Protein Family IF06151

Metagenome Isolate
112 Members
37 Samples
110 Scaffolds
389.34 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_140716|Ga0466713_140716_1706_2917
Length
403 aa
Sequence
MSAIAGAGAIITPGLTACKSSSQTALAAEEALTTGKATAEAADGKIETRTLGKTGITVPVLSMGVMRADNPAVLRAAYNSGITFFDTAHGYQNGKNEEMVGEFFKDKDRSTFYIATKGNPGRRNVPDDYGKAFEEMLNTSLRRLQMDYVDIYYLHGPGSVEDVTNPQVLAAMKKFKSEGKIRHIGFSTHANKPEQIDAAIETGVYEVILISYNFKLNILPELDRAIERGVKAGLGFVAMKTMVGGGTAPAEPWNNNSGPIDGAACLRWVWQNKNIATAIPGFTSFDLLDNCLQAAHNPKFTDEDKKYIAQLGSQELLYCQNCGKCVGDCKKHLPIPDIMRAYMYNYGYRQPSLSKETLAELALGADVCKGCTGCAVKCPSGFKVKEKIAAIAPVVNVPDRFLA

📊 Sample Types

Isolate 1.8%
Metagenome 98.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 36.1%
Termitidae 27.8%
Unclassified 11.1%
Termopsidae 11.1%
Rhinotermitidae 8.3%
Passalidae 5.6%

