Protein Family IF06173

Metagenome Isolate
375 Members
119 Samples
331 Scaffolds
196.35 Avg Length

🧬 Representative Sequence

ID
3300042603|Ga0466714_013796|Ga0466714_013796_1695_2405
Length
236 aa
Sequence
MLLYEKLNPYRIILASGSPRRRQLLKDAGIAYELAEGYEVEEVFPASLPVEQVPVYLSELKSAAYPNELSSKEILITADTVVCLHGALIGKPEDRADAVAILGRLSANRHTVVTGVTLRTAGRKKSFSVHSDVFFRKLTGEEIDWYVDTYRPFDKAGAYGVQEWIGYVGIERIEGSFYNVMGLPVQRLYLELDEFLAAFTQNNGEEMNNLDAIIAVGHSPAGAISSFLYGCRPFGA

πŸ“Š Sample Types

Isolate 11.7%
Metagenome 88.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 25.5%
Blattidae 20.0%
Unclassified 12.7%
Kalotermitidae 12.7%
Formicidae 8.2%
Drosophilidae 5.5%
Rhinotermitidae 3.6%
Termopsidae 3.6%
Armadillidiidae 2.7%
Passalidae 1.8%
Hodotermitidae 0.9%
Tenebrionidae 0.9%
Cambaridae 0.9%
Bombycidae 0.9%

🌳 Taxonomy

Archaea 1
Bacteria 361
Eukaryota 0
Viruses 0
Unclassified 13

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 2882250448 Bizionia sp. APA-3 Isolate
3 2923982719 Parabacteroides sp. 52 Isolate Blattidae
4 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
5 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
6 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
7 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
12 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
13 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
14 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
22 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 2896350215 Sphingobacterium sp. xlx-183 Isolate
25 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
26 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
27 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
28 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
29 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
30 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
31 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
32 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
33 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
34 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
35 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
36 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
37 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
38 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
39 2898741527 Sphingobacterium sp. xlx-73 Isolate
40 2904728850 Flavobacterium sp. xlx-214 Isolate
41 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
42 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
43 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
44 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
45 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
46 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
47 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
48 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
49 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
50 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
51 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
52 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
53 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
54 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
55 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
56 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
57 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
58 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
59 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
60 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
61 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
62 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
63 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
64 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
65 3300005307 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut Metagenome Drosophilidae
66 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
67 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
68 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
69 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
70 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
71 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
72 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
73 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
74 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
75 2896321640 Sphingobacterium sp. xlx-130 Isolate
76 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
77 2922326829 Bacteroides sp. 224 Isolate Blattidae
78 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
79 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
80 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
81 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
82 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
83 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
84 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
85 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
86 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
87 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
88 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
89 2896330536 Sphingobacterium sp. xlx-96 Isolate
90 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
91 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
92 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
93 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
94 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
95 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
96 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
