Protein Family IF06135

Metagenome Isolate
199 Members
133 Samples
99 Scaffolds
507.75 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_121888|Ga0466713_121888_269_1864
Length
531 aa
Sequence
MIGGEDIASGVSGVYGVNDATGQDRAYLARNSLHAYLPGENKDLLPKDTRPLLERIKSRSKIVPSLEEAVRLSGLRDGMTVSFHHHFRNGDNIVNPVLDTLARMGFRNLRVAASSLNDVHEPMIGHIRAGVVDRIETSGLRGGLAEAVSRGLMAEPVVFRSHGGRAAAIQNGALHIDVAFLGAPSCDPYGNVNGYSREGQDHSACGSMGYARVDAQFADKVVALTDNIVPYPNTPFGIPQSQVDYIVEVDSVGEQAKIMTGATRQTKNPRDLLIAEKAAEVVIHSGYFVDGFSIQTGSGGAALAVTRFIRDEMAGRGVRASFALGGITGQIVRLHEEGLIKKLLDVQSFDVDAVESLKNNRFHQQIDANYYANPYNKGSAVNELDVVVLSALEIDENFNVNVLTGSDGVIRGAIGGHQDTAAGAALSVLVGPLVRGRIPTVLRRVNTVVTPGDTVDVFVSDQGCAVNPRRPEVAARLARAGVDVYTMDELRRKAERMTGEPDPLPFGDKVVGVVTYRDGSVLDLIYDVRDS

πŸ“Š Sample Types

Isolate 50.2%
Metagenome 49.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 28.9%
Apidae 25.8%
Drosophilidae 15.6%
Kalotermitidae 11.7%
Culicidae 3.9%
Termitidae 3.9%
Termopsidae 2.3%
Rhinotermitidae 1.6%
Passalidae 1.6%
Vespidae 0.8%
Bombycidae 0.8%
Hodotermitidae 0.8%
Hydrophilidae 0.8%
Tenebrionidae 0.8%
Pyrrhocoridae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 191
Eukaryota 0
Viruses 0
Unclassified 8

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
2 2595698193 Melissococcus plutonius B5 Isolate Apidae
3 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
4 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
5 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
6 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
7 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
8 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
9 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
10 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
11 2964145936 Entomospira culicis BR149 Isolate Culicidae
12 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
13 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
14 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
15 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
16 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
17 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
18 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
21 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
24 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
27 2595698195 Melissococcus plutonius 119 Isolate Apidae
28 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
29 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
30 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
31 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
32 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
33 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
34 2964144231 Entomospira culicis BR151 Isolate Culicidae
35 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
36 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
37 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
39 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
40 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 2595698197 Melissococcus plutonius H6 Isolate Apidae
43 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
44 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
45 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
46 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
47 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
48 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
49 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
50 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
51 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
52 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
53 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
54 8063595521 Entomospira culicis BR149 Isolate Culicidae
55 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
56 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
57 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
