Protein Family IF06108
Metagenome
Isolate
229
Members
92
Samples
200
Scaffolds
104.66
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_098132|Ga0466713_098132_6026_6337
- Length
- 103 aa
- Sequence
- MTLQITDGNFQELLQGGKPLVVDFWAEWCGPCRMIGPLVEELAETYKEQVTIGKVNVDENELPNEYGIRNIPTLLFFKDGAVVDKLVGAVQKSAIEEKIKAII
Sample Types
Isolate
12.7%
Metagenome
87.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.2%
Blattidae
18.0%
Kalotermitidae
15.7%
Unclassified
13.5%
Rhinotermitidae
5.6%
Termopsidae
3.4%
Armadillidiidae
3.4%
Apidae
3.4%
Passalidae
3.4%
Tenebrionidae
1.1%
Drosophilidae
1.1%
Formicidae
1.1%
Hodotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
213
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 2 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 3 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 4 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 5 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 6 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 7 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 8 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 9 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 10 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 11 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 12 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 13 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 14 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 15 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 16 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 17 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 18 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 19 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 20 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 21 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 22 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 23 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 24 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 25 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 26 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 27 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 28 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 35 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 36 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 37 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 38 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 41 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 42 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 47 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 48 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 49 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 50 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 51 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 52 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 53 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 54 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 55 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 56 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 57 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 58 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 59 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 60 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 61 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 62 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 63 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 64 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 65 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 66 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 67 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 68 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 69 