97 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
98 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
99 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
100 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
101 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
102 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
103 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
104 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
105 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
106 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
107 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
108 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
109 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
110 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
111 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
112 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
113 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
114 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
115 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
116 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
117 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
118 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
119 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_033650 3300042612 Bacteria 6830
2 Ga0466705_084401 3300042612 Bacteria 19488
3 Ga0160469_102018 3300012824 Bacteria 4339
4 Ga0466690_021291 3300042590 Bacteria 1465
5 Ga0466690_059292 3300042590 Bacteria 6987
6 Ga0466690_339386 3300042590 Bacteria 6419
7 Ga0466691_076199 3300042593 Bacteria 5074
8 Ga0466696_108775 3300042596 Bacteria 27757
9 Ga0466696_257240 3300042596 Bacteria 7789
10 Ga0466699_378655 3300042597 Bacteria 2402
11 Ga0123356_10059865 3300010049 Bacteria 3553
12 Ga0466707_053900 3300042601 Bacteria 1496
13 Ga0466707_112594 3300042601 Bacteria 1387
14 Ga0466707_180781 3300042601 Bacteria 11649
15 Ga0466714_009109 3300042603 Bacteria 7353
16 Ga0466714_021809 3300042603 Bacteria 2126
17 Ga0466714_037214 3300042603 Bacteria 1367
18 Ga0466714_061940 3300042603 Bacteria 1746
19 Ga0466716_484962 3300042605 Bacteria 1803
20 Ga0466719_517237 3300042606 Bacteria 14063
21 IMNBL1DRAFT_c0035606 3300000062 Bacteria 1752
22 IMNBL1DRAFT_c0097826 3300000062 Bacteria 794
23 JGI24699J35502_11133850 3300002509 Bacteria 17080
24 JGI24699J35502_11133885 3300002509 Bacteria 18160
25 JGI24699J35502_11134211 3300002509 Bacteria 60442
26 JGI24696J40584_12949749 3300002834 Bacteria 2097
27 CVPL010W_10000609 3300002931 Bacteria 39279
28 Ga0068305_10749342 3300005083 Bacteria 3167
29 Ga0072941_1100666 3300005201 Bacteria 3047
30 Ga0102739_1000086 3300007095 Bacteria 25596
31 Ga0105005_1014017 3300007505 Bacteria 9419
32 Ga0466703_046406 3300042636 Bacteria 4720
33 Ga0466703_280503 3300042636 Bacteria 24175
34 Ga0466704_102348 3300042643 Bacteria 9428
35 Ga0466704_244636 3300042643 Bacteria 19020
36 Ga0466727_339815 3300042655 Bacteria 1519
37 Ga0466710_108507 3300042613 Bacteria 1503
38 Ga0466710_443636 3300042613 Bacteria 4223
39 Ga0466715_346793 3300042616 Bacteria 22249
40 Ga0466728_420477 3300042620 Bacteria 25205
41 Ga0466729_176883 3300042621 Bacteria 2062
42 Ga0466697_137236 3300042611 Bacteria 1464
43 Ga0466705_035441 3300042612 Bacteria 6678
44 Ga0466705_123350 3300042612 Bacteria 4905
45 Ga0466732_369489 3300042656 Bacteria 1916
46 Ga0466690_235471 3300042590 Bacteria 5779
47 Ga0466691_179806 3300042593 Bacteria 1512
48 Ga0123356_10561778 3300010049 Bacteria 1303
49 Ga0123353_10163207 3300010167 Bacteria 3545
50 Ga0123354_10017809 3300010882 Bacteria 11129
51 Ga0466701_080572 3300042598 Bacteria 2148
52 Ga0466706_065473 3300042599 Bacteria 19318
53 Ga0466706_147365 3300042599 Bacteria 6178
54 Ga0466707_148566 3300042601 Bacteria 35043
55 Ga0466713_152770 3300042602 Unclassified 1238
56 Ga0466714_012858 3300042603 Bacteria 3360
57 Ga0466714_013796 3300042603 Bacteria 3571
58 Ga0466722_164674 3300042609 Bacteria 8708
59 Ga0072940_1075433 3300005200 Bacteria 1400
60 Ga0072941_1281331 3300005201 Bacteria 1695
61 Ga0103265_1000203 3300007068 Bacteria 10195
62 Ga0102737_1000105 3300007142 Unclassified 26195
63 Ga0104050_1000547 3300007153 Bacteria 2576
64 Ga0466731_337031 3300042622 Bacteria 1187
65 Ga0466702_108766 3300042635 Bacteria 1258
66 Ga0466703_218033 3300042636 Bacteria 11419
67 Ga0466703_232938 3300042636 Bacteria 8340
68 Ga0466724_21956 3300042649 Bacteria 426457
69 Ga0466708_095033 3300042652 Bacteria 42990
70 Ga0466708_152954 3300042652 Bacteria 7432
71 Ga0466727_333421 3300042655 Bacteria 6624
72 Ga0466705_510664 3300042612 Bacteria 7836
73 Ga0466711_071713 3300042615 Bacteria 4080
74 Ga0466715_223437 3300042616 Bacteria 30992
75 Ga0466728_284109 3300042620 Bacteria 4870
76 Ga0466728_347669 3300042620 Bacteria 1232
77 Ga0466733_067642 3300042659 Bacteria 12444
78 Ga0466733_147774 3300042659 Bacteria 3245
79 Ga0466733_209000 3300042659 Bacteria 10317
80 Ga0160433_100138 3300012846 Unclassified 64982
81 Ga0265387_1001377 3300024582 Bacteria 3557
82 Ga0466690_053116 3300042590 Bacteria 3969
83 Ga0466693_306053 3300042592 Bacteria 1196
84 Ga0466691_017420 3300042593 Bacteria 2231
85 Ga0466696_502627 3300042596 Archaea 4358
86 Ga0123354_10005802 3300010882 Bacteria 18105
87 Ga0466701_027194 3300042598 Bacteria 1506
88 Ga0466701_093209 3300042598 Bacteria 69353
89 Ga0466706_154769 3300042599 Bacteria 8287
90 Ga0466706_204359 3300042599 Bacteria 22058
91 Ga0466700_002804 3300042600 Bacteria 7874
92 Ga0466707_291066 3300042601 Bacteria 10923
93 Ga0466713_131527 3300042602 Bacteria 55397