58 8114555646 Enterococcus sp. DIV1094 Isolate
59 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
60 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
61 2627853628 Melissococcus plutonius 82 Isolate Apidae
62 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
63 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
64 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
65 2651870343 Fructobacillus sp. EFB-N1 Isolate Apidae
66 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
67 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
68 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
69 2595698199 Melissococcus plutonius 60 Isolate Apidae
70 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
71 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
72 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
73 2756170272 Convivina intestini DSM 28795 Isolate Unclassified
74 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
75 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
76 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
77 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
78 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
79 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
80 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
81 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
82 3004719924 Lactobacillus sp. W8174 Isolate Apidae
83 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
84 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
85 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
86 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
87 8017489919 Lactobacillus brevis EF Isolate Unclassified
88 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
89 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
90 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
91 2595698198 Melissococcus plutonius L9 Isolate Apidae
92 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
93 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
94 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
95 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
96 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
97 2834540479 Leuconostoc citreum DmW_111 Isolate Drosophilidae
98 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
99 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
100 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
101 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
102 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
103 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
104 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
105 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
106 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
107 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
108 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
109 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
110 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
111 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
112 2558860239 Spiroplasma culicicola AES-1 Isolate Culicidae
113 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
114 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
115 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
116 8063597228 Entomospira culicis BR151 Isolate Culicidae
117 8108568626 Enterococcus sp. DIV1094 Isolate
118 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
119 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
120 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
121 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
122 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
123 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
124 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
125 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
126 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