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 70 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 71 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 72 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 73 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 74 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 75 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 76 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 77 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 78 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 79 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 80 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 81 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 82 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 83 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 84 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 85 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 86 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 87 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 88 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 89 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 90 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 91 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 92 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466713_016098 | 3300042602 | Bacteria | 28647 |
| 2 | Ga0466708_429560 | 3300042652 | Bacteria | 24497 |
| 3 | Ga0466727_078398 | 3300042655 | Bacteria | 7767 |
| 4 | Ga0466715_308003 | 3300042616 | Bacteria | 15273 |
| 5 | Ga0466715_498857 | 3300042616 | Bacteria | 1503 |
| 6 | Ga0466715_594964 | 3300042616 | Bacteria | 6962 |
| 7 | Ga0466718_054158 | 3300042617 | Bacteria | 2100 |
| 8 | Ga0466729_018611 | 3300042621 | Bacteria | 5279 |
| 9 | Ga0123357_10006384 | 3300009784 | Bacteria | 14368 |
| 10 | Ga0123357_10735898 | 3300009784 | Bacteria | 692 |
| 11 | Ga0123356_10335714 | 3300010049 | Bacteria | 1630 |
| 12 | Ga0123356_11501937 | 3300010049 | Bacteria | 831 |
| 13 | Ga0123354_10234304 | 3300010882 | Bacteria | 1909 |
| 14 | Ga0160445_100274 | 3300012847 | Bacteria | 35026 |
| 15 | IMNBL1DRAFT_c0003948 | 3300000062 | Unclassified | 9175 |
| 16 | IMNBL1DRAFT_c0006111 | 3300000062 | Bacteria | 6681 |
| 17 | JGI24702J35022_10141519 | 3300002462 | Bacteria | 1343 |
| 18 | Ga0123357_10000567 | 3300009784 | Bacteria | 36488 |
| 19 | Ga0466705_018092 | 3300042612 | Bacteria | 7038 |
| 20 | Ga0466705_106089 | 3300042612 | Bacteria | 5098 |
| 21 | Ga0466733_174420 | 3300042659 | Bacteria | 8101 |
| 22 | Ga0466706_138262 | 3300042599 | Bacteria | 3070 |
| 23 | Ga0466707_070187 | 3300042601 | Bacteria | 9383 |
| 24 | Ga0466714_048910 | 3300042603 | Bacteria | 1340 |
| 25 | Ga0466714_096799 | 3300042603 | Bacteria | 2703 |
| 26 | Ga0466719_127199 | 3300042606 | Bacteria | 13882 |
| 27 | Ga0466719_157463 | 3300042606 | Bacteria | 8290 |
| 28 | Ga0466698_071784 | 3300042610 | Bacteria | 2097 |
| 29 | Ga0466704_043892 | 3300042643 | Bacteria | 18876 |
| 30 | Ga0466704_205364 | 3300042643 | Bacteria | 3745 |
| 31 | Ga0160469_115093 | 3300012824 | Unclassified | 624 |
| 32 | Ga0466690_144121 | 3300042590 | Bacteria | 19950 |
| 33 | IMNBL1DRAFT_c0000686 | 3300000062 | Bacteria | 27169 |
| 34 | JGI24702J35022_10093597 | 3300002462 | Bacteria | 1638 |
| 35 | JGI24696J40584_12322872 | 3300002834 | Bacteria | 526 |
| 36 | Ga0103267_1000101 | 3300007190 | Bacteria | 31632 |
| 37 | Ga0466697_097748 | 3300042611 | Bacteria | 10482 |
| 38 | Ga0466706_055901 | 3300042599 | Bacteria | 1023 |
| 39 | Ga0466700_049164 | 3300042600 | Bacteria | 1329 |
| 40 | Ga0466700_309186 | 3300042600 | Bacteria | 3733 |
| 41 | Ga0466707_032368 | 3300042601 | Unclassified | 17057 |
| 42 | Ga0466714_146137 | 3300042603 | Bacteria | 42453 |
| 43 | Ga0466721_003572 | 3300042608 | Bacteria | 14667 |
| 44 | Ga0466698_458397 | 3300042610 | Bacteria | 1250 |
