Protein Family IF06168

Metagenome Isolate
151 Members
58 Samples
136 Scaffolds
228.58 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_155988|Ga0466713_155988_8399_9217
Length
272 aa
Sequence
MNIELFLGAKIHKIFFFLPTFYIILYFCPLKHQTSNIVDILYEDNHIIAVNKNCHEIVQGDKTGDEPLAEALKTYLKEKYAKPGNVFVGVTHRLDRPVTGVVLFAKTSKALTRLNEMFRTGKVKKTYWAIVLNTADSIASSNTVGRYDASASTTLAHWLVRNEKQNKTYAYDVEQPASKKAILHYRAIAATDRYRLLEIELETGRHHQIRAQLSKIGLPIKGDLKYGSKRSNPDGGISLHARSISFVHPVSKEELTVTAPPPPDNLWKALRE

📊 Sample Types

Isolate 9.9%
Metagenome 90.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 29.8%
Kalotermitidae 24.6%
Blattidae 14.0%
Unclassified 10.5%
Rhinotermitidae 7.0%
Termopsidae 5.3%
Hodotermitidae 1.8%
Armadillidiidae 1.8%
Cambaridae 1.8%
Passalidae 1.8%
Hydrophilidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 150
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
7 2923982719 Parabacteroides sp. 52 Isolate Blattidae
8 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
14 2920168565 Paludibacter sp. 221 Isolate Blattidae
15 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
16 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
17 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
18 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
19 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
20 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
21 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
22 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
23 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
24 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
25 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
26 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
27 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
28 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
29 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
30 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
31 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
32 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
33 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
34 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
35 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
36 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
37 2904728850 Flavobacterium sp. xlx-214 Isolate
38 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
39 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
40 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
44 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
45 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
46 3004667792 Bacteroides sp. 519 Isolate Blattidae
47 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
48 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
49 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
50 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
51 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
52 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
53 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
54 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
55 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