127 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
128 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
129 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
130 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
131 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
132 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
133 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_192553 3300042612 Unclassified 2882
2 Ga0466723_005889 3300042618 Bacteria 5667
3 Ga0466723_039096 3300042618 Bacteria 7654
4 Ga0466728_086008 3300042620 Bacteria 6421
5 HBC_ctgsDRAFT_1000128 3300000333 Bacteria 18614
6 Ga0123353_10292783 3300010167 Bacteria 2491
7 Ga0466690_408750 3300042590 Bacteria 2342
8 Ga0466691_087208 3300042593 Bacteria 7646
9 Ga0466696_256157 3300042596 Bacteria 36381
10 Ga0466709_181411 3300042648 Bacteria 2801
11 Ga0466708_203793 3300042652 Bacteria 10598
12 Ga0466708_217874 3300042652 Bacteria 5135
13 Ga0466727_174131 3300042655 Bacteria 11843
14 Ga0466719_162096 3300042606 Bacteria 14272
15 Ga0466705_027160 3300042612 Bacteria 4396
16 Ga0466705_266488 3300042612 Bacteria 6915
17 Ga0466715_115730 3300042616 Bacteria 8275
18 Ga0466715_213975 3300042616 Bacteria 22156
19 Ga0466704_080029 3300042643 Bacteria 18024
20 Ga0466704_204150 3300042643 Bacteria 13724
21 Ga0466706_046447 3300042599 Unclassified 1455
22 Ga0466707_348765 3300042601 Bacteria 5377
23 Ga0466714_161318 3300042603 Bacteria 3202
24 Ga0466705_097527 3300042612 Bacteria 3972
25 Ga0562379_0011 3300056790 Bacteria 1623141
26 Ga0466711_236971 3300042615 Bacteria 16778
27 Ga0466723_141990 3300042618 Unclassified 6767
28 2227463829 2225789004 Bacteria 5292
29 IMNBL1DRAFT_c0003046 3300000062 Bacteria 11065
30 Ga0466691_153370 3300042593 Bacteria 12863
31 Ga0466703_179720 3300042636 Bacteria 3896
32 Ga0466703_360167 3300042636 Bacteria 4354
33 Ga0466704_050841 3300042643 Bacteria 2764
34 Ga0466704_168208 3300042643 Bacteria 28884
35 Ga0466708_026639 3300042652 Bacteria 11263
36 Ga0466708_160348 3300042652 Bacteria 7764
37 Ga0466706_038590 3300042599 Bacteria 35108
38 Ga0466700_095378 3300042600 Bacteria 87403
39 Ga0466713_121888 3300042602 Bacteria 4587
40 Ga0466719_112665 3300042606 Bacteria 44651
41 Ga0466719_178424 3300042606 Bacteria 1853
42 Ga0466726_159671 3300042619 Bacteria 3477
43 Ga0466728_137448 3300042620 Bacteria 10677
44 IMNBL1DRAFT_c0000405 3300000062 Bacteria 36558
45 Ga0466690_045159 3300042590 Bacteria 6795
46 Ga0466691_136277 3300042593 Bacteria 5664
47 Ga0466735_020407 3300042624 Unclassified 8027
48 Ga0466719_275760 3300042606 Bacteria 8100
49 Ga0466705_149154 3300042612 Bacteria 4648
50 Ga0466733_074647 3300042659 Bacteria 10950
51 Ga0466711_095116 3300042615 Bacteria 15490
52 Ga0466715_334969 3300042616 Bacteria 10133
53 Ga0466728_205127 3300042620 Bacteria 3665
54 HBC_ctgsDRAFT_1000633 3300000333 Unclassified 7789
55 Ga0466696_109442 3300042596 Bacteria 7513
56 Ga0466734_019259 3300042623 Bacteria 11227
57 Ga0466708_303285 3300042652 Bacteria 18072
58 Ga0466714_089617 3300042603 Bacteria 1891
59 Ga0466719_398592 3300042606 Bacteria 7898
60 Ga0466722_080785 3300042609 Bacteria 2158
61 Ga0466722_126134 3300042609 Bacteria 12087
62 Ga0466715_408870 3300042616 Bacteria 12544
63 Ga0466715_510871 3300042616 Bacteria 6762
64 Ga0466723_113123 3300042618 Bacteria 12537
65 Ga0466726_401888 3300042619 Bacteria 18079
66 Ga0466728_034112 3300042620 Bacteria 27725
67 Ga0068305_10064205 3300005083 Bacteria 3119
68 Ga0466692_070667 3300042591 Bacteria 3161
69 Ga0466704_084651 3300042643 Bacteria 24091
70 Ga0466704_441158 3300042643 Bacteria 10702
71 Ga0466704_544874 3300042643 Bacteria 5202
72 Ga0466707_010078 3300042601 Bacteria 2927
73 Ga0466716_084409 3300042605 Bacteria 10346
74 Ga0466719_566348 3300042606 Bacteria 4658
75 Ga0466705_163372 3300042612 Bacteria 5354
76 Ga0466733_167157 3300042659 Bacteria 20372
77 Ga0466711_253371 3300042615 Bacteria 3457
78 Ga0466715_229423 3300042616 Bacteria 5672