94 Ga0466714_035388 3300042603 Bacteria 1872
95 2227513552 2225789004 Bacteria 3501
96 2227576578 2225789004 Bacteria 2555
97 IMNBL1DRAFT_c0005969 3300000062 Bacteria 6805
98 IMNBL1DRAFT_c0011476 3300000062 Bacteria 4134
99 JGI24702J35022_10362811 3300002462 Bacteria 868
100 Ga0102740_1000548 3300007140 Bacteria 10278
101 Ga0104050_1002864 3300007153 Bacteria 4054
102 Ga0466704_104502 3300042643 Bacteria 10368
103 Ga0466704_364071 3300042643 Bacteria 2459
104 Ga0466708_065430 3300042652 Bacteria 25041
105 Ga0466727_263308 3300042655 Bacteria 66130
106 Ga0466705_461320 3300042612 Bacteria 10068
107 Ga0466711_094091 3300042615 Bacteria 4686
108 Ga0466711_160184 3300042615 Bacteria 13975
109 Ga0466715_383243 3300042616 Unclassified 3357
110 Ga0466723_127458 3300042618 Bacteria 5164
111 Ga0466723_173974 3300042618 Bacteria 14831
112 Ga0466728_064136 3300042620 Bacteria 50421
113 Ga0466728_306930 3300042620 Bacteria 116996
114 Ga0466705_130292 3300042612 Bacteria 9509
115 Ga0466705_357512 3300042612 Bacteria 2076
116 Ga0466732_440629 3300042656 Bacteria 1160
117 Ga0160433_108634 3300012846 Bacteria 1361
118 Ga0466690_089085 3300042590 Bacteria 7131
119 Ga0466690_125536 3300042590 Bacteria 1457
120 Ga0466692_006453 3300042591 Bacteria 14043
121 Ga0466692_099787 3300042591 Bacteria 3510
122 Ga0466694_010907 3300042594 Bacteria 2297
123 Ga0123357_10639626 3300009784 Bacteria 794
124 Ga0123353_10019714 3300010167 Bacteria 10036
125 Ga0123353_10740838 3300010167 Bacteria 1370
126 Ga0123353_10756515 3300010167 Bacteria 1351
127 Ga0123354_10137783 3300010882 Bacteria 3040
128 Ga0123354_10191136 3300010882 Bacteria 2291
129 Ga0466706_120960 3300042599 Bacteria 15301
130 Ga0466700_119367 3300042600 Bacteria 51339
131 Ga0466700_143177 3300042600 Bacteria 14060
132 Ga0466700_264674 3300042600 Bacteria 1634
133 Ga0466713_026892 3300042602 Bacteria 11456
134 Ga0466713_059440 3300042602 Bacteria 68698
135 Ga0466714_028328 3300042603 Bacteria 1323
136 Ga0466714_136077 3300042603 Bacteria 139396
137 Ga0466717_210722 3300042604 Unclassified 3597
138 Ga0466716_107962 3300042605 Bacteria 2751
139 Ga0466719_243643 3300042606 Bacteria 21193
140 Ga0466719_311544 3300042606 Bacteria 4073
141 Ga0466722_088000 3300042609 Bacteria 12671
142 2227275225 2225789004 Bacteria 30519
143 2227303002 2225789004 Bacteria 29616
144 IMNBL1DRAFT_c0000785 3300000062 Bacteria 25114
145 IMNBL1DRAFT_c0001109 3300000062 Bacteria 20634
146 IMNBL1DRAFT_c0037684 3300000062 Bacteria 1672
147 JGI24702J35022_10005614 3300002462 Unclassified 7317
148 Ga0068305_10036533 3300005083 Bacteria 46563
149 Ga0102735_1000235 3300007080 Bacteria 19488
150 Ga0104050_1003883 3300007153 Bacteria 3489
151 Ga0466704_412311 3300042643 Bacteria 7105
152 Ga0466708_400273 3300042652 Bacteria 55189
153 Ga0466727_306287 3300042655 Bacteria 8716
154 Ga0466727_342338 3300042655 Unclassified 2370
155 Ga0466711_088394 3300042615 Bacteria 6324
156 Ga0466711_128935 3300042615 Bacteria 5191
157 Ga0466711_173885 3300042615 Bacteria 5019
158 Ga0466723_220384 3300042618 Bacteria 2810
159 Ga0466723_271308 3300042618 Bacteria 19297
160 Ga0466690_171518 3300042590 Bacteria 4140
161 Ga0466691_164143 3300042593 Bacteria 2309
162 Ga0466694_012704 3300042594 Unclassified 2311
163 Ga0466696_010079 3300042596 Bacteria 13527
164 Ga0466696_254260 3300042596 Bacteria 24185
165 Ga0123357_10062418 3300009784 Bacteria 4989
166 Ga0123353_10004979 3300010167 Bacteria 17306
167 Ga0123353_11307660 3300010167 Bacteria 941
168 Ga0123354_10045541 3300010882 Bacteria 6713
169 Ga0123354_10122526 3300010882 Bacteria 3346
170 Ga0123354_10146620 3300010882 Bacteria 2885
171 Ga0466701_071564 3300042598 Bacteria 4629
172 Ga0466701_101758 3300042598 Bacteria 95224
173 Ga0466706_085050 3300042599 Bacteria 34505
174 Ga0466706_089391 3300042599 Bacteria 6268
175 Ga0466706_160827 3300042599 Bacteria 31004
176 Ga0466714_030409 3300042603 Bacteria 3435
177 Ga0466714_035266 3300042603 Bacteria 2406
178 Ga0466714_126469 3300042603 Bacteria 66148
179 Ga0466716_214791 3300042605 Bacteria 2978
180 Ga0466716_449927 3300042605 Bacteria 4158
181 Ga0466721_073227 3300042608 Bacteria 2303
182 Ga0466722_123554 3300042609 Bacteria 11164
183 IMNBL1DRAFT_c0000056 3300000062 Bacteria 106919
184 IMNBL1DRAFT_c0021664 3300000062 Bacteria 2565
185 IMNBL1DRAFT_c0052760 3300000062 Bacteria 1272
186 JGI24702J35022_10269611 3300002462 Bacteria 996
187 Ga0068305_10851235 3300005083 Bacteria 2630
188 Ga0104045_1008575 3300007085 Bacteria 2211
189 Ga0102734_1000175 3300007129 Bacteria 20528
190 Ga0104019_1196940 3300007150 Bacteria 1112
191 Ga0103267_1023028 3300007190 Bacteria 2061
192 Ga0466729_215074 3300042621 Bacteria 2329
193 Ga0466735_107458 3300042624 Bacteria 3137
194 Ga0466703_122128 3300042636 Bacteria 7487
195 Ga0466703_131731 3300042636 Bacteria 7138
196 Ga0466703_352187 3300042636 Bacteria 1404
197 Ga0466704_269820 3300042643 Bacteria 13523
198 Ga0466708_170849 3300042652 Bacteria 4371
199 Ga0466708_405823 3300042652 Bacteria 2161
200 Ga0466712_124664 3300042614 Bacteria 2034
201 Ga0466711_155701 3300042615 Bacteria 12048
202 Ga0466711_210957 3300042615 Bacteria 3626
203 Ga0466711_308491 3300042615 Bacteria 3441
204 Ga0466718_093822 3300042617 Bacteria 1097
205 Ga0466723_092677 3300042618 Bacteria 22716
206 Ga0466726_056744 3300042619 Bacteria 6981
207 Ga0466726_141993 3300042619 Bacteria 7655
208 Ga0466705_007182 3300042612 Bacteria 4015
209 Ga0466732_082485 3300042656 Bacteria 3369
210 Ga0466733_165942 3300042659 Bacteria 49543
211 Ga0466733_210826 3300042659 Bacteria 17624
212 Ga0264413_156640 3300024493 Bacteria 2315
213 Ga0466690_332773 3300042590 Bacteria 19205