56 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
57 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
58 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_054948 3300042659 Bacteria 1623
2 Ga0466704_193291 3300042643 Bacteria 1177
3 Ga0466704_367890 3300042643 Bacteria 7284
4 Ga0466692_121438 3300042591 Bacteria 29354
5 Ga0466705_433894 3300042612 Bacteria 4277
6 Ga0466711_091189 3300042615 Bacteria 3941
7 Ga0466728_373976 3300042620 Bacteria 1211
8 Ga0466714_081690 3300042603 Bacteria 21775
9 Ga0466722_029979 3300042609 Bacteria 2438
10 JGI24699J35502_11132388 3300002509 Bacteria 6784
11 Ga0068305_10018221 3300005083 Bacteria 1409
12 Ga0466705_358193 3300042612 Bacteria 48237
13 Ga0123353_10195207 3300010167 Bacteria 3191
14 Ga0466735_024490 3300042624 Bacteria 16233
15 Ga0466735_096129 3300042624 Bacteria 3076
16 Ga0466735_139694 3300042624 Bacteria 11932
17 Ga0466730_088972 3300042625 Bacteria 2023
18 Ga0466709_008379 3300042648 Bacteria 52460
19 Ga0466727_032376 3300042655 Bacteria 52244
20 Ga0466711_062120 3300042615 Bacteria 7801
21 Ga0466715_174556 3300042616 Bacteria 12351
22 Ga0466726_271261 3300042619 Bacteria 2066
23 Ga0466729_051835 3300042621 Bacteria 1270
24 Ga0466700_108390 3300042600 Bacteria 2692
25 Ga0466713_012307 3300042602 Bacteria 58290
26 Ga0466713_073953 3300042602 Bacteria 19632
27 Ga0466713_098854 3300042602 Bacteria 24287
28 Ga0466714_021688 3300042603 Bacteria 6127
29 Ga0466721_241138 3300042608 Bacteria 4462
30 Ga0466705_369079 3300042612 Bacteria 2817
31 Ga0466733_095936 3300042659 Bacteria 8903
32 Ga0123356_10045375 3300010049 Bacteria 4090
33 Ga0466735_006292 3300042624 Bacteria 2614
34 Ga0466703_402347 3300042636 Bacteria 2022
35 Ga0466704_227457 3300042643 Bacteria 3559
36 Ga0466709_231341 3300042648 Bacteria 1150
37 Ga0466656_211189 3300042550 Bacteria 4646
38 Ga0466657_330578 3300042582 Bacteria 10823
39 Ga0466711_245991 3300042615 Bacteria 8257
40 Ga0466715_063927 3300042616 Bacteria 20242
41 Ga0466706_005003 3300042599 Bacteria 88622
42 Ga0466706_049528 3300042599 Bacteria 126627
43 Ga0466707_350599 3300042601 Bacteria 3854
44 Ga0466714_139802 3300042603 Bacteria 44076
45 Ga0466719_009668 3300042606 Bacteria 13225
46 Ga0466719_057701 3300042606 Bacteria 4518
47 Ga0466722_030321 3300042609 Bacteria 2531
48 IMNBL1DRAFT_c0000013 3300000062 Bacteria 180832
49 Ga0068305_10044706 3300005083 Unclassified 2950
50 Ga0466697_114553 3300042611 Bacteria 2126
51 Ga0466705_058872 3300042612 Bacteria 5610
52 Ga0123353_10274456 3300010167 Bacteria 2595
53 Ga0466729_297055 3300042621 Bacteria 11394
54 Ga0466703_028602 3300042636 Bacteria 13514
55 Ga0466704_031634 3300042643 Bacteria 25951
56 Ga0466704_465446 3300042643 Bacteria 11294
57 Ga0466690_156317 3300042590 Bacteria 10842
58 Ga0466696_019129 3300042596 Bacteria 8988
59 Ga0466696_500621 3300042596 Bacteria 1438
60 Ga0466711_502239 3300042615 Bacteria 21969
61 Ga0466715_025032 3300042616 Bacteria 5084
62 Ga0466715_076726 3300042616 Bacteria 12449
63 IMNBL1DRAFT_c0007081 3300000062 Bacteria 5969
64 JGI24702J35022_10024994 3300002462 Bacteria 3225
65 JGI24702J35022_10447748 3300002462 Bacteria 786