🌳 Taxonomy

Archaea 0
Bacteria 110
Eukaryota 0
Viruses 1
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
2 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
3 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
6 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
9 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
10 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
11 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
12 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
13 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
18 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
19 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
20 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
23 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
24 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
25 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
26 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
27 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
28 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
31 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
32 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
33 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
34 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
35 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
36 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
37 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466704_028752 3300042643 Bacteria 8447
2 Ga0466704_310944 3300042643 Bacteria 5568
3 Ga0466709_237921 3300042648 Bacteria 101442
4 Ga0466727_280080 3300042655 Bacteria 2874
5 Ga0466690_342154 3300042590 Bacteria 5786
6 Ga0466690_371428 3300042590 Bacteria 9156
7 Ga0466696_125373 3300042596 Bacteria 2315
8 Ga0466707_047616 3300042601 Bacteria 20965
9 Ga0123357_10030365 3300009784 Bacteria 7325
10 Ga0123357_10225557 3300009784 Bacteria 2067
11 Ga0466697_259107 3300042611 Bacteria 1333
12 Ga0466711_040919 3300042615 Bacteria 18408
13 Ga0466711_116634 3300042615 Bacteria 4261
14 Ga0466715_048593 3300042616 Bacteria 3511
15 Ga0466723_178996 3300042618 Bacteria 9054
16 Ga0466700_051149 3300042600 Bacteria 14467
17 Ga0466713_089566 3300042602 Bacteria 1939
18 Ga0123354_10229950 3300010882 Bacteria 1942
19 Ga0466705_091702 3300042612 Bacteria 3464
20 Ga0466705_309809 3300042612 Bacteria 1710
21 Ga0466729_270565 3300042621 Bacteria 6046
22 Ga0466704_080054 3300042643 Bacteria 4215
23 Ga0466727_055928 3300042655 Bacteria 2705
24 Ga0466715_019376 3300042616 Bacteria 10481
25 Ga0466715_026255 3300042616 Bacteria 31429
26 Ga0466726_323435 3300042619 Bacteria 1869
27 Ga0466726_347450 3300042619 Bacteria 33335
28 Ga0466692_038240 3300042591 Bacteria 2480
29 Ga0466692_156077 3300042591 Bacteria 15779
30 Ga0466707_231685 3300042601 Bacteria 4076
31 Ga0466707_242973 3300042601 Bacteria 16990
32 Ga0466713_140716 3300042602 Bacteria 27446
33 Ga0466719_482507 3300042606 Bacteria 3042
34 Ga0123356_10416906 3300010049 Bacteria 1484
35 Ga0123354_10016367 3300010882 Bacteria 11619
36 IMNBL1DRAFT_c0001060 3300000062 Bacteria 21260
37 JGI24699J35502_11133697 3300002509 Bacteria 13756
38 Ga0466705_150477 3300042612 Bacteria 2523
39 Ga0466729_275550 3300042621 Bacteria 5376
40 Ga0466703_034601 3300042636 Bacteria 4713
41 Ga0466703_039625 3300042636 Bacteria 8080
42 Ga0466709_330887 3300042648 Bacteria 11774
43 Ga0466711_335316 3300042615 Bacteria 14103
44 Ga0466715_434942 3300042616 Bacteria 16490
45 Ga0466690_033411 3300042590 Bacteria 5980
46 Ga0466707_008556 3300042601 Bacteria 2889
47 Ga0466707_407745 3300042601 Bacteria 18219
48 Ga0466716_222741 3300042605 Bacteria 26302
49 Ga0466719_470350 3300042606 Bacteria 3280
50 Ga0123353_10104342 3300010167 Bacteria 4568
51 Ga0123354_10002051 3300010882 Bacteria 25954
52 2227469382 2225789004 Bacteria 4963
53 JGI24699J35502_11041860 3300002509 Bacteria 1582
54 JGI24699J35502_11134190 3300002509 Bacteria 48930
55 JGI24696J40584_12959266 3300002834 Viruses 4916
56 Ga0123357_10001038 3300009784 Bacteria 28515
57 Ga0466727_101102 3300042655 Bacteria 4542
58 Ga0466727_122982 3300042655 Bacteria 40069
59 Ga0466715_079781 3300042616 Bacteria 19811
60 Ga0466715_632327 3300042616 Bacteria 13777
61 Ga0466723_140313 3300042618 Bacteria 61055
62 Ga0466723_224327 3300042618 Bacteria 5271
63 Ga0466692_030788 3300042591 Bacteria 34612
64 Ga0466707_301205 3300042601 Bacteria 10041
65 Ga0466719_192439 3300042606 Bacteria 21840
66 Ga0466722_221149 3300042609 Bacteria 16960
67 Ga0123354_10000156 3300010882 Bacteria 54363
68 Ga0123354_10286828 3300010882 Bacteria 1586
69 2227094706 2225789004 Bacteria 9730
70 Ga0466727_348819 3300042655 Bacteria 3871
71 Ga0466735_156234 3300042624 Bacteria 14530
72 Ga0466723_030107 3300042618 Bacteria 20038
73 Ga0466723_308452 3300042618 Bacteria 4188
74 Ga0466728_081622 3300042620 Bacteria 4588
75 Ga0466690_096137 3300042590 Bacteria 12112
76 Ga0466692_043166 3300042591 Bacteria 27075
77 Ga0466696_036809 3300042596 Bacteria 6517
78 Ga0466707_163341 3300042601 Bacteria 4537
79 Ga0466716_025263 3300042605 Bacteria 7895
80 Ga0072941_1085555 3300005201 Bacteria 2627
81 Ga0466735_150369 3300042624 Bacteria 7637
82 Ga0466703_009348 3300042636 Bacteria 7112
83 Ga0466704_062323 3300042643 Bacteria 6946
84 Ga0466704_326796 3300042643 Bacteria 7022
85 Ga0466723_048094 3300042618 Bacteria 9768
86 Ga0466728_080958 3300042620 Bacteria 5694
87 Ga0466690_059913 3300042590 Bacteria 43148
88 Ga0466696_227064 3300042596 Bacteria 35618
89 Ga0466719_396836 3300042606 Bacteria 2137
90 IMNBL1DRAFT_c0001265 3300000062 Bacteria 19071
91 JGI24702J35022_10007620 3300002462 Bacteria 6191
92 JGI24702J35022_10008174 3300002462 Bacteria 5942
93 Ga0068302_10655189 3300005071 Unclassified 1429
94 Ga0466705_157525 3300042612 Bacteria 4711
95 Ga0466735_014708 3300042624 Bacteria 5306
96 Ga0466709_049597 3300042648 Bacteria 2240
97 Ga0466711_010847 3300042615 Bacteria 41256
98 Ga0466715_074426 3300042616 Bacteria 5481
99 Ga0466723_130968 3300042618 Bacteria 3652
100 Ga0466726_203148 3300042619 Bacteria 7936
101 Ga0466728_300584 3300042620 Bacteria 10442
102 Ga0466690_034127 3300042590 Bacteria 10198
103 Ga0466690_042712 3300042590 Bacteria 8144
104 Ga0466691_033116 3300042593 Bacteria 8086
105 Ga0466691_116484 3300042593 Bacteria 13504
106 Ga0466707_328711 3300042601 Bacteria 2157
107 Ga0123357_10094667 3300009784 Bacteria 3876
108 Ga0123357_10104810 3300009784 Bacteria 3629
109 Ga0123354_10285956 3300010882 Bacteria 1591
110 JGI24705J35276_12217820 3300002504 Bacteria 2113

