Protein Family IF06126

Metagenome Isolate
107 Members
47 Samples
99 Scaffolds
314.93 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_115337|Ga0466713_115337_62734_63798
Length
354 aa
Sequence
LPPKEWDYKKNAIFAEIAYCLSVISVIINGIDFRRMSKEKYRALCQTEESIPIFSQDWWLDVVCGEANWDVLLIEKNDRILAAWPLYIPLRGVVTMPPYTQTMGVWFAPTSDDTKYHSTLEKRQALCNQLIEKLKTRVFLQNFNYAFTDWLPFYWKGYKQTTRYTYLLKDLNNRNVLRENMNRQMRRNIRDARNKFNIEVKSGVAADSFIQIQDQTFERQRLRNKQDPHVLRHLIAACRERKQGDIWGGYDSDGQLHAAAFVVWQKRSAYYIAGGGNPSFRHSGAHSLVLWEAIKQVSQYTDTFDFEGSMLPGVERFFREFGGVQTPYFAVSKGKIGLLDRAIIKLSKAYRCKT

📊 Sample Types

Isolate 7.5%
Metagenome 92.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 29.8%
Termitidae 23.4%
Blattidae 12.8%
Unclassified 10.6%
Termopsidae 8.5%
Rhinotermitidae 6.4%
Passalidae 6.4%
Hodotermitidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 103
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 2923982719 Parabacteroides sp. 52 Isolate Blattidae
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
11 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
12 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
13 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
14 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
15 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
16 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
22 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
23 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
24 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
25 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
29 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
35 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
36 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
37 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
38 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
39 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
40 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
43 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
44 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
45 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
46 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
47 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10008689 3300009784 Bacteria 12726
2 Ga0123357_10255469 3300009784 Bacteria 1864
3 Ga0466705_012784 3300042612 Bacteria 2584
4 Ga0466735_152975 3300042624 Bacteria 3175
5 Ga0466703_206962 3300042636 Bacteria 15694
6 Ga0466703_302285 3300042636 Bacteria 14876
7 Ga0466704_107047 3300042643 Bacteria 25370
8 Ga0466704_123406 3300042643 Bacteria 3047
9 Ga0466708_292984 3300042652 Bacteria 60416
10 Ga0466705_492646 3300042612 Bacteria 19254
11 Ga0466711_007791 3300042615 Bacteria 31232
12 Ga0466711_045925 3300042615 Bacteria 6905
13 Ga0466723_023862 3300042618 Bacteria 63714
14 Ga0466729_105991 3300042621 Bacteria 7753
15 Ga0466701_037235 3300042598 Bacteria 2274
16 Ga0466706_268163 3300042599 Bacteria 17265
17 Ga0466713_035202 3300042602 Bacteria 9215
18 Ga0466713_042007 3300042602 Bacteria 37825
19 Ga0466713_136676 3300042602 Unclassified 10591
20 Ga0466716_434282 3300042605 Bacteria 11943
21 Ga0466719_270979 3300042606 Bacteria 8646
22 JGI24702J35022_10001443 3300002462 Bacteria 14826
23 Ga0466733_150744 3300042659 Bacteria 51643
24 Ga0466690_255308 3300042590 Bacteria 8276