66 Ga0072940_1099628 3300005200 Bacteria 3486
67 Ga0466735_142604 3300042624 Bacteria 1700
68 Ga0466735_164257 3300042624 Bacteria 1125
69 Ga0466735_205360 3300042624 Bacteria 3003
70 Ga0466703_099532 3300042636 Bacteria 11615
71 Ga0466704_280846 3300042643 Bacteria 2441
72 Ga0466704_362206 3300042643 Bacteria 17907
73 Ga0466709_245297 3300042648 Bacteria 6454
74 Ga0160443_100159 3300012848 Bacteria 96879
75 Ga0466690_092237 3300042590 Bacteria 50238
76 Ga0466690_395423 3300042590 Bacteria 2591
77 Ga0466692_029164 3300042591 Bacteria 9584
78 Ga0466691_017691 3300042593 Bacteria 1136
79 Ga0466691_168903 3300042593 Bacteria 4832
80 Ga0466711_180591 3300042615 Bacteria 1784
81 Ga0466729_179941 3300042621 Bacteria 7967
82 Ga0466706_026420 3300042599 Bacteria 1926
83 Ga0466707_111278 3300042601 Bacteria 4328
84 Ga0466716_349488 3300042605 Bacteria 9051
85 Ga0466722_055337 3300042609 Bacteria 46327
86 Ga0466697_048910 3300042611 Bacteria 5672
87 JGI24696J40584_12889856 3300002834 Bacteria 1125
88 JGI24696J40584_12956873 3300002834 Bacteria 3268
89 Ga0072940_1418639 3300005200 Bacteria 993
90 Ga0466735_048803 3300042624 Bacteria 1962
91 Ga0466735_172236 3300042624 Bacteria 4417
92 Ga0466735_219259 3300042624 Bacteria 2441
93 Ga0466696_267649 3300042596 Bacteria 36863
94 Ga0466711_176340 3300042615 Bacteria 4966
95 Ga0466711_239548 3300042615 Bacteria 5626
96 Ga0466723_137213 3300042618 Bacteria 27651
97 Ga0466706_055892 3300042599 Bacteria 3989
98 Ga0466707_310091 3300042601 Bacteria 2902
99 Ga0466713_027482 3300042602 Bacteria 12651
100 Ga0466713_109180 3300042602 Bacteria 24782
101 Ga0466716_451314 3300042605 Bacteria 8977
102 Ga0466719_326382 3300042606 Bacteria 1732
103 JGI24695J34938_10118736 3300002450 Bacteria 1076
104 Ga0466703_091407 3300042636 Bacteria 4642
105 Ga0466709_109313 3300042648 Bacteria 13355
106 Ga0466696_070975 3300042596 Bacteria 1815
107 Ga0466696_079957 3300042596 Bacteria 7777
108 Ga0466711_187829 3300042615 Bacteria 15956
109 Ga0466715_149789 3300042616 Bacteria 38698
110 Ga0466715_458768 3300042616 Bacteria 71878
111 Ga0466715_579864 3300042616 Bacteria 1698
112 Ga0466706_037626 3300042599 Bacteria 1206
113 Ga0466707_046338 3300042601 Bacteria 3253
114 Ga0466713_061789 3300042602 Bacteria 88378
115 Ga0466713_155988 3300042602 Bacteria 9294
116 Ga0068305_10023860 3300005083 Bacteria 5275
117 Ga0466732_359599 3300042656 Bacteria 1163
118 Ga0466733_086182 3300042659 Bacteria 2093
119 Ga0466703_096920 3300042636 Bacteria 5212
120 Ga0466703_122933 3300042636 Bacteria 9570
121 Ga0466709_154165 3300042648 Bacteria 14931
122 Ga0466708_068773 3300042652 Bacteria 15534
123 Ga0466690_160469 3300042590 Bacteria 15377
124 Ga0466691_052134 3300042593 Bacteria 12667
125 Ga0466711_010541 3300042615 Bacteria 14290
126 Ga0466715_118872 3300042616 Bacteria 2042
127 Ga0466723_089568 3300042618 Bacteria 54083
128 Ga0466728_404043 3300042620 Bacteria 6322
129 Ga0466707_115176 3300042601 Bacteria 1756
130 Ga0466707_389988 3300042601 Bacteria 4014
131 Ga0466716_101111 3300042605 Bacteria 10329
132 Ga0466719_143492 3300042606 Bacteria 4770
133 Ga0466719_479001 3300042606 Bacteria 8748