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042602 Ga0466713_089566 Ga0466713_089566_848_1903 332
2 3300042611 Ga0466697_259107 Ga0466697_259107_50_1078 342
3 3300042655 Ga0466727_280080 Ga0466727_280080_135_1301 345
4 3300042615 Ga0466711_010847 Ga0466711_010847_14723_15919 360
5 3300042606 Ga0466719_396836 Ga0466719_396836_1007_2101 364
6 3300042655 Ga0466727_055928 Ga0466727_055928_485_1594 369
7 3300005201 Ga0072941_1085555 Ga0072941_10855552 373
8 3300002834 JGI24696J40584_12959266 JGI24696J40584_129592664 381
9 3300042601 Ga0466707_407745 Ga0466707_407745_2345_3529 384
10 3300042648 Ga0466709_237921 Ga0466709_237921_65521_66702 384
11 3300010882 Ga0123354_10286828 Ga0123354_102868282 385
12 3300042596 Ga0466696_036809 Ga0466696_036809_2396_3553 385
13 2225789004 2227094706 2227475401 386
14 3300009784 Ga0123357_10094667 Ga0123357_100946673 386
15 3300042591 Ga0466692_030788 Ga0466692_030788_18961_20121 386
16 3300042615 Ga0466711_116634 Ga0466711_116634_311_1492 386
17 3300042616 Ga0466715_026255 Ga0466715_026255_23687_24847 386
18 3300042643 Ga0466704_326796 Ga0466704_326796_3303_4463 386
19 2225789004 2227469382 2227913175 387
20 3300042601 Ga0466707_047616 Ga0466707_047616_17827_19005 387
21 3300042605 Ga0466716_025263 Ga0466716_025263_1241_2404 387
22 3300042612 Ga0466705_091702 Ga0466705_091702_854_2035 387
23 3300042643 Ga0466704_080054 Ga0466704_080054_1977_3140 387
24 3300042643 Ga0466704_310944 Ga0466704_310944_3387_4568 387
25 3300000062 IMNBL1DRAFT_c0001265 IMNBL1DRAFT_000126510 388
26 3300042600 Ga0466700_051149 Ga0466700_051149_2001_3167 388
27 3300042605 Ga0466716_222741 Ga0466716_222741_20758_21924 388
28 3300042612 Ga0466705_157525 Ga0466705_157525_2832_3998 388
29 3300042615 Ga0466711_335316 Ga0466711_335316_12650_13843 388
30 3300042616 Ga0466715_434942 Ga0466715_434942_12989_14155 388
31 3300042624 Ga0466735_150369 Ga0466735_150369_6403_7569 388
32 3300042655 Ga0466727_348819 Ga0466727_348819_1061_2227 388
33 iso_pr_bacteria 2967483437 2967483547 388
34 3300000062 IMNBL1DRAFT_c0001060 IMNBL1DRAFT_000106013 389
35 3300002509 JGI24699J35502_11041860 JGI24699J35502_110418601 389
36 3300010167 Ga0123353_10104342 Ga0123353_101043423 389
37 3300042590 Ga0466690_042712 Ga0466690_042712_3570_4739 389
38 3300042643 Ga0466704_028752 Ga0466704_028752_1916_3085 389
39 3300002462 JGI24702J35022_10007620 JGI24702J35022_100076203 390
40 3300010049 Ga0123356_10416906 Ga0123356_104169061 390
41 3300042590 Ga0466690_371428 Ga0466690_371428_3786_4958 390
42 3300042591 Ga0466692_156077 Ga0466692_156077_12527_13699 390
43 3300042618 Ga0466723_308452 Ga0466723_308452_1959_3131 390
44 3300042619 Ga0466726_323435 Ga0466726_323435_519_1691 390
45 3300042620 Ga0466728_080958 Ga0466728_080958_1793_2965 390
46 3300002504 JGI24705J35276_12217820 JGI24705J35276_122178202 391
47 3300009784 Ga0123357_10104810 Ga0123357_101048104 391
48 3300010882 Ga0123354_10002051 Ga0123354_1000205112 391
49 3300010882 Ga0123354_10016367 Ga0123354_100163675 391
50 3300042590 Ga0466690_096137 Ga0466690_096137_7340_8515 391
51 3300042593 Ga0466691_116484 Ga0466691_116484_9643_10818 391
52 3300042601 Ga0466707_231685 Ga0466707_231685_1964_3139 391
53 3300042601 Ga0466707_242973 Ga0466707_242973_7590_8765 391
54 3300042609 Ga0466722_221149 Ga0466722_221149_1153_2328 391
55 3300042616 Ga0466715_632327 Ga0466715_632327_9730_10905 391
56 3300042618 Ga0466723_140313 Ga0466723_140313_8899_10074 391
57 3300042619 Ga0466726_347450 Ga0466726_347450_15983_17158 391
58 3300042620 Ga0466728_081622 Ga0466728_081622_246_1421 391