79 Ga0466723_233626 3300042618 Bacteria 17477
80 Ga0466690_376828 3300042590 Bacteria 3979
81 Ga0466692_035955 3300042591 Bacteria 4207
82 Ga0466703_233480 3300042636 Bacteria 8622
83 Ga0466722_065491 3300042609 Bacteria 8979
84 Ga0466705_204125 3300042612 Bacteria 12824
85 Ga0466705_318713 3300042612 Unclassified 2012
86 Ga0466711_134598 3300042615 Bacteria 10753
87 Ga0466715_533916 3300042616 Bacteria 24126
88 Ga0466726_014016 3300042619 Bacteria 2329
89 2227591284 2225789004 Bacteria 48103
90 IMNBL1DRAFT_c0017592 3300000062 Bacteria 3002
91 Ga0074278_119844 3300005721 Unclassified 8334
92 Ga0074278_142236 3300005721 Bacteria 46389
93 Ga0466690_196149 3300042590 Bacteria 27057
94 Ga0466696_177692 3300042596 Bacteria 5179
95 Ga0466703_173516 3300042636 Bacteria 3474
96 Ga0466704_489140 3300042643 Bacteria 9974
97 Ga0466704_528612 3300042643 Bacteria 5448
98 Ga0466709_121017 3300042648 Bacteria 2518
99 Ga0466727_238638 3300042655 Unclassified 2174

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_046447 Ga0466706_046447_147_1445 432
2 3300000333 HBC_ctgsDRAFT_1000128 HBC_ctgsDRAFT_10001281 439
3 3300042612 Ga0466705_192553 Ga0466705_192553_1322_2839 455
4 3300042655 Ga0466727_238638 Ga0466727_238638_198_1730 464
5 3300042643 Ga0466704_050841 Ga0466704_050841_219_1745 469
6 3300042591 Ga0466692_070667 Ga0466692_070667_1579_3117 471
7 3300042599 Ga0466706_038590 Ga0466706_038590_30269_31807 471
8 3300042600 Ga0466700_095378 Ga0466700_095378_65874_67412 472
9 3300042659 Ga0466733_167157 Ga0466733_167157_16778_18316 475
10 iso_pr_bacteria 2781125694 2781435200 477
11 3300042601 Ga0466707_348765 Ga0466707_348765_2444_3949 486
12 3300042603 Ga0466714_161318 Ga0466714_161318_1685_3166 493
13 3300042648 Ga0466709_121017 Ga0466709_121017_305_1822 496
14 3300056790 Ga0562379_0011 Ga0562379_0011_873823_875361 496
15 3300042616 Ga0466715_334969 Ga0466715_334969_6165_7718 499
16 3300042616 Ga0466715_533916 Ga0466715_533916_5916_7469 499
17 3300042601 Ga0466707_010078 Ga0466707_010078_1210_2751 500
18 3300042618 Ga0466723_141990 Ga0466723_141990_2565_4067 500
19 3300042652 Ga0466708_303285 Ga0466708_303285_3769_5304 500
20 3300042652 Ga0466708_160348 Ga0466708_160348_5579_7111 501
21 3300042636 Ga0466703_173516 Ga0466703_173516_36_1547 503
22 3300042590 Ga0466690_408750 Ga0466690_408750_708_2225 505
23 3300042593 Ga0466691_153370 Ga0466691_153370_6760_8277 505
24 3300042596 Ga0466696_109442 Ga0466696_109442_528_2045 505
25 3300042596 Ga0466696_177692 Ga0466696_177692_820_2337 505
26 3300042606 Ga0466719_178424 Ga0466719_178424_228_1745 505
27 3300042612 Ga0466705_097527 Ga0466705_097527_1193_2710 505
28 3300042612 Ga0466705_163372 Ga0466705_163372_2320_3837 505
29 3300042612 Ga0466705_266488 Ga0466705_266488_3841_5358 505
30 3300042612 Ga0466705_318713 Ga0466705_318713_71_1588 505
31 3300042616 Ga0466715_229423 Ga0466715_229423_706_2223 505
32 3300042620 Ga0466728_086008 Ga0466728_086008_2834_4351 505
33 3300042620 Ga0466728_137448 Ga0466728_137448_6452_7969 505
34 3300042636 Ga0466703_179720 Ga0466703_179720_2093_3610 505
35 3300042643 Ga0466704_528612 Ga0466704_528612_2751_4268 505
36 3300042648 Ga0466709_181411 Ga0466709_181411_960_2477 505
37 3300042652 Ga0466708_203793 Ga0466708_203793_2562_4079 505
38 3300042593 Ga0466691_136277 Ga0466691_136277_3061_4581 506
39 3300042596 Ga0466696_256157 Ga0466696_256157_26531_28051 506
40 3300042606 Ga0466719_162096 Ga0466719_162096_2804_4324 506
41 3300042606 Ga0466719_398592 Ga0466719_398592_2665_4185 506
42 3300042609 Ga0466722_080785 Ga0466722_080785_530_2050 506
43 3300042612 Ga0466705_027160 Ga0466705_027160_893_2413 506
44 3300042612 Ga0466705_204125 Ga0466705_204125_1494_3014 506
45 3300042615 Ga0466711_095116 Ga0466711_095116_517_2052 506
46 3300042615 Ga0466711_134598 Ga0466711_134598_3572_5092 506
47 3300042615 Ga0466711_253371 Ga0466711_253371_1836_3356 506
48 3300042616 Ga0466715_115730 Ga0466715_115730_5437_6957 506