134 Ga0466722_007565 3300042609 Bacteria 18233
135 JGI24699J35502_11133978 3300002509 Bacteria 22406
136 Ga0123357_10000854 3300009784 Bacteria 31021

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005200 Ga0072940_1099628 Ga0072940_10996284 201
2 3300042656 Ga0466732_359599 Ga0466732_359599_35_706 208
3 3300042659 Ga0466733_086182 Ga0466733_086182_1307_1987 217
4 3300005200 Ga0072940_1418639 Ga0072940_14186391 218
5 3300042648 Ga0466709_231341 Ga0466709_231341_338_994 218
6 3300042620 Ga0466728_373976 Ga0466728_373976_80_739 219
7 3300042599 Ga0466706_005003 Ga0466706_005003_32136_32798 220
8 3300042615 Ga0466711_502239 Ga0466711_502239_659_1321 220
9 iso_pr_bacteria 3004667792 3004669856 220
10 3300042601 Ga0466707_389988 Ga0466707_389988_2838_3503 221
11 3300042616 Ga0466715_063927 Ga0466715_063927_15583_16248 221
12 3300042621 Ga0466729_051835 Ga0466729_051835_555_1220 221
13 3300042590 Ga0466690_092237 Ga0466690_092237_46977_47645 222
14 3300042602 Ga0466713_061789 Ga0466713_061789_84693_85361 222
15 3300042609 Ga0466722_007565 Ga0466722_007565_13448_14116 222
16 3300042612 Ga0466705_433894 Ga0466705_433894_101_769 222
17 3300042615 Ga0466711_062120 Ga0466711_062120_3242_3910 222
18 3300042616 Ga0466715_118872 Ga0466715_118872_818_1486 222
19 3300042624 Ga0466735_142604 Ga0466735_142604_56_724 222
20 3300042624 Ga0466735_172236 Ga0466735_172236_3030_3698 222
21 3300042636 Ga0466703_028602 Ga0466703_028602_6482_7150 222
22 3300042659 Ga0466733_054948 Ga0466733_054948_806_1474 222
23 iso_pr_bacteria 2820751898 2820753313 222
24 3300005083 Ga0068305_10023860 Ga0068305_100238602 223
25 3300042590 Ga0466690_156317 Ga0466690_156317_5035_5706 223
26 3300042590 Ga0466690_395423 Ga0466690_395423_297_968 223
27 3300042602 Ga0466713_109180 Ga0466713_109180_15597_16268 223
28 3300042605 Ga0466716_101111 Ga0466716_101111_8806_9477 223
29 3300042615 Ga0466711_239548 Ga0466711_239548_4000_4671 223
30 3300042616 Ga0466715_025032 Ga0466715_025032_3121_3792 223
31 3300042624 Ga0466735_048803 Ga0466735_048803_979_1650 223
32 3300042643 Ga0466704_367890 Ga0466704_367890_2617_3312 223
33 iso_pr_bacteria 2940195863 2940197544 223
34 3300002450 JGI24695J34938_10118736 JGI24695J34938_101187361 224
35 3300002509 JGI24699J35502_11133978 JGI24699J35502_1113397818 224
36 3300002834 JGI24696J40584_12956873 JGI24696J40584_129568732 224
37 3300005083 Ga0068305_10018221 Ga0068305_100182212 224
38 3300042593 Ga0466691_017691 Ga0466691_017691_396_1070 224
39 3300042596 Ga0466696_500621 Ga0466696_500621_55_729 224
40 3300042599 Ga0466706_037626 Ga0466706_037626_307_981 224
41 3300042603 Ga0466714_021688 Ga0466714_021688_5307_5981 224
42 3300042606 Ga0466719_326382 Ga0466719_326382_501_1175 224
43 3300042612 Ga0466705_369079 Ga0466705_369079_203_877 224
44 3300042615 Ga0466711_176340 Ga0466711_176340_782_1456 224
45 3300042618 Ga0466723_137213 Ga0466723_137213_8786_9460 224
46 3300042624 Ga0466735_006292 Ga0466735_006292_1656_2330 224
47 3300042643 Ga0466704_362206 Ga0466704_362206_2788_3462 224
48 3300042648 Ga0466709_008379 Ga0466709_008379_8469_9143 224
49 3300042648 Ga0466709_154165 Ga0466709_154165_4003_4677 224