59 3300042621 Ga0466729_270565 Ga0466729_270565_1061_2236 391
60 3300042655 Ga0466727_122982 Ga0466727_122982_23143_24318 391
61 3300009784 Ga0123357_10030365 Ga0123357_100303655 392
62 3300010882 Ga0123354_10229950 Ga0123354_102299502 392
63 3300042590 Ga0466690_059913 Ga0466690_059913_15694_16872 392
64 3300042591 Ga0466692_043166 Ga0466692_043166_8161_9339 392
65 3300042606 Ga0466719_192439 Ga0466719_192439_16184_17362 392
66 3300042612 Ga0466705_309809 Ga0466705_309809_321_1499 392
67 3300042636 Ga0466703_039625 Ga0466703_039625_4976_6154 392
68 iso_pr_bacteria 2820759988 2820760809 392
69 3300002509 JGI24699J35502_11133697 JGI24699J35502_1113369711 393
70 3300002509 JGI24699J35502_11134190 JGI24699J35502_1113419018 393
71 3300042612 Ga0466705_150477 Ga0466705_150477_1306_2487 393
72 3300042616 Ga0466715_074426 Ga0466715_074426_791_1972 393
73 3300042616 Ga0466715_079781 Ga0466715_079781_301_1482 393
74 3300042618 Ga0466723_030107 Ga0466723_030107_4735_5916 393
75 3300042619 Ga0466726_203148 Ga0466726_203148_5947_7128 393
76 3300042636 Ga0466703_034601 Ga0466703_034601_2208_3389 393
77 3300042643 Ga0466704_062323 Ga0466704_062323_2557_3738 393
78 3300042648 Ga0466709_330887 Ga0466709_330887_250_1431 393
79 3300042655 Ga0466727_101102 Ga0466727_101102_1493_2674 393
80 3300005071 Ga0068302_10655189 Ga0068302_106551891 394
81 3300009784 Ga0123357_10225557 Ga0123357_102255572 394
82 3300010882 Ga0123354_10000156 Ga0123354_100001569 394
83 3300042590 Ga0466690_033411 Ga0466690_033411_3338_4522 394
84 3300042590 Ga0466690_034127 Ga0466690_034127_8164_9348 394
85 3300042590 Ga0466690_342154 Ga0466690_342154_472_1656 394
86 3300042596 Ga0466696_125373 Ga0466696_125373_692_1876 394
87 3300042596 Ga0466696_227064 Ga0466696_227064_30281_31465 394
88 3300042606 Ga0466719_470350 Ga0466719_470350_518_1702 394
89 3300042616 Ga0466715_019376 Ga0466715_019376_3882_5066 394
90 3300042616 Ga0466715_048593 Ga0466715_048593_1019_2203 394
91 3300042618 Ga0466723_224327 Ga0466723_224327_3911_5095 394
92 3300042620 Ga0466728_300584 Ga0466728_300584_3414_4598 394
93 3300042621 Ga0466729_275550 Ga0466729_275550_1440_2624 394
94 3300042636 Ga0466703_009348 Ga0466703_009348_5551_6735 394
95 3300042648 Ga0466709_049597 Ga0466709_049597_946_2130 394
96 3300002462 JGI24702J35022_10008174 JGI24702J35022_100081742 395
97 3300042593 Ga0466691_033116 Ga0466691_033116_5908_7095 395
98 3300042601 Ga0466707_328711 Ga0466707_328711_101_1288 395
99 3300042615 Ga0466711_040919 Ga0466711_040919_4205_5392 395
100 3300042618 Ga0466723_048094 Ga0466723_048094_246_1433 395
101 3300042618 Ga0466723_178996 Ga0466723_178996_3509_4696 395
102 3300042601 Ga0466707_008556 Ga0466707_008556_333_1526 397
103 3300042606 Ga0466719_482507 Ga0466719_482507_1666_2859 397
104 3300042601 Ga0466707_301205 Ga0466707_301205_4800_5996 398
105 3300042618 Ga0466723_130968 Ga0466723_130968_862_2058 398
106 3300042601 Ga0466707_163341 Ga0466707_163341_263_1462 399
107 3300009784 Ga0123357_10001038 Ga0123357_100010383 400
108 3300042624 Ga0466735_156234 Ga0466735_156234_1847_3049 400
109 3300010882 Ga0123354_10285956 Ga0123354_102859562 401
110 3300042624 Ga0466735_014708 Ga0466735_014708_1068_2276 402
111 3300042602 Ga0466713_140716 Ga0466713_140716_1706_2917 403
112 3300042591 Ga0466692_038240 Ga0466692_038240_108_1322 404

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00248 Aldo_ket_red Aldo/keto reductase family 71 245 0.82
PF13534 Fer4_17 4Fe-4S dicluster domain 319 382 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.72 0.78 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.