214 Ga0466692_146653 3300042591 Bacteria 22871
215 Ga0123357_10518762 3300009784 Bacteria 975
216 Ga0123353_10001135 3300010167 Bacteria 32414
217 Ga0123353_10010485 3300010167 Bacteria 12920
218 Ga0123353_10565167 3300010167 Bacteria 1636
219 Ga0466701_021293 3300042598 Bacteria 1025
220 Ga0466706_004062 3300042599 Bacteria 54084
221 Ga0466707_314308 3300042601 Bacteria 31979
222 Ga0466707_322321 3300042601 Bacteria 10124
223 Ga0466713_072003 3300042602 Bacteria 72866
224 Ga0466716_441168 3300042605 Bacteria 7504
225 JGI24699J35502_11032248 3300002509 Bacteria 1518
226 Ga0068302_10473375 3300005071 Bacteria 2412
227 Ga0072941_1069700 3300005201 Bacteria 1432
228 Ga0104048_1001397 3300007143 Bacteria 3070
229 Ga0466703_058087 3300042636 Bacteria 19917
230 Ga0466703_129766 3300042636 Bacteria 1993
231 Ga0466703_272532 3300042636 Bacteria 2223
232 Ga0466704_010086 3300042643 Bacteria 24092
233 Ga0466704_011881 3300042643 Bacteria 7344
234 Ga0466704_207225 3300042643 Bacteria 4244
235 Ga0466709_226395 3300042648 Bacteria 1781
236 Ga0466709_227908 3300042648 Bacteria 46017
237 Ga0466724_13241 3300042649 Bacteria 17212
238 Ga0466724_53539 3300042649 Bacteria 21378
239 Ga0466727_301265 3300042655 Bacteria 1583
240 Ga0466711_079239 3300042615 Bacteria 1680
241 Ga0466711_330587 3300042615 Bacteria 18688
242 Ga0466715_146421 3300042616 Bacteria 7253
243 Ga0466715_329130 3300042616 Bacteria 55839
244 Ga0466728_182332 3300042620 Bacteria 20539
245 Ga0466705_175096 3300042612 Bacteria 32654
246 Ga0466733_121761 3300042659 Bacteria 8528
247 Ga0466733_219698 3300042659 Bacteria 12162
248 Ga0160457_1006047 3300012858 Bacteria 1810
249 Ga0466692_160536 3300042591 Bacteria 1629
250 Ga0466696_146362 3300042596 Bacteria 19783
251 Ga0466696_259711 3300042596 Bacteria 25289
252 Ga0123353_10000019 3300010167 Bacteria 185006
253 Ga0123353_10007698 3300010167 Bacteria 14609
254 Ga0123353_11552061 3300010167 Bacteria 840
255 Ga0123353_11663731 3300010167 Bacteria 802
256 Ga0123354_10085643 3300010882 Bacteria 4413
257 Ga0466706_171356 3300042599 Bacteria 1817
258 Ga0466706_178052 3300042599 Bacteria 1852
259 Ga0466706_209610 3300042599 Bacteria 69562
260 Ga0466707_083114 3300042601 Bacteria 16238
261 Ga0466713_122827 3300042602 Bacteria 174567
262 Ga0466713_149763 3300042602 Bacteria 1851
263 Ga0466714_019482 3300042603 Bacteria 68715
264 Ga0466714_023572 3300042603 Bacteria 1522
265 Ga0466714_072816 3300042603 Bacteria 12417
266 Ga0466716_102169 3300042605 Bacteria 3124
267 Ga0466719_149177 3300042606 Bacteria 5068
268 Ga0466721_269998 3300042608 Bacteria 1553
269 Ga0466722_176901 3300042609 Bacteria 2334
270 Ga0466697_000635 3300042611 Bacteria 14006
271 2227572434 2225789004 Unclassified 2599
272 IMNBL1DRAFT_c0000270 3300000062 Bacteria 45954
273 IMNBL1DRAFT_c0007048 3300000062 Bacteria 5991
274 IMNBL1DRAFT_c0018331 3300000062 Bacteria 2914
275 IMNBL1DRAFT_c0019372 3300000062 Bacteria 2791
276 JGI24702J35022_10026581 3300002462 Unclassified 3117
277 Ga0074308_1113623 3300005307 Unclassified 3100
278 Ga0104048_1000353 3300007143 Bacteria 6229
279 Ga0466730_081936 3300042625 Bacteria 13722
280 Ga0466703_040466 3300042636 Bacteria 5498
281 Ga0466703_162055 3300042636 Bacteria 3688
282 Ga0466703_336984 3300042636 Bacteria 4790
283 Ga0466703_385403 3300042636 Bacteria 1712
284 Ga0466704_120956 3300042643 Bacteria 12850
285 Ga0466708_050428 3300042652 Bacteria 5173
286 Ga0466711_117298 3300042615 Bacteria 1467
287 Ga0466711_122031 3300042615 Bacteria 2175
288 Ga0466711_145131 3300042615 Bacteria 39663
289 Ga0466711_239934 3300042615 Bacteria 17196
290 Ga0466715_033953 3300042616 Bacteria 34236
291 Ga0466715_090334 3300042616 Bacteria 8566
292 Ga0466715_615123 3300042616 Bacteria 1067
293 Ga0466723_039913 3300042618 Bacteria 8162
294 Ga0466723_079245 3300042618 Bacteria 12025
295 Ga0466726_115726 3300042619 Bacteria 4824
296 Ga0466728_122844 3300042620 Bacteria 12635
297 Ga0466729_149369 3300042621 Bacteria 2443
298 Ga0466733_066683 3300042659 Bacteria 2488
299 Ga0466692_110056 3300042591 Bacteria 56697
300 Ga0466692_122966 3300042591 Bacteria 22698
301 Ga0466691_216784 3300042593 Bacteria 3334
302 Ga0466696_081230 3300042596 Bacteria 3724
303 Ga0466696_218381 3300042596 Bacteria 1926
304 Ga0466696_366704 3300042596 Bacteria 7882
305 Ga0466696_467012 3300042596 Bacteria 2282
306 Ga0123355_10474232 3300009826 Bacteria 1561
307 Ga0123353_10151234 3300010167 Bacteria 3706
308 Ga0123353_10174601 3300010167 Bacteria 3408
309 Ga0123353_11492581 3300010167 Bacteria 862
310 Ga0123354_10033083 3300010882 Bacteria 8096
311 Ga0466701_046108 3300042598 Bacteria 2403
312 Ga0466706_076331 3300042599 Bacteria 34187
313 Ga0466714_090093 3300042603 Bacteria 1167
314 2227504085 2225789004 Unclassified 3724
315 2227662667 2225789004 Bacteria 1940
316 IMNBL1DRAFT_c0000216 3300000062 Bacteria 50594
317 IMNBL1DRAFT_c0017398 3300000062 Bacteria 3026
318 JGI24705J35276_12200672 3300002504 Bacteria 1606
319 Ga0072941_1082653 3300005201 Bacteria 7704
320 Ga0104045_1002382 3300007085 Bacteria 5323
321 Ga0103267_1000966 3300007190 Bacteria 7222
322 Ga0103268_1000215 3300007192 Bacteria 19226
323 Ga0123357_10000306 3300009784 Bacteria 46839
324 Ga0466735_091998 3300042624 Bacteria 2126
325 Ga0466704_015140 3300042643 Bacteria 23812
326 Ga0466709_121677 3300042648 Unclassified 2233
327 Ga0466709_252452 3300042648 Bacteria 8786
328 Ga0466708_168769 3300042652 Bacteria 4264
329 Ga0466715_001888 3300042616 Bacteria 2020
330 Ga0466715_161468 3300042616 Bacteria 1061
331 Ga0466729_194578 3300042621 Bacteria 12153