50 3300042652 Ga0466708_068773 Ga0466708_068773_3792_4466 224
51 3300042655 Ga0466727_032376 Ga0466727_032376_23815_24489 224
52 iso_pr_bacteria 2910949487 2910952396 224
53 3300000062 IMNBL1DRAFT_c0000013 IMNBL1DRAFT_000001362 225
54 3300002462 JGI24702J35022_10447748 JGI24702J35022_104477481 225
55 3300002834 JGI24696J40584_12889856 JGI24696J40584_128898561 225
56 3300042590 Ga0466690_160469 Ga0466690_160469_4186_4863 225
57 3300042593 Ga0466691_168903 Ga0466691_168903_1096_1773 225
58 3300042605 Ga0466716_349488 Ga0466716_349488_2134_2811 225
59 3300042612 Ga0466705_058872 Ga0466705_058872_1750_2427 225
60 3300042612 Ga0466705_358193 Ga0466705_358193_5857_6534 225
61 3300042616 Ga0466715_174556 Ga0466715_174556_9081_9758 225
62 3300042620 Ga0466728_404043 Ga0466728_404043_543_1220 225
63 3300042621 Ga0466729_297055 Ga0466729_297055_4715_5392 225
64 3300042624 Ga0466735_205360 Ga0466735_205360_673_1350 225
65 3300042643 Ga0466704_280846 Ga0466704_280846_567_1244 225
66 iso_pr_bacteria 2910926975 2910928557 225
67 iso_pr_bacteria 2910930387 2910930781 225
68 iso_pr_bacteria 2920168565 2920170347 225
69 iso_pr_bacteria 8100166142 8100170081 225
70 3300000062 IMNBL1DRAFT_c0007081 IMNBL1DRAFT_00070815 226
71 3300042601 Ga0466707_310091 Ga0466707_310091_1950_2630 226
72 3300042611 Ga0466697_114553 Ga0466697_114553_114_794 226
73 3300042615 Ga0466711_010541 Ga0466711_010541_10418_11098 226
74 3300042624 Ga0466735_096129 Ga0466735_096129_1634_2314 226
75 3300042636 Ga0466703_122933 Ga0466703_122933_6798_7478 226
76 3300042643 Ga0466704_465446 Ga0466704_465446_197_877 226
77 3300042648 Ga0466709_109313 Ga0466709_109313_11242_11922 226
78 iso_pr_bacteria 2873610414 2873613938 226
79 3300002509 JGI24699J35502_11132388 JGI24699J35502_111323884 227
80 3300009784 Ga0123357_10000854 Ga0123357_1000085418 227
81 3300010167 Ga0123353_10195207 Ga0123353_101952075 227
82 3300042591 Ga0466692_029164 Ga0466692_029164_8303_8986 227
83 3300042601 Ga0466707_111278 Ga0466707_111278_1043_1726 227
84 3300042601 Ga0466707_115176 Ga0466707_115176_137_820 227
85 3300042602 Ga0466713_098854 Ga0466713_098854_4724_5407 227
86 3300042616 Ga0466715_458768 Ga0466715_458768_7853_8536 227
87 3300042618 Ga0466723_089568 Ga0466723_089568_30887_31570 227
88 3300042621 Ga0466729_179941 Ga0466729_179941_4306_4989 227
89 3300042659 Ga0466733_095936 Ga0466733_095936_8038_8721 227
90 3300005083 Ga0068305_10044706 Ga0068305_100447065 228
91 3300042591 Ga0466692_121438 Ga0466692_121438_6382_7068 228
92 3300042596 Ga0466696_079957 Ga0466696_079957_1712_2398 228
93 3300042599 Ga0466706_055892 Ga0466706_055892_201_887 228
94 3300042602 Ga0466713_027482 Ga0466713_027482_6433_7119 228
95 3300042619 Ga0466726_271261 Ga0466726_271261_686_1372 228
96 3300042624 Ga0466735_139694 Ga0466735_139694_2849_3535 228
97 3300042636 Ga0466703_099532 Ga0466703_099532_4162_4848 228
98 iso_pr_bacteria 2923982719 2923984214 228
99 iso_pr_bacteria 2940371297 2940371887 228
100 3300042596 Ga0466696_019129 Ga0466696_019129_4967_5656 229
101 3300042606 Ga0466719_009668 Ga0466719_009668_11660_12349 229
102 3300042608 Ga0466721_241138 Ga0466721_241138_673_1362 229