49 3300042616 Ga0466715_408870 Ga0466715_408870_8176_9696 506
50 3300042616 Ga0466715_510871 Ga0466715_510871_2416_3936 506
51 3300042618 Ga0466723_039096 Ga0466723_039096_4558_6078 506
52 3300042620 Ga0466728_034112 Ga0466728_034112_18622_20142 506
53 3300042620 Ga0466728_205127 Ga0466728_205127_794_2314 506
54 3300042636 Ga0466703_233480 Ga0466703_233480_4631_6151 506
55 3300042643 Ga0466704_080029 Ga0466704_080029_12554_14074 506
56 3300042643 Ga0466704_084651 Ga0466704_084651_8871_10391 506
57 3300042643 Ga0466704_544874 Ga0466704_544874_1314_2834 506
58 3300042652 Ga0466708_217874 Ga0466708_217874_2468_3988 506
59 3300042603 Ga0466714_089617 Ga0466714_089617_277_1800 507
60 3300005083 Ga0068305_10064205 Ga0068305_100642051 509
61 3300042619 Ga0466726_014016 Ga0466726_014016_554_2083 509
62 3300042590 Ga0466690_196149 Ga0466690_196149_5024_6556 510
63 3300042591 Ga0466692_035955 Ga0466692_035955_337_1869 510
64 3300042593 Ga0466691_087208 Ga0466691_087208_4707_6239 510
65 3300042606 Ga0466719_275760 Ga0466719_275760_5073_6605 510
66 3300042609 Ga0466722_126134 Ga0466722_126134_3463_4995 510
67 3300042616 Ga0466715_213975 Ga0466715_213975_9788_11320 510
68 3300042618 Ga0466723_005889 Ga0466723_005889_3189_4721 510
69 3300042618 Ga0466723_233626 Ga0466723_233626_8681_10213 510
70 3300042636 Ga0466703_360167 Ga0466703_360167_1455_2987 510
71 3300042643 Ga0466704_441158 Ga0466704_441158_2977_4509 510
72 3300042655 Ga0466727_174131 Ga0466727_174131_2596_4128 510
73 iso_pr_bacteria 2881375749 2881377337 510
74 iso_pr_bacteria 8038268975 8038269450 510
75 iso_pr_bacteria 8108568626 8108571711 510
76 iso_pr_bacteria 8114555646 8114558731 510
77 2225789004 2227463829 2227899953 511
78 2225789004 2227591284 2228150700 511
79 3300010167 Ga0123353_10292783 Ga0123353_102927832 511
80 3300042605 Ga0466716_084409 Ga0466716_084409_4974_6509 511
81 3300042606 Ga0466719_112665 Ga0466719_112665_438_1973 511
82 3300042609 Ga0466722_065491 Ga0466722_065491_3573_5108 511
83 3300042615 Ga0466711_236971 Ga0466711_236971_4063_5598 511
84 3300042619 Ga0466726_159671 Ga0466726_159671_1632_3167 511
85 3300042624 Ga0466735_020407 Ga0466735_020407_4819_6354 511
86 3300000062 IMNBL1DRAFT_c0000405 IMNBL1DRAFT_000040526 512
87 3300000062 IMNBL1DRAFT_c0003046 IMNBL1DRAFT_000304611 512
88 3300042606 Ga0466719_566348 Ga0466719_566348_2502_4040 512
89 3300042619 Ga0466726_401888 Ga0466726_401888_6423_7961 512
90 3300042659 Ga0466733_074647 Ga0466733_074647_1640_3178 512
91 iso_pr_bacteria 2503538010 2503575360 512
92 iso_pr_bacteria 2576861670 2579166395 512
93 iso_pr_bacteria 2595698190 2596206653 512
94 iso_pr_bacteria 2595698193 2596212097 512
95 iso_pr_bacteria 2595698194 2596213959 512
96 iso_pr_bacteria 2595698195 2596215837 512
97 iso_pr_bacteria 2595698196 2596217542 512
98 iso_pr_bacteria 2595698197 2596219459 512
99 iso_pr_bacteria 2595698198 2596221203 512
100 iso_pr_bacteria 2595698199 2596223101 512
101 iso_pr_bacteria 2597490239 2598798587 512
102 iso_pr_bacteria 2597490293 2598963571 512
103 iso_pr_bacteria 2627853628 2628281547 512
104 iso_pr_bacteria 2630968413 2631702445 512
105 iso_pr_bacteria 2645727721 2646684451 512
106 iso_pr_bacteria 2651870343 2654486811 512
107 iso_pr_bacteria 2684622911 2686073781 512
108 iso_pr_bacteria 2684622913 2686077372 512
109 iso_pr_bacteria 2684622914 2686079220 512
110 iso_pr_bacteria 2690315820 2691200642 512
111 iso_pr_bacteria 2718218475 2721607375 512
112 iso_pr_bacteria 2728369362 2730150227 512
113 iso_pr_bacteria 2756170272 2756775573 512
114 iso_pr_bacteria 2758568501 2760245326 512
115 iso_pr_bacteria 2758568502 2760246939 512
116 iso_pr_bacteria 2758568503 2760248601 512
117 iso_pr_bacteria 2758568504 2760250263 512
118 iso_pr_bacteria 2758568505 2760251873 512
119 iso_pr_bacteria 2758568506 2760253584 512
120 iso_pr_bacteria 2758568507 2760255240 512
121 iso_pr_bacteria 2758568508 2760256939 512
122 iso_pr_bacteria 2758568509 2760258639 512
123 iso_pr_bacteria 2758568510 2760260351 512