25 Ga0466691_024094 3300042593 Bacteria 43041
26 Ga0466696_049767 3300042596 Bacteria 8340
27 Ga0466704_006648 3300042643 Bacteria 19242
28 Ga0466727_091484 3300042655 Bacteria 30499
29 Ga0466711_188604 3300042615 Bacteria 11040
30 Ga0466715_008078 3300042616 Bacteria 17386
31 Ga0466715_134828 3300042616 Bacteria 35442
32 Ga0466715_483124 3300042616 Bacteria 7569
33 Ga0466716_380608 3300042605 Bacteria 11528
34 Ga0466722_112887 3300042609 Bacteria 4216
35 2227414121 2225789004 Bacteria 26644
36 2227474646 2225789004 Unclassified 4710
37 IMNBL1DRAFT_c0002035 3300000062 Bacteria 14472
38 JGI24702J35022_10017426 3300002462 Bacteria 3925
39 JGI24699J35502_11134095 3300002509 Bacteria 30132
40 Ga0466691_044457 3300042593 Bacteria 8884
41 Ga0466696_122399 3300042596 Bacteria 9442
42 Ga0123354_10000099 3300010882 Bacteria 64622
43 Ga0466704_036087 3300042643 Bacteria 26125
44 Ga0466704_065737 3300042643 Bacteria 18488
45 Ga0466704_378852 3300042643 Bacteria 3796
46 Ga0466727_073242 3300042655 Bacteria 11332
47 Ga0466727_178048 3300042655 Bacteria 12464
48 Ga0466723_006640 3300042618 Bacteria 26078
49 Ga0466726_006104 3300042619 Bacteria 6838
50 Ga0466726_026507 3300042619 Bacteria 1067
51 Ga0466707_277127 3300042601 Bacteria 2823
52 Ga0466719_036494 3300042606 Bacteria 9769
53 Ga0466722_224363 3300042609 Bacteria 1633
54 Ga0072940_1152097 3300005200 Bacteria 2725
55 Ga0466690_090234 3300042590 Bacteria 9390
56 Ga0466694_278584 3300042594 Bacteria 2443
57 Ga0466703_141647 3300042636 Bacteria 5459
58 Ga0466713_149568 3300042602 Bacteria 40583
59 Ga0466703_402296 3300042636 Bacteria 9318
60 Ga0466704_026702 3300042643 Bacteria 22766
61 Ga0466704_352971 3300042643 Bacteria 7757
62 Ga0466711_004827 3300042615 Bacteria 1772
63 Ga0466711_155616 3300042615 Bacteria 19142
64 Ga0466711_284098 3300042615 Bacteria 9669
65 Ga0466723_176790 3300042618 Bacteria 13031
66 Ga0466713_120191 3300042602 Bacteria 32830
67 Ga0466716_388667 3300042605 Bacteria 5919
68 Ga0466719_396693 3300042606 Bacteria 6052
69 Ga0466696_076877 3300042596 Bacteria 23333
70 Ga0123356_10084275 3300010049 Bacteria 3012
71 Ga0466709_406024 3300042648 Bacteria 9175
72 Ga0466715_043124 3300042616 Bacteria 4518
73 Ga0466726_208996 3300042619 Bacteria 1205
74 JGI24702J35022_10130229 3300002462 Unclassified 1396
75 Ga0068302_10026749 3300005071 Bacteria 8711
76 Ga0068302_10026750 3300005071 Unclassified 1730
77 Ga0123353_10174313 3300010167 Bacteria 3411
78 Ga0466705_345985 3300042612 Bacteria 2985
79 Ga0466703_337300 3300042636 Bacteria 12920
80 Ga0466704_521090 3300042643 Bacteria 6402
81 Ga0466711_291776 3300042615 Bacteria 3299
82 Ga0466728_289140 3300042620 Bacteria 8953
83 Ga0466713_019762 3300042602 Bacteria 3322
84 Ga0466713_115337 3300042602 Bacteria 64305
85 JGI24702J35022_10000230 3300002462 Bacteria 31710
86 Ga0068305_10068846 3300005083 Bacteria 15630
87 Ga0466690_037173 3300042590 Bacteria 22326
88 Ga0466692_100322 3300042591 Bacteria 97018
89 Ga0466696_097993 3300042596 Bacteria 8133
90 Ga0466696_302479 3300042596 Bacteria 58494
91 Ga0123356_10070314 3300010049 Bacteria 3283
92 Ga0466703_130328 3300042636 Bacteria 7800
93 Ga0466704_252374 3300042643 Bacteria 11019
94 Ga0466704_466074 3300042643 Bacteria 9492
95 Ga0466725_215908 3300042654 Bacteria 2458
96 Ga0466727_061548 3300042655 Bacteria 36764
97 Ga0466727_323065 3300042655 Bacteria 9658