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042602 Ga0466713_152770 Ga0466713_152770_58_540 160
2 3300042594 Ga0466694_012704 Ga0466694_012704_1581_2087 168
3 3300042636 Ga0466703_058087 Ga0466703_058087_6013_6603 170
4 3300042604 Ga0466717_210722 Ga0466717_210722_2655_3170 171
5 3300042659 Ga0466733_219698 Ga0466733_219698_11271_11786 171
6 3300002462 JGI24702J35022_10026581 JGI24702J35022_100265815 173
7 3300042612 Ga0466705_130292 Ga0466705_130292_8672_9193 173
8 3300042643 Ga0466704_269820 Ga0466704_269820_2746_3267 173
9 3300042648 Ga0466709_121677 Ga0466709_121677_578_1105 175
10 3300042616 Ga0466715_001888 Ga0466715_001888_669_1277 176
11 3300042608 Ga0466721_073227 Ga0466721_073227_336_875 179
12 3300042618 Ga0466723_127458 Ga0466723_127458_1545_2171 180
13 3300042608 Ga0466721_269998 Ga0466721_269998_718_1266 182
14 3300042615 Ga0466711_079239 Ga0466711_079239_728_1294 188
15 3300000062 IMNBL1DRAFT_c0021664 IMNBL1DRAFT_00216643 189
16 3300010049 Ga0123356_10059865 Ga0123356_100598652 189
17 3300042601 Ga0466707_148566 Ga0466707_148566_34229_34798 189
18 3300042615 Ga0466711_117298 Ga0466711_117298_837_1406 189
19 3300042655 Ga0466727_339815 Ga0466727_339815_775_1344 189
20 3300042655 Ga0466727_342338 Ga0466727_342338_435_1004 189
21 3300002462 JGI24702J35022_10362811 JGI24702J35022_103628112 190
22 3300042590 Ga0466690_235471 Ga0466690_235471_1234_1806 190
23 3300042596 Ga0466696_257240 Ga0466696_257240_511_1083 190
24 3300042596 Ga0466696_502627 Ga0466696_502627_292_864 190
25 3300042598 Ga0466701_071564 Ga0466701_071564_2906_3478 190
26 3300042602 Ga0466713_059440 Ga0466713_059440_48920_49492 190
27 3300042602 Ga0466713_131527 Ga0466713_131527_31466_32038 190
28 3300042602 Ga0466713_149763 Ga0466713_149763_960_1532 190
29 3300042612 Ga0466705_084401 Ga0466705_084401_5371_5943 190
30 3300042615 Ga0466711_122031 Ga0466711_122031_817_1389 190
31 3300042616 Ga0466715_161468 Ga0466715_161468_308_880 190
32 3300042622 Ga0466731_337031 Ga0466731_337031_113_685 190
33 3300042652 Ga0466708_152954 Ga0466708_152954_4064_4636 190
34 iso_pr_bacteria 2695420931 2698110403 190
35 2225789004 2227576578 2228125422 191
36 3300009784 Ga0123357_10639626 Ga0123357_106396261 191
37 3300010882 Ga0123354_10085643 Ga0123354_100856435 191
38 3300042596 Ga0466696_366704 Ga0466696_366704_241_837 191
39 3300042603 Ga0466714_035388 Ga0466714_035388_523_1098 191
40 3300042615 Ga0466711_088394 Ga0466711_088394_1281_1856 191
41 3300042616 Ga0466715_346793 Ga0466715_346793_194_769 191
42 3300042655 Ga0466727_333421 Ga0466727_333421_5092_5667 191
43 3300042659 Ga0466733_210826 Ga0466733_210826_12218_12793 191
44 iso_pr_bacteria 2922326829 2922326964 191
45 3300002462 JGI24702J35022_10269611 JGI24702J35022_102696112 192
46 3300010167 Ga0123353_10163207 Ga0123353_101632074 192
47 3300042591 Ga0466692_110056 Ga0466692_110056_49882_50460 192
48 3300042596 Ga0466696_081230 Ga0466696_081230_2093_2671 192
49 3300042596 Ga0466696_259711 Ga0466696_259711_13822_14400 192
50 3300042598 Ga0466701_021293 Ga0466701_021293_321_899 192
51 3300042602 Ga0466713_122827 Ga0466713_122827_96032_96610 192
52 3300042603 Ga0466714_136077 Ga0466714_136077_5060_5638 192
53 iso_pr_bacteria 2940244548 2940248213 192
54 iso_pr_bacteria 2940248789 2940252389 192
55 iso_pr_bacteria 2940253009 2940256625 192
56 iso_pr_bacteria 2940257232 2940260778 192
57 2225789004 2227303002 2227752976 193
58 3300042590 Ga0466690_089085 Ga0466690_089085_5624_6205 193
59 3300042590 Ga0466690_332773 Ga0466690_332773_8147_8728 193
60 3300042593 Ga0466691_017420 Ga0466691_017420_985_1566 193
61 3300042593 Ga0466691_216784 Ga0466691_216784_807_1433 193
62 3300042596 Ga0466696_108775 Ga0466696_108775_5287_5868 193
63 3300042599 Ga0466706_178052 Ga0466706_178052_1174_1755 193
64 3300042603 Ga0466714_028328 Ga0466714_028328_447_1028 193
65 3300042606 Ga0466719_517237 Ga0466719_517237_295_876 193
66 3300042612 Ga0466705_035441 Ga0466705_035441_850_1431 193
67 3300042613 Ga0466710_443636 Ga0466710_443636_1891_2472 193
68 3300042615 Ga0466711_094091 Ga0466711_094091_3763_4344 193
69 3300042615 Ga0466711_128935 Ga0466711_128935_888_1469 193
70 3300042615 Ga0466711_160184 Ga0466711_160184_3600_4181 193
71 3300042615 Ga0466711_173885 Ga0466711_173885_4096_4677 193
72 3300042615 Ga0466711_239934 Ga0466711_239934_11892_12473 193
73 3300042615 Ga0466711_308491 Ga0466711_308491_2250_2831 193
74 3300042616 Ga0466715_329130 Ga0466715_329130_35681_36262 193
75 3300042620 Ga0466728_284109 Ga0466728_284109_1130_1711 193
76 3300042621 Ga0466729_194578 Ga0466729_194578_3589_4170 193
77 3300042636 Ga0466703_218033 Ga0466703_218033_5367_5948 193
78 3300042643 Ga0466704_102348 Ga0466704_102348_6029_6610 193
79 3300042643 Ga0466704_104502 Ga0466704_104502_6238_6819 193
80 3300042643 Ga0466704_364071 Ga0466704_364071_880_1461 193
81 3300042649 Ga0466724_13241 Ga0466724_13241_8006_8587 193
82 3300042652 Ga0466708_065430 Ga0466708_065430_18502_19083 193
83 iso_pr_bacteria 2609459943 2610741076 193
84 iso_pr_bacteria 2820762746 2820764985 193
85 iso_pr_bacteria 2830041218 2830041930 193
86 iso_pr_bacteria 2904728850 2904731832 193
87 iso_pr_bacteria 2940205530 2940208844 193
88 iso_pr_bacteria 2940212447 2940215759 193
89 iso_pr_bacteria 2940216256 2940218039 193
90 iso_pr_bacteria 2940298504 2940301812 193
91 iso_pr_bacteria 2940302308 2940305614 193
92 iso_pr_bacteria 2940306115 2940309424 193
93 iso_pr_bacteria 2940309933 2940313261 193
94 iso_pr_bacteria 2940313741 2940317076 193
95 iso_pr_bacteria 2940317558 2940320889 193
96 iso_pr_bacteria 2940321370 2940324646 193
97 iso_pr_bacteria 2940325180 2940328484 193
98 iso_pr_bacteria 2940328985 2940332291 193