| 45 | Ga0466703_200566 | 3300042636 | Unclassified | 6858 |
| 46 | Ga0466703_217922 | 3300042636 | Bacteria | 3615 |
| 47 | Ga0466704_186674 | 3300042643 | Unclassified | 7523 |
| 48 | Ga0466709_202524 | 3300042648 | Bacteria | 11208 |
| 49 | Ga0466711_339108 | 3300042615 | Bacteria | 40685 |
| 50 | Ga0466715_102073 | 3300042616 | Bacteria | 16795 |
| 51 | Ga0466715_547960 | 3300042616 | Bacteria | 6013 |
| 52 | Ga0265387_1002479 | 3300024582 | Bacteria | 2597 |
| 53 | Ga0466692_034946 | 3300042591 | Bacteria | 4741 |
| 54 | 2227255832 | 2225789004 | Bacteria | 1309 |
| 55 | IMNBL1DRAFT_c0014882 | 3300000062 | Unclassified | 3405 |
| 56 | IMNBL1DRAFT_c0017432 | 3300000062 | Bacteria | 3021 |
| 57 | IMNBL1DRAFT_c0026135 | 3300000062 | Unclassified | 2224 |
| 58 | IMNBL1DRAFT_c0107820 | 3300000062 | Bacteria | 742 |
| 59 | JGI24702J35022_10000589 | 3300002462 | Bacteria | 22050 |
| 60 | JGI24702J35022_10306086 | 3300002462 | Unclassified | 939 |
| 61 | Ga0466705_196208 | 3300042612 | Unclassified | 3925 |
| 62 | Ga0466733_192917 | 3300042659 | Bacteria | 71960 |
| 63 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 64 | Ga0466701_074020 | 3300042598 | Bacteria | 9157 |
| 65 | Ga0466706_052437 | 3300042599 | Bacteria | 11745 |
| 66 | Ga0466713_031916 | 3300042602 | Bacteria | 32822 |
| 67 | Ga0466714_002120 | 3300042603 | Bacteria | 4821 |
| 68 | Ga0466714_006451 | 3300042603 | Bacteria | 1587 |
| 69 | Ga0466714_039229 | 3300042603 | Bacteria | 23987 |
| 70 | Ga0466698_093929 | 3300042610 | Bacteria | 1226 |
| 71 | Ga0466704_040894 | 3300042643 | Bacteria | 16973 |
| 72 | Ga0466704_204908 | 3300042643 | Bacteria | 43948 |
| 73 | Ga0466704_368221 | 3300042643 | Bacteria | 6874 |
| 74 | Ga0466727_263885 | 3300042655 | Bacteria | 1149 |
| 75 | Ga0466711_064784 | 3300042615 | Bacteria | 6889 |
| 76 | Ga0466715_175144 | 3300042616 | Bacteria | 2995 |
| 77 | Ga0466715_243412 | 3300042616 | Bacteria | 8465 |
| 78 | Ga0466728_052378 | 3300042620 | Bacteria | 3379 |
| 79 | Ga0466729_038453 | 3300042621 | Unclassified | 5624 |
| 80 | Ga0123356_10049682 | 3300010049 | Bacteria | 3904 |
| 81 | Ga0123353_10171707 | 3300010167 | Bacteria | 3441 |
| 82 | Ga0123353_10210712 | 3300010167 | Bacteria | 3048 |
| 83 | Ga0265387_1005597 | 3300024582 | Bacteria | 1692 |
| 84 | Ga0466656_128026 | 3300042550 | Bacteria | 1053 |
| 85 | Ga0466690_394866 | 3300042590 | Bacteria | 116329 |
| 86 | Ga0466692_011754 | 3300042591 | Bacteria | 8276 |
| 87 | Ga0466691_026612 | 3300042593 | Bacteria | 14198 |
| 88 | Ga0466696_187960 | 3300042596 | Bacteria | 5945 |
| 89 | 2227469921 | 2225789004 | Bacteria | 4941 |
| 90 | JGI24702J35022_10115877 | 3300002462 | Bacteria | 1476 |
| 91 | JGI24705J35276_11940248 | 3300002504 | Bacteria | 785 |
| 92 | JGI24696J40584_12941049 | 3300002834 | Bacteria | 1695 |
| 93 | Ga0068302_10110903 | 3300005071 | Bacteria | 2249 |
| 94 | Ga0068305_10089882 | 3300005083 | Bacteria | 4163 |
| 95 | Ga0072941_1091990 | 3300005201 | Bacteria | 3515 |
| 96 | Ga0105005_1121902 | 3300007505 | Bacteria | 2963 |
| 97 | Ga0466705_191792 | 3300042612 | Bacteria | 6983 |
| 98 | Ga0466732_262067 | 3300042656 | Bacteria | 1222 |
| 99 | Ga0466707_057045 | 3300042601 | Bacteria | 18225 |
| 100 | Ga0466713_125837 | 3300042602 | Bacteria | 25210 |
| 101 | Ga0466714_058176 | 3300042603 | Bacteria | 3316 |
| 102 | Ga0466714_075760 | 3300042603 | Unclassified | 3318 |
| 103 | Ga0466716_000643 | 3300042605 | Bacteria | 8883 |
| 104 | Ga0466716_256504 | 3300042605 | Bacteria | 6861 |
| 105 | Ga0466722_194052 | 3300042609 | Bacteria | 3082 |
| 106 | Ga0466703_102690 | 3300042636 | Bacteria | 12075 |
| 107 | Ga0466710_261346 | 3300042613 | Bacteria | 2636 |
| 108 | Ga0466711_172335 | 3300042615 | Bacteria | 8197 |
| 109 | Ga0466723_011775 | 3300042618 | Bacteria | 14310 |
| 110 | Ga0466723_245376 | 3300042618 | Bacteria | 10412 |