124 iso_pr_bacteria 2758568511 2760262149 512
125 iso_pr_bacteria 2758568512 2760263898 512
126 iso_pr_bacteria 2758568513 2760265741 512
127 iso_pr_bacteria 2758568514 2760267718 512
128 iso_pr_bacteria 2758568515 2760269584 512
129 iso_pr_bacteria 2758568558 2760424878 512
130 iso_pr_bacteria 2770939318 2771020143 512
131 iso_pr_bacteria 2785510748 2785747324 512
132 iso_pr_bacteria 2799112220 2799191525 512
133 iso_pr_bacteria 2799112229 2799228675 512
134 iso_pr_bacteria 2799112230 2799231593 512
135 iso_pr_bacteria 2814123166 2815022457 512
136 iso_pr_bacteria 2834540479 2834541571 512
137 iso_pr_bacteria 2851410423 2851411396 512
138 iso_pr_bacteria 2851412233 2851413515 512
139 iso_pr_bacteria 2873581347 2873583189 512
140 iso_pr_bacteria 2877513988 2877515036 512
141 iso_pr_bacteria 2882334426 2882334614 512
142 iso_pr_bacteria 2896843662 2896845052 512
143 iso_pr_bacteria 2937236879 2937237609 512
144 iso_pr_bacteria 2956926959 2956927747 512
145 iso_pr_bacteria 2956928875 2956929685 512
146 iso_pr_bacteria 2956930723 2956931124 512
147 iso_pr_bacteria 2957623355 2957624580 512
148 iso_pr_bacteria 2958885890 2958886701 512
149 iso_pr_bacteria 2960772748 2960773338 512
150 iso_pr_bacteria 2961465228 2961466047 512
151 iso_pr_bacteria 2961515617 2961516550 512
152 iso_pr_bacteria 2964739456 2964740666 512
153 iso_pr_bacteria 2964749277 2964750292 512
154 iso_pr_bacteria 2964765680 2964767634 512
155 iso_pr_bacteria 2964775400 2964777149 512
156 iso_pr_bacteria 2964778705 2964779615 512
157 iso_pr_bacteria 2967802344 2967803657 512
158 iso_pr_bacteria 2967825073 2967826430 512
159 iso_pr_bacteria 2968368220 2968369270 512
160 iso_pr_bacteria 2970199020 2970200243 512
161 iso_pr_bacteria 2970225615 2970227005 512
162 iso_pr_bacteria 2970254690 2970255560 512
163 iso_pr_bacteria 2971062614 2971063297 512
164 iso_pr_bacteria 2977592972 2977594164 512
165 iso_pr_bacteria 2977596371 2977596655 512
166 iso_pr_bacteria 2977622177 2977623612 512
167 iso_pr_bacteria 2977628635 2977629709 512
168 iso_pr_bacteria 2977635137 2977636206 512
169 iso_pr_bacteria 2977653127 2977654340 512
170 iso_pr_bacteria 2979949929 2979950893 512
171 iso_pr_bacteria 3004719924 3004720274 512
172 iso_pr_bacteria 650716050 650846176 512
173 iso_pr_bacteria 8001918023 8001919272 512
174 iso_pr_bacteria 8004832522 8004833329 512
175 iso_pr_bacteria 8017440191 8017441444 512
176 iso_pr_bacteria 8017462664 8017463805 512
177 iso_pr_bacteria 8017489919 8017492566 512
178 iso_pr_bacteria 8017536074 8017537181 512
179 3300000333 HBC_ctgsDRAFT_1000633 HBC_ctgsDRAFT_10006336 513
180 3300005721 Ga0074278_119844 Ga0074278_1198445 513
181 3300005721 Ga0074278_142236 Ga0074278_14223618 513
182 3300042590 Ga0466690_045159 Ga0466690_045159_1402_2943 513
183 3300042618 Ga0466723_113123 Ga0466723_113123_8838_10379 513
184 3300042643 Ga0466704_489140 Ga0466704_489140_2900_4441 513
185 3300042652 Ga0466708_026639 Ga0466708_026639_990_2531 513
186 iso_pr_bacteria 651324002 651580935 513
187 3300042623 Ga0466734_019259 Ga0466734_019259_4938_6482 514
188 iso_pr_bacteria 2558860239 2559285793 516
189 iso_pr_bacteria 2645727657 2646404674 516
190 3300042612 Ga0466705_149154 Ga0466705_149154_1534_3087 517
191 3300042643 Ga0466704_168208 Ga0466704_168208_20320_21873 517
192 3300042643 Ga0466704_204150 Ga0466704_204150_3679_5232 517
193 3300042590 Ga0466690_376828 Ga0466690_376828_1087_2643 518
194 3300000062 IMNBL1DRAFT_c0017592 IMNBL1DRAFT_00175923 519
195 iso_pr_bacteria 2964144231 2964144867 520
196 iso_pr_bacteria 2964145936 2964146754 520
197 iso_pr_bacteria 8063595521 8063596344 520
198 iso_pr_bacteria 8063597228 8063598047 520
199 3300042602 Ga0466713_121888 Ga0466713_121888_269_1864 531

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04223 CitF Citrate lyase, alpha subunit (CitF) 61 528 0.99

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.91 0.95 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.