99 iso_pr_bacteria 2940332795 2940336127 193
100 iso_pr_bacteria 2940371297 2940371611 193
101 iso_pr_bacteria 2958471994 2958475101 193
102 2225789004 2227513552 2228010328 194
103 2225789004 2227572434 2228118612 194
104 3300000062 IMNBL1DRAFT_c0000056 IMNBL1DRAFT_000005699 194
105 3300002509 JGI24699J35502_11134211 JGI24699J35502_1113421141 194
106 3300009784 Ga0123357_10518762 Ga0123357_105187622 194
107 3300010167 Ga0123353_11492581 Ga0123353_114925811 194
108 3300042591 Ga0466692_160536 Ga0466692_160536_426_1010 194
109 3300042598 Ga0466701_080572 Ga0466701_080572_143_727 194
110 3300042599 Ga0466706_154769 Ga0466706_154769_4983_5567 194
111 3300042601 Ga0466707_180781 Ga0466707_180781_1589_2173 194
112 3300042606 Ga0466719_311544 Ga0466719_311544_2061_2645 194
113 3300042612 Ga0466705_461320 Ga0466705_461320_6090_6674 194
114 3300042616 Ga0466715_146421 Ga0466715_146421_5148_5732 194
115 3300042619 Ga0466726_115726 Ga0466726_115726_1892_2476 194
116 3300042621 Ga0466729_215074 Ga0466729_215074_351_935 194
117 3300042655 Ga0466727_301265 Ga0466727_301265_772_1356 194
118 3300042656 Ga0466732_440629 Ga0466732_440629_384_968 194
119 3300042659 Ga0466733_067642 Ga0466733_067642_11569_12153 194
120 iso_pr_bacteria 2940202316 2940203458 194
121 2225789004 2227662667 2228263954 195
122 3300000062 IMNBL1DRAFT_c0000785 IMNBL1DRAFT_00007857 195
123 3300000062 IMNBL1DRAFT_c0007048 IMNBL1DRAFT_00070484 195
124 3300000062 IMNBL1DRAFT_c0037684 IMNBL1DRAFT_00376842 195
125 3300000062 IMNBL1DRAFT_c0097826 IMNBL1DRAFT_00978261 195
126 3300002931 CVPL010W_10000609 CVPL010W_100006093 195
127 3300007095 Ga0102739_1000086 Ga0102739_10000862 195
128 3300007140 Ga0102740_1000548 Ga0102740_10005488 195
129 3300007143 Ga0104048_1000353 Ga0104048_10003534 195
130 3300007143 Ga0104048_1001397 Ga0104048_10013972 195
131 3300007153 Ga0104050_1002864 Ga0104050_10028644 195
132 3300007190 Ga0103267_1023028 Ga0103267_10230282 195
133 3300007192 Ga0103268_1000215 Ga0103268_10002156 195
134 3300042590 Ga0466690_059292 Ga0466690_059292_4692_5279 195
135 3300042590 Ga0466690_171518 Ga0466690_171518_1440_2027 195
136 3300042591 Ga0466692_006453 Ga0466692_006453_12038_12625 195
137 3300042591 Ga0466692_146653 Ga0466692_146653_15383_15970 195
138 3300042592 Ga0466693_306053 Ga0466693_306053_255_842 195
139 3300042596 Ga0466696_146362 Ga0466696_146362_7524_8111 195
140 3300042596 Ga0466696_218381 Ga0466696_218381_1083_1670 195
141 3300042598 Ga0466701_093209 Ga0466701_093209_11187_11774 195
142 3300042598 Ga0466701_101758 Ga0466701_101758_22316_22903 195
143 3300042599 Ga0466706_065473 Ga0466706_065473_6845_7432 195
144 3300042599 Ga0466706_160827 Ga0466706_160827_6332_6919 195
145 3300042600 Ga0466700_002804 Ga0466700_002804_2101_2688 195
146 3300042600 Ga0466700_119367 Ga0466700_119367_20403_20990 195
147 3300042600 Ga0466700_143177 Ga0466700_143177_13202_13789 195
148 3300042602 Ga0466713_026892 Ga0466713_026892_10746_11333 195
149 3300042602 Ga0466713_072003 Ga0466713_072003_64078_64665 195
150 3300042605 Ga0466716_214791 Ga0466716_214791_1162_1749 195
151 3300042605 Ga0466716_484962 Ga0466716_484962_372_959 195
152 3300042606 Ga0466719_149177 Ga0466719_149177_2278_2865 195
153 3300042609 Ga0466722_088000 Ga0466722_088000_2736_3323 195
154 3300042612 Ga0466705_007182 Ga0466705_007182_2187_2774 195
155 3300042612 Ga0466705_510664 Ga0466705_510664_3353_3940 195
156 3300042616 Ga0466715_223437 Ga0466715_223437_25255_25842 195
157 3300042618 Ga0466723_079245 Ga0466723_079245_2459_3046 195
158 3300042618 Ga0466723_271308 Ga0466723_271308_354_941 195
159 3300042620 Ga0466728_122844 Ga0466728_122844_1534_2121 195
160 3300042621 Ga0466729_176883 Ga0466729_176883_512_1099 195
161 3300042636 Ga0466703_046406 Ga0466703_046406_1091_1678 195
162 3300042643 Ga0466704_120956 Ga0466704_120956_3689_4276 195
163 3300042643 Ga0466704_412311 Ga0466704_412311_4468_5055 195
164 3300042649 Ga0466724_21956 Ga0466724_21956_414342_414929 195
165 3300042652 Ga0466708_168769 Ga0466708_168769_1575_2162 195
166 3300042655 Ga0466727_263308 Ga0466727_263308_20206_20793 195
167 3300042655 Ga0466727_306287 Ga0466727_306287_885_1472 195
168 iso_pr_bacteria 2820759988 2820760994 195
169 iso_pr_bacteria 2899132286 2899134403 195
170 2225789004 2227504085 2227989839 196
171 3300000062 IMNBL1DRAFT_c0000216 IMNBL1DRAFT_000021625 196
172 3300000062 IMNBL1DRAFT_c0017398 IMNBL1DRAFT_00173985 196
173 3300002509 JGI24699J35502_11032248 JGI24699J35502_110322481 196
174 3300002509 JGI24699J35502_11133850 JGI24699J35502_1113385012 196
175 3300002509 JGI24699J35502_11133885 JGI24699J35502_1113388510 196
176 3300005083 Ga0068305_10036533 Ga0068305_1003653326 196
177 3300005083 Ga0068305_10851235 Ga0068305_108512352 196
178 3300005201 Ga0072941_1281331 Ga0072941_12813312 196
179 3300005307 Ga0074308_1113623 Ga0074308_11136235 196
180 3300007085 Ga0104045_1002382 Ga0104045_10023823 196
181 3300007150 Ga0104019_1196940 Ga0104019_11969402 196
182 3300007153 Ga0104050_1000547 Ga0104050_10005472 196
183 3300007153 Ga0104050_1003883 Ga0104050_10038833 196
184 3300010167 Ga0123353_11307660 Ga0123353_113076602 196
185 3300010882 Ga0123354_10005802 Ga0123354_1000580213 196
186 3300010882 Ga0123354_10017809 Ga0123354_100178093 196
187 3300010882 Ga0123354_10045541 Ga0123354_100455415 196
188 3300010882 Ga0123354_10191136 Ga0123354_101911362 196
189 3300024582 Ga0265387_1001377 Ga0265387_10013772 196
190 3300042590 Ga0466690_021291 Ga0466690_021291_440_1030 196
191 3300042591 Ga0466692_099787 Ga0466692_099787_1511_2101 196
192 3300042593 Ga0466691_164143 Ga0466691_164143_30_620 196