98 2227035911 2225789003 Bacteria 20837
99 Ga0068302_10453502 3300005071 Bacteria 2102

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_026507 Ga0466726_026507_252_1055 267
2 3300042615 Ga0466711_188604 Ga0466711_188604_1124_2068 289
3 3300010882 Ga0123354_10000099 Ga0123354_1000009935 297
4 3300002462 JGI24702J35022_10130229 JGI24702J35022_101302291 299
5 3300005071 Ga0068302_10026749 Ga0068302_100267495 300
6 3300042619 Ga0466726_208996 Ga0466726_208996_15_917 300
7 3300042593 Ga0466691_024094 Ga0466691_024094_34472_35401 302
8 3300042636 Ga0466703_302285 Ga0466703_302285_4728_5684 302
9 3300042596 Ga0466696_122399 Ga0466696_122399_2868_3815 303
10 3300042605 Ga0466716_388667 Ga0466716_388667_2337_3284 304
11 3300042643 Ga0466704_352971 Ga0466704_352971_5835_6782 304
12 3300042652 Ga0466708_292984 Ga0466708_292984_47754_48719 308
13 2225789003 2227035911 2227396245 310
14 2225789004 2227414121 2227855695 310
15 3300042602 Ga0466713_149568 Ga0466713_149568_39118_40077 310
16 2225789004 2227474646 2227925326 311
17 3300000062 IMNBL1DRAFT_c0002035 IMNBL1DRAFT_00020353 312
18 3300042590 Ga0466690_090234 Ga0466690_090234_3795_4733 312
19 3300042596 Ga0466696_302479 Ga0466696_302479_29677_30615 312
20 3300042612 Ga0466705_012784 Ga0466705_012784_931_1869 312
21 3300042612 Ga0466705_492646 Ga0466705_492646_5734_6672 312
22 3300042620 Ga0466728_289140 Ga0466728_289140_3381_4319 312
23 3300042643 Ga0466704_006648 Ga0466704_006648_12086_13024 312
24 3300042643 Ga0466704_026702 Ga0466704_026702_17821_18759 312
25 3300042643 Ga0466704_065737 Ga0466704_065737_15550_16488 312
26 3300042643 Ga0466704_252374 Ga0466704_252374_6954_7892 312
27 3300042655 Ga0466727_178048 Ga0466727_178048_5765_6703 312
28 3300042596 Ga0466696_076877 Ga0466696_076877_8937_9878 313
29 3300042601 Ga0466707_277127 Ga0466707_277127_1189_2130 313
30 3300042602 Ga0466713_035202 Ga0466713_035202_4278_5261 313
31 3300042605 Ga0466716_380608 Ga0466716_380608_6168_7109 313
32 3300042616 Ga0466715_134828 Ga0466715_134828_16611_17552 313
33 3300042621 Ga0466729_105991 Ga0466729_105991_2766_3707 313
34 3300042636 Ga0466703_206962 Ga0466703_206962_7001_7942 313
35 3300042643 Ga0466704_036087 Ga0466704_036087_4340_5281 313
36 3300010049 Ga0123356_10070314 Ga0123356_100703143 314
37 3300010167 Ga0123353_10174313 Ga0123353_101743132 314
38 3300042596 Ga0466696_049767 Ga0466696_049767_2469_3413 314
39 3300042598 Ga0466701_037235 Ga0466701_037235_461_1405 314
40 3300042605 Ga0466716_434282 Ga0466716_434282_1541_2485 314
41 3300042606 Ga0466719_036494 Ga0466719_036494_1048_1992 314
42 3300042606 Ga0466719_396693 Ga0466719_396693_4919_5863 314
43 3300042615 Ga0466711_045925 Ga0466711_045925_3853_4797 314
44 3300042616 Ga0466715_483124 Ga0466715_483124_2581_3525 314
45 3300042618 Ga0466723_023862 Ga0466723_023862_16891_17835 314
46 3300042619 Ga0466726_006104 Ga0466726_006104_5806_6750 314
47 3300042624 Ga0466735_152975 Ga0466735_152975_694_1638 314
48 3300042643 Ga0466704_123406 Ga0466704_123406_1230_2174 314
49 3300042643 Ga0466704_378852 Ga0466704_378852_1979_2923 314
50 3300042643 Ga0466704_466074 Ga0466704_466074_4104_5048 314
51 3300042654 Ga0466725_215908 Ga0466725_215908_924_1868 314
52 3300042655 Ga0466727_061548 Ga0466727_061548_25529_26473 314
53 3300042655 Ga0466727_091484 Ga0466727_091484_29254_30198 314
54 iso_pr_bacteria 2940195863 2940198254 314