| 111 | Ga0466723_310878 | 3300042618 | Bacteria | 11490 |
| 112 | Ga0123357_10127609 | 3300009784 | Bacteria | 3180 |
| 113 | Ga0123356_11610465 | 3300010049 | Bacteria | 804 |
| 114 | Ga0123356_11648774 | 3300010049 | Bacteria | 795 |
| 115 | Ga0466657_102682 | 3300042582 | Bacteria | 41497 |
| 116 | Ga0466691_049926 | 3300042593 | Bacteria | 11408 |
| 117 | Ga0466691_191353 | 3300042593 | Bacteria | 6407 |
| 118 | Ga0466696_192499 | 3300042596 | Bacteria | 34182 |
| 119 | 2227077737 | 2225789003 | Unclassified | 2133 |
| 120 | 2227286341 | 2225789004 | Unclassified | 6768 |
| 121 | JGI24702J35022_10371940 | 3300002462 | Bacteria | 858 |
| 122 | JGI24699J35502_11133502 | 3300002509 | Bacteria | 11231 |
| 123 | Ga0466701_024556 | 3300042598 | Bacteria | 38823 |
| 124 | Ga0466706_118666 | 3300042599 | Bacteria | 2417 |
| 125 | Ga0466707_048120 | 3300042601 | Bacteria | 11850 |
| 126 | Ga0466707_048239 | 3300042601 | Bacteria | 2609 |
| 127 | Ga0466709_242055 | 3300042648 | Bacteria | 39824 |
| 128 | Ga0466724_56145 | 3300042649 | Bacteria | 4709 |
| 129 | Ga0466708_090929 | 3300042652 | Bacteria | 3957 |
| 130 | Ga0466715_499377 | 3300042616 | Bacteria | 1362 |
| 131 | Ga0466729_089960 | 3300042621 | Bacteria | 9721 |
| 132 | Ga0466690_434398 | 3300042590 | Bacteria | 17322 |
| 133 | Ga0466695_253029 | 3300042595 | Unclassified | 1348 |
| 134 | 2227488530 | 2225789004 | Bacteria | 20877 |
| 135 | Ga0068305_10001914 | 3300005083 | Bacteria | 13772 |
| 136 | Ga0466705_085948 | 3300042612 | Bacteria | 5255 |
| 137 | Ga0466700_244198 | 3300042600 | Bacteria | 7795 |
| 138 | Ga0466700_446435 | 3300042600 | Bacteria | 2183 |
| 139 | Ga0466713_018750 | 3300042602 | Bacteria | 18934 |
| 140 | Ga0466713_029415 | 3300042602 | Bacteria | 115461 |
| 141 | Ga0466713_098132 | 3300042602 | Bacteria | 9540 |
| 142 | Ga0466716_432688 | 3300042605 | Bacteria | 2036 |
| 143 | Ga0466722_132870 | 3300042609 | Bacteria | 22775 |
| 144 | Ga0466698_285782 | 3300042610 | Bacteria | 1395 |
| 145 | Ga0466729_233065 | 3300042621 | Bacteria | 3884 |
| 146 | Ga0466735_041732 | 3300042624 | Bacteria | 1188 |
| 147 | Ga0466735_198159 | 3300042624 | Bacteria | 1793 |
| 148 | Ga0466730_006581 | 3300042625 | Bacteria | 2365 |
| 149 | Ga0466708_044096 | 3300042652 | Bacteria | 70438 |
| 150 | Ga0466708_353035 | 3300042652 | Bacteria | 11593 |
| 151 | Ga0466727_333073 | 3300042655 | Bacteria | 5525 |
| 152 | Ga0466712_208422 | 3300042614 | Bacteria | 1789 |
| 153 | Ga0466711_117224 | 3300042615 | Bacteria | 16870 |
| 154 | Ga0466711_263178 | 3300042615 | Bacteria | 12410 |
| 155 | Ga0123357_10105402 | 3300009784 | Bacteria | 3617 |
| 156 | Ga0123356_10224922 | 3300010049 | Bacteria | 1936 |
| 157 | Ga0160443_105025 | 3300012848 | Bacteria | 1877 |
| 158 | Ga0456237_0000002 | 3300041968 | Bacteria | 104267 |
| 159 | Ga0466692_157590 | 3300042591 | Bacteria | 38629 |
| 160 | Ga0466696_263272 | 3300042596 | Bacteria | 3748 |
| 161 | 2227137496 | 2225789004 | Unclassified | 1636 |
| 162 | 2227463531 | 2225789004 | Bacteria | 25273 |
| 163 | HBC_ctgsDRAFT_1000062 | 3300000333 | Bacteria | 27258 |
| 164 | JGI24702J35022_10768789 | 3300002462 | Unclassified | 600 |
| 165 | JGI24696J40584_12561045 | 3300002834 | Bacteria | 632 |
| 166 | Ga0103267_1000006 | 3300007190 | Bacteria | 81411 |
| 167 | Ga0103267_1000112 | 3300007190 | Bacteria | 30536 |
| 168 | Ga0123357_10002393 | 3300009784 | Bacteria | 20901 |
| 169 | Ga0466733_034634 | 3300042659 | Bacteria | 1277 |
| 170 | Ga0466701_082480 | 3300042598 | Bacteria | 1268 |
| 171 | Ga0466713_020351 | 3300042602 | Bacteria | 91390 |
| 172 | Ga0466714_158267 | 3300042603 | Bacteria | 2209 |
| 173 | Ga0466719_297315 | 3300042606 | Bacteria | 3128 |
| 174 | Ga0466719_429838 | 3300042606 | Bacteria | 6140 |
| 175 | Ga0466722_073927 | 3300042609 | Bacteria | 34486 |