193 3300042593 Ga0466691_179806 Ga0466691_179806_231_821 196
194 3300042596 Ga0466696_010079 Ga0466696_010079_873_1463 196
195 3300042596 Ga0466696_254260 Ga0466696_254260_21671_22261 196
196 3300042596 Ga0466696_467012 Ga0466696_467012_75_665 196
197 3300042597 Ga0466699_378655 Ga0466699_378655_555_1145 196
198 3300042598 Ga0466701_027194 Ga0466701_027194_256_846 196
199 3300042598 Ga0466701_046108 Ga0466701_046108_965_1555 196
200 3300042600 Ga0466700_264674 Ga0466700_264674_719_1309 196
201 3300042601 Ga0466707_053900 Ga0466707_053900_101_691 196
202 3300042601 Ga0466707_112594 Ga0466707_112594_696_1286 196
203 3300042603 Ga0466714_009109 Ga0466714_009109_3002_3592 196
204 3300042603 Ga0466714_023572 Ga0466714_023572_280_870 196
205 3300042603 Ga0466714_037214 Ga0466714_037214_42_632 196
206 3300042603 Ga0466714_061940 Ga0466714_061940_118_708 196
207 3300042611 Ga0466697_137236 Ga0466697_137236_756_1346 196
208 3300042614 Ga0466712_124664 Ga0466712_124664_1102_1692 196
209 3300042615 Ga0466711_210957 Ga0466711_210957_1919_2509 196
210 3300042616 Ga0466715_383243 Ga0466715_383243_188_778 196
211 3300042616 Ga0466715_615123 Ga0466715_615123_188_778 196
212 3300042618 Ga0466723_173974 Ga0466723_173974_2119_2709 196
213 3300042620 Ga0466728_182332 Ga0466728_182332_14679_15269 196
214 3300042624 Ga0466735_091998 Ga0466735_091998_1452_2042 196
215 3300042625 Ga0466730_081936 Ga0466730_081936_1821_2411 196
216 3300042643 Ga0466704_207225 Ga0466704_207225_3376_3966 196
217 3300042648 Ga0466709_227908 Ga0466709_227908_27021_27611 196
218 3300042656 Ga0466732_369489 Ga0466732_369489_203_793 196
219 3300042659 Ga0466733_066683 Ga0466733_066683_1268_1858 196
220 3300042659 Ga0466733_147774 Ga0466733_147774_1847_2437 196
221 iso_pr_bacteria 2820744581 2820745598 196
222 iso_pr_bacteria 2882250448 2882253185 196
223 iso_pr_bacteria 2940195863 2940198449 196
224 3300000062 IMNBL1DRAFT_c0018331 IMNBL1DRAFT_00183312 197
225 3300000062 IMNBL1DRAFT_c0035606 IMNBL1DRAFT_00356062 197
226 3300002462 JGI24702J35022_10005614 JGI24702J35022_100056146 197
227 3300005201 Ga0072941_1069700 Ga0072941_10697002 197
228 3300005201 Ga0072941_1082653 Ga0072941_10826534 197
229 3300007068 Ga0103265_1000203 Ga0103265_10002032 197
230 3300007085 Ga0104045_1008575 Ga0104045_10085752 197
231 3300007129 Ga0102734_1000175 Ga0102734_10001759 197
232 3300007142 Ga0102737_1000105 Ga0102737_10001055 197
233 3300007190 Ga0103267_1000966 Ga0103267_10009663 197
234 3300010167 Ga0123353_10001135 Ga0123353_1000113525 197
235 3300010167 Ga0123353_11552061 Ga0123353_115520612 197
236 3300010167 Ga0123353_11663731 Ga0123353_116637311 197
237 3300042590 Ga0466690_053116 Ga0466690_053116_1037_1630 197
238 3300042593 Ga0466691_076199 Ga0466691_076199_559_1152 197
239 3300042603 Ga0466714_012858 Ga0466714_012858_1877_2470 197
240 3300042603 Ga0466714_019482 Ga0466714_019482_47824_48417 197
241 3300042605 Ga0466716_107962 Ga0466716_107962_594_1187 197
242 3300042611 Ga0466697_000635 Ga0466697_000635_3594_4187 197
243 3300042612 Ga0466705_175096 Ga0466705_175096_27177_27770 197
244 3300042616 Ga0466715_090334 Ga0466715_090334_2012_2605 197
245 3300042635 Ga0466702_108766 Ga0466702_108766_52_645 197
246 3300042636 Ga0466703_131731 Ga0466703_131731_2535_3128 197
247 3300042636 Ga0466703_232938 Ga0466703_232938_1799_2392 197
248 3300042636 Ga0466703_336984 Ga0466703_336984_1048_1641 197
249 3300042643 Ga0466704_244636 Ga0466704_244636_6854_7447 197
250 3300042659 Ga0466733_165942 Ga0466733_165942_2158_2796 197
251 iso_pr_bacteria 2820765201 2820766897 197
252 iso_pr_bacteria 2923982719 2923983679 197
253 3300002504 JGI24705J35276_12200672 JGI24705J35276_122006722 198
254 3300002834 JGI24696J40584_12949749 JGI24696J40584_129497493 198
255 3300005071 Ga0068302_10473375 Ga0068302_104733751 198
256 3300005200 Ga0072940_1075433 Ga0072940_10754332 198
257 3300005201 Ga0072941_1100666 Ga0072941_11006663 198
258 3300010167 Ga0123353_10740838 Ga0123353_107408381 198
259 3300010167 Ga0123353_10756515 Ga0123353_107565152 198
260 3300010882 Ga0123354_10146620 Ga0123354_101466203 198
261 3300042590 Ga0466690_339386 Ga0466690_339386_3855_4451 198
262 3300042599 Ga0466706_004062 Ga0466706_004062_25339_25935 198
263 3300042599 Ga0466706_147365 Ga0466706_147365_934_1530 198
264 3300042612 Ga0466705_123350 Ga0466705_123350_4115_4711 198
265 3300042615 Ga0466711_071713 Ga0466711_071713_2314_2910 198
266 3300042617 Ga0466718_093822 Ga0466718_093822_422_1018 198
267 3300042636 Ga0466703_122128 Ga0466703_122128_5258_5854 198
268 3300042636 Ga0466703_352187 Ga0466703_352187_311_907 198
269 3300042652 Ga0466708_050428 Ga0466708_050428_3142_3738 198
270 3300042659 Ga0466733_209000 Ga0466733_209000_707_1303 198
271 iso_pr_bacteria 2579779088 2582239524 198
272 iso_pr_bacteria 2820765201 2820765830 198
273 iso_pr_bacteria 2896321640 2896325447 198
274 iso_pr_bacteria 2896330536 2896330965 198
275 iso_pr_bacteria 2896350215 2896350704 198
276 iso_pr_bacteria 2898741527 2898741561 198
277 3300007080 Ga0102735_1000235 Ga0102735_100023514 199
278 3300009826 Ga0123355_10474232 Ga0123355_104742322 199
279 3300010167 Ga0123353_10010485 Ga0123353_100104858 199
280 3300010167 Ga0123353_10019714 Ga0123353_100197147 199
281 3300042590 Ga0466690_125536 Ga0466690_125536_381_980 199
282 3300042591 Ga0466692_122966 Ga0466692_122966_7426_8025 199
283 3300042599 Ga0466706_076331 Ga0466706_076331_21159_21758 199
284 3300042599 Ga0466706_120960 Ga0466706_120960_61_660 199
285 3300042599 Ga0466706_204359 Ga0466706_204359_20267_20866 199
286 3300042599 Ga0466706_209610 Ga0466706_209610_15613_16212 199