55 3300002462 JGI24702J35022_10000230 JGI24702J35022_100002309 315
56 3300002462 JGI24702J35022_10001443 JGI24702J35022_100014437 315
57 3300002462 JGI24702J35022_10017426 JGI24702J35022_100174261 315
58 3300005071 Ga0068302_10026750 Ga0068302_100267501 315
59 3300010049 Ga0123356_10084275 Ga0123356_100842751 315
60 3300042590 Ga0466690_037173 Ga0466690_037173_20812_21759 315
61 3300042602 Ga0466713_042007 Ga0466713_042007_34720_35667 315
62 3300042602 Ga0466713_120191 Ga0466713_120191_14255_15202 315
63 3300042648 Ga0466709_406024 Ga0466709_406024_5988_6935 315
64 3300042659 Ga0466733_150744 Ga0466733_150744_20586_21533 315
65 3300042615 Ga0466711_004827 Ga0466711_004827_706_1656 316
66 3300042615 Ga0466711_284098 Ga0466711_284098_157_1107 316
67 3300042655 Ga0466727_073242 Ga0466727_073242_5493_6443 316
68 3300005071 Ga0068302_10453502 Ga0068302_104535022 317
69 3300005200 Ga0072940_1152097 Ga0072940_11520973 317
70 3300042590 Ga0466690_255308 Ga0466690_255308_5995_6948 317
71 3300042606 Ga0466719_270979 Ga0466719_270979_6626_7579 317
72 3300042636 Ga0466703_337300 Ga0466703_337300_7365_8318 317
73 3300042643 Ga0466704_521090 Ga0466704_521090_5408_6361 317
74 iso_pr_bacteria 2940199050 2940199627 317
75 iso_pr_bacteria 2940346213 2940347044 317
76 3300042599 Ga0466706_268163 Ga0466706_268163_10782_11738 318
77 3300042612 Ga0466705_345985 Ga0466705_345985_1005_1961 318
78 3300042615 Ga0466711_007791 Ga0466711_007791_2246_3202 318
79 3300042655 Ga0466727_323065 Ga0466727_323065_222_1178 318
80 3300042591 Ga0466692_100322 Ga0466692_100322_60319_61278 319
81 3300042602 Ga0466713_019762 Ga0466713_019762_902_1861 319
82 3300042602 Ga0466713_136676 Ga0466713_136676_3643_4602 319
83 3300042618 Ga0466723_006640 Ga0466723_006640_12568_13527 319
84 3300042618 Ga0466723_176790 Ga0466723_176790_6458_7417 319
85 iso_pr_bacteria 2940209341 2940209350 319
86 3300042593 Ga0466691_044457 Ga0466691_044457_6128_7090 320
87 3300042615 Ga0466711_155616 Ga0466711_155616_2244_3206 320
88 3300042616 Ga0466715_008078 Ga0466715_008078_4224_5186 320
89 3300042636 Ga0466703_130328 Ga0466703_130328_4069_5034 321
90 3300005083 Ga0068305_10068846 Ga0068305_1006884611 322
91 3300042643 Ga0466704_107047 Ga0466704_107047_10678_11646 322
92 3300042609 Ga0466722_112887 Ga0466722_112887_2811_3815 323
93 3300042594 Ga0466694_278584 Ga0466694_278584_1087_2061 324
94 3300042596 Ga0466696_097993 Ga0466696_097993_4694_5668 324
95 3300042636 Ga0466703_141647 Ga0466703_141647_2154_3128 324
96 3300042636 Ga0466703_402296 Ga0466703_402296_5345_6319 324
97 iso_pr_bacteria 2820757377 2820759909 324
98 iso_pr_bacteria 2820759988 2820761838 324
99 3300002509 JGI24699J35502_11134095 JGI24699J35502_1113409526 325
100 3300009784 Ga0123357_10008689 Ga0123357_100086893 325
101 3300009784 Ga0123357_10255469 Ga0123357_102554692 325
102 3300042616 Ga0466715_043124 Ga0466715_043124_3344_4327 327
103 iso_pr_bacteria 2923982719 2923984185 327
104 iso_pr_bacteria 2940371297 2940371858 327
105 3300042609 Ga0466722_224363 Ga0466722_224363_396_1382 328
106 3300042615 Ga0466711_291776 Ga0466711_291776_1398_2390 330
107 3300042602 Ga0466713_115337 Ga0466713_115337_62734_63798 354

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13480 Acetyltransf_6 Acetyltransferase (GNAT) domain 183 317 0.77

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.