103 3300042611 Ga0466697_048910 Ga0466697_048910_3982_4671 229
104 3300042615 Ga0466711_187829 Ga0466711_187829_6834_7523 229
105 3300042624 Ga0466735_024490 Ga0466735_024490_13994_14683 229
106 3300042625 Ga0466730_088972 Ga0466730_088972_84_773 229
107 3300042636 Ga0466703_091407 Ga0466703_091407_22_711 229
108 iso_pr_bacteria 2820740053 2820740376 229
109 iso_pr_bacteria 2967483437 2967485572 229
110 3300010049 Ga0123356_10045375 Ga0123356_100453752 230
111 3300042615 Ga0466711_180591 Ga0466711_180591_425_1117 230
112 3300042599 Ga0466706_026420 Ga0466706_026420_45_740 231
113 3300042606 Ga0466719_057701 Ga0466719_057701_3594_4289 231
114 3300042609 Ga0466722_055337 Ga0466722_055337_41993_42688 231
115 3300042643 Ga0466704_227457 Ga0466704_227457_2112_2807 231
116 3300042648 Ga0466709_245297 Ga0466709_245297_345_1040 231
117 3300012848 Ga0160443_100159 Ga0160443_10015944 232
118 3300042601 Ga0466707_350599 Ga0466707_350599_2353_3051 232
119 3300042615 Ga0466711_091189 Ga0466711_091189_942_1640 232
120 3300042636 Ga0466703_402347 Ga0466703_402347_1264_1962 232
121 iso_pr_bacteria 2904728850 2904729514 232
122 iso_pr_bacteria 2958471994 2958473893 232
123 3300002462 JGI24702J35022_10024994 JGI24702J35022_100249941 233
124 3300042596 Ga0466696_070975 Ga0466696_070975_77_778 233
125 3300042624 Ga0466735_164257 Ga0466735_164257_311_1012 233
126 3300042643 Ga0466704_031634 Ga0466704_031634_21496_22197 233
127 3300010167 Ga0123353_10274456 Ga0123353_102744562 234
128 3300042596 Ga0466696_267649 Ga0466696_267649_21105_21809 234
129 3300042600 Ga0466700_108390 Ga0466700_108390_1653_2357 234
130 3300042606 Ga0466719_479001 Ga0466719_479001_6792_7496 234
131 3300042616 Ga0466715_149789 Ga0466715_149789_19333_20040 235
132 3300042599 Ga0466706_049528 Ga0466706_049528_86966_87676 236
133 3300042605 Ga0466716_451314 Ga0466716_451314_3726_4436 236
134 3300042609 Ga0466722_030321 Ga0466722_030321_1023_1733 236
135 3300042615 Ga0466711_245991 Ga0466711_245991_2949_3659 236
136 3300042616 Ga0466715_076726 Ga0466715_076726_7552_8265 237
137 3300042601 Ga0466707_046338 Ga0466707_046338_2199_2915 238
138 3300042582 Ga0466657_330578 Ga0466657_330578_7213_7935 240
139 3300042593 Ga0466691_052134 Ga0466691_052134_2658_3386 242
140 3300042643 Ga0466704_193291 Ga0466704_193291_379_1107 242
141 3300042636 Ga0466703_096920 Ga0466703_096920_1844_2581 245
142 3300042603 Ga0466714_139802 Ga0466714_139802_6122_6868 248
143 3300042606 Ga0466719_143492 Ga0466719_143492_3167_3913 248
144 3300042616 Ga0466715_579864 Ga0466715_579864_738_1484 248
145 3300042603 Ga0466714_081690 Ga0466714_081690_20322_21071 249
146 3300042602 Ga0466713_012307 Ga0466713_012307_27835_28602 255
147 3300042602 Ga0466713_073953 Ga0466713_073953_10749_11525 258
148 3300042609 Ga0466722_029979 Ga0466722_029979_621_1397 258
149 3300042624 Ga0466735_219259 Ga0466735_219259_14_796 260
150 3300042550 Ga0466656_211189 Ga0466656_211189_924_1748 263
151 3300042602 Ga0466713_155988 Ga0466713_155988_8399_9217 272

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00849 PseudoU_synth_2 RNA pseudouridylate synthase 46 214 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.