287 3300042603 Ga0466714_035266 Ga0466714_035266_1328_1927 199
288 3300042603 Ga0466714_072816 Ga0466714_072816_6554_7153 199
289 3300042612 Ga0466705_357512 Ga0466705_357512_865_1464 199
290 3300042615 Ga0466711_330587 Ga0466711_330587_3206_3805 199
291 3300042618 Ga0466723_039913 Ga0466723_039913_1399_1998 199
292 3300042620 Ga0466728_347669 Ga0466728_347669_131_730 199
293 3300042636 Ga0466703_162055 Ga0466703_162055_828_1427 199
294 3300042636 Ga0466703_385403 Ga0466703_385403_551_1150 199
295 3300042643 Ga0466704_011881 Ga0466704_011881_3501_4100 199
296 3300042649 Ga0466724_53539 Ga0466724_53539_448_1047 199
297 3300042652 Ga0466708_400273 Ga0466708_400273_14048_14647 199
298 3300042652 Ga0466708_405823 Ga0466708_405823_119_718 199
299 iso_pr_bacteria 2894649344 2894651187 199
300 3300000062 IMNBL1DRAFT_c0005969 IMNBL1DRAFT_00059693 200
301 3300009784 Ga0123357_10062418 Ga0123357_100624184 200
302 3300010167 Ga0123353_10151234 Ga0123353_101512343 200
303 3300024493 Ga0264413_156640 Ga0264413_1566403 200
304 3300042599 Ga0466706_171356 Ga0466706_171356_639_1241 200
305 3300042603 Ga0466714_021809 Ga0466714_021809_86_688 200
306 3300042603 Ga0466714_090093 Ga0466714_090093_463_1065 200
307 3300042605 Ga0466716_449927 Ga0466716_449927_96_698 200
308 3300042606 Ga0466719_243643 Ga0466719_243643_5180_5782 200
309 3300042612 Ga0466705_033650 Ga0466705_033650_2135_2737 200
310 3300042615 Ga0466711_155701 Ga0466711_155701_11046_11648 200
311 3300042621 Ga0466729_149369 Ga0466729_149369_1201_1803 200
312 3300042636 Ga0466703_040466 Ga0466703_040466_2590_3192 200
313 3300042643 Ga0466704_010086 Ga0466704_010086_15396_15998 200
314 3300042643 Ga0466704_015140 Ga0466704_015140_13464_14066 200
315 3300010049 Ga0123356_10561778 Ga0123356_105617782 201
316 3300042599 Ga0466706_089391 Ga0466706_089391_3153_3758 201
317 3300042601 Ga0466707_291066 Ga0466707_291066_9363_9968 201
318 3300042636 Ga0466703_280503 Ga0466703_280503_20795_21400 201
319 3300042648 Ga0466709_252452 Ga0466709_252452_3631_4236 201
320 iso_pr_bacteria 2820768849 2820769724 201
321 iso_pr_bacteria 2820774381 2820774647 201
322 3300005083 Ga0068305_10749342 Ga0068305_107493423 202
323 3300010167 Ga0123353_10000019 Ga0123353_10000019106 202
324 3300012824 Ga0160469_102018 Ga0160469_1020183 202
325 3300012846 Ga0160433_100138 Ga0160433_1001388 202
326 3300012858 Ga0160457_1006047 Ga0160457_10060471 202
327 3300042594 Ga0466694_010907 Ga0466694_010907_176_784 202
328 3300042615 Ga0466711_145131 Ga0466711_145131_25757_26365 202
329 3300042616 Ga0466715_033953 Ga0466715_033953_11672_12280 202
330 3300042619 Ga0466726_056744 Ga0466726_056744_1356_1964 202
331 3300042652 Ga0466708_095033 Ga0466708_095033_13714_14322 202
332 3300042652 Ga0466708_170849 Ga0466708_170849_1945_2553 202
333 3300000062 IMNBL1DRAFT_c0001109 IMNBL1DRAFT_00011093 203
334 3300012846 Ga0160433_108634 Ga0160433_1086342 203
335 3300042618 Ga0466723_220384 Ga0466723_220384_1572_2183 203
336 3300042659 Ga0466733_121761 Ga0466733_121761_319_930 203
337 3300010167 Ga0123353_10174601 Ga0123353_101746011 204
338 3300010882 Ga0123354_10137783 Ga0123354_101377831 204
339 3300042603 Ga0466714_030409 Ga0466714_030409_608_1222 204
340 3300042609 Ga0466722_164674 Ga0466722_164674_3346_3960 204
341 3300042636 Ga0466703_129766 Ga0466703_129766_1192_1806 204
342 3300007505 Ga0105005_1014017 Ga0105005_10140176 205
343 3300010167 Ga0123353_10004979 Ga0123353_100049792 205
344 3300010167 Ga0123353_10007698 Ga0123353_100076989 205
345 3300010882 Ga0123354_10033083 Ga0123354_100330835 205
346 3300010882 Ga0123354_10122526 Ga0123354_101225263 205
347 3300042599 Ga0466706_085050 Ga0466706_085050_18695_19312 205
348 3300042601 Ga0466707_314308 Ga0466707_314308_3989_4606 205
349 3300042601 Ga0466707_322321 Ga0466707_322321_2025_2642 205
350 3300042603 Ga0466714_126469 Ga0466714_126469_39604_40221 205
351 3300042619 Ga0466726_141993 Ga0466726_141993_5834_6451 205
352 2225789004 2227275225 2227725698 206
353 3300000062 IMNBL1DRAFT_c0000270 IMNBL1DRAFT_000027037 206
354 3300042601 Ga0466707_083114 Ga0466707_083114_5505_6128 207
355 3300010167 Ga0123353_10565167 Ga0123353_105651673 208
356 3300042605 Ga0466716_102169 Ga0466716_102169_228_854 208
357 3300042620 Ga0466728_064136 Ga0466728_064136_30151_30777 208
358 3300042620 Ga0466728_306930 Ga0466728_306930_29406_30032 208
359 3300000062 IMNBL1DRAFT_c0019372 IMNBL1DRAFT_00193722 209
360 3300009784 Ga0123357_10000306 Ga0123357_1000030641 209
361 3300042605 Ga0466716_441168 Ga0466716_441168_4446_5075 209
362 3300042624 Ga0466735_107458 Ga0466735_107458_340_972 210
363 3300000062 IMNBL1DRAFT_c0052760 IMNBL1DRAFT_00527601 211
364 3300042609 Ga0466722_176901 Ga0466722_176901_1520_2155 211
365 3300042613 Ga0466710_108507 Ga0466710_108507_514_1149 211
366 3300042648 Ga0466709_226395 Ga0466709_226395_560_1195 211
367 3300042636 Ga0466703_272532 Ga0466703_272532_1416_2054 212
368 3300042618 Ga0466723_092677 Ga0466723_092677_2224_2865 213
369 3300000062 IMNBL1DRAFT_c0011476 IMNBL1DRAFT_00114763 215
370 3300042609 Ga0466722_123554 Ga0466722_123554_3731_4387 218
371 3300042620 Ga0466728_420477 Ga0466728_420477_16597_17283 219
372 3300042656 Ga0466732_082485 Ga0466732_082485_1938_2612 224
373 iso_pr_bacteria 2820736622 2820737659 226
374 iso_pr_bacteria 2820740053 2820740890 226
375 3300042603 Ga0466714_013796 Ga0466714_013796_1695_2405 236

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02545 Maf Maf-like protein 11 194 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02545 GO:0047429 nucleoside triphosphate diphosphatase activity MF

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.