| 176 | Ga0466730_102793 | 3300042625 | Bacteria | 1124 |
| 177 | Ga0466703_050628 | 3300042636 | Bacteria | 1364 |
| 178 | Ga0466704_377167 | 3300042643 | Bacteria | 7130 |
| 179 | Ga0466704_436254 | 3300042643 | Bacteria | 2497 |
| 180 | Ga0466708_140172 | 3300042652 | Bacteria | 30570 |
| 181 | Ga0466725_014462 | 3300042654 | Bacteria | 2305 |
| 182 | Ga0466725_036713 | 3300042654 | Bacteria | 10625 |
| 183 | Ga0466727_213127 | 3300042655 | Bacteria | 13130 |
| 184 | Ga0466711_488038 | 3300042615 | Bacteria | 4064 |
| 185 | Ga0466715_360885 | 3300042616 | Bacteria | 59521 |
| 186 | Ga0466715_402287 | 3300042616 | Bacteria | 28899 |
| 187 | Ga0466715_621967 | 3300042616 | Bacteria | 12938 |
| 188 | Ga0466692_169709 | 3300042591 | Bacteria | 12436 |
| 189 | Ga0466693_273644 | 3300042592 | Bacteria | 2003 |
| 190 | Ga0466696_304362 | 3300042596 | Bacteria | 42297 |
| 191 | 2227490204 | 2225789004 | Bacteria | 4113 |
| 192 | 2227513528 | 2225789004 | Bacteria | 18058 |
| 193 | IMNBL1DRAFT_c0001815 | 3300000062 | Bacteria | 15547 |
| 194 | IMNBL1DRAFT_c0001978 | 3300000062 | Bacteria | 14764 |
| 195 | IMNBL1DRAFT_c0004449 | 3300000062 | Bacteria | 8434 |
| 196 | JGI24702J35022_10291684 | 3300002462 | Bacteria | 960 |
| 197 | JGI24702J35022_10929779 | 3300002462 | Bacteria | 542 |
| 198 | JGI24699J35502_11134069 | 3300002509 | Bacteria | 28139 |
| 199 | Ga0068305_10024597 | 3300005083 | Bacteria | 25459 |
| 200 | Ga0072941_1211495 | 3300005201 | Bacteria | 2673 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300005083 | Ga0068305_10089882 | Ga0068305_100898822 | 84 |
| 2 | 3300005071 | Ga0068302_10110903 | Ga0068302_101109031 | 96 |
| 3 | 3300007505 | Ga0105005_1121902 | Ga0105005_11219023 | 98 |
| 4 | 3300002834 | JGI24696J40584_12941049 | JGI24696J40584_129410492 | 103 |
| 5 | 3300042593 | Ga0466691_026612 | Ga0466691_026612_4286_4597 | 103 |
| 6 | 3300042602 | Ga0466713_098132 | Ga0466713_098132_6026_6337 | 103 |
| 7 | 2225789004 | 2227137496 | 2227538035 | 104 |
| 8 | 2225789004 | 2227255832 | 2227700522 | 104 |
| 9 | 2225789004 | 2227286341 | 2227737585 | 104 |
| 10 | 2225789004 | 2227463531 | 2227899101 | 104 |
| 11 | 2225789004 | 2227469921 | 2227914317 | 104 |
| 12 | 2225789004 | 2227488530 | 2227957701 | 104 |
| 13 | 2225789004 | 2227513528 | 2228010095 | 104 |
| 14 | 3300024582 | Ga0265387_1002479 | Ga0265387_10024792 | 104 |
| 15 | 3300041968 | Ga0456237_0000002 | Ga0456237_0000002_60797_61111 | 104 |
| 16 | 3300042550 | Ga0466656_128026 | Ga0466656_128026_679_993 | 104 |
| 17 | 3300042590 | Ga0466690_394866 | Ga0466690_394866_29790_30104 | 104 |
| 18 | 3300042590 | Ga0466690_434398 | Ga0466690_434398_1509_1823 | 104 |
| 19 | 3300042591 | Ga0466692_011754 | Ga0466692_011754_867_1181 | 104 |
| 20 | 3300042591 | Ga0466692_157590 | Ga0466692_157590_29059_29373 | 104 |
| 21 | 3300042591 | Ga0466692_169709 | Ga0466692_169709_3675_3989 | 104 |
| 22 | 3300042592 | Ga0466693_273644 | Ga0466693_273644_773_1087 | 104 |
| 23 | 3300042593 | Ga0466691_191353 | Ga0466691_191353_4127_4441 | 104 |
| 24 | 3300042596 | Ga0466696_187960 | Ga0466696_187960_1033_1347 | 104 |
| 25 | 3300042596 | Ga0466696_192499 | Ga0466696_192499_8840_9154 | 104 |
| 26 | 3300042598 | Ga0466701_074020 | Ga0466701_074020_4868_5182 | 104 |
| 27 | 3300042599 | Ga0466706_052437 | Ga0466706_052437_8871_9185 | 104 |
| 28 | 3300042599 | Ga0466706_138262 | Ga0466706_138262_658_972 | 104 |
| 29 | 3300042600 | Ga0466700_049164 | Ga0466700_049164_375_689 | 104 |
| 30 | 3300042600 | Ga0466700_244198 | Ga0466700_244198_5174_5488 | 104 |
| 31 | 3300042600 | Ga0466700_309186 | Ga0466700_309186_2845_3159 | 104 |
| 32 | 3300042600 | Ga0466700_446435 | Ga0466700_446435_866_1180 | 104 |
| 33 | 3300042601 | Ga0466707_032368 | Ga0466707_032368_15111_15425 | 104 |
| 34 | 3300042601 | Ga0466707_048120 | Ga0466707_048120_1509_1823 | 104 |
| 35 | 3300042601 | Ga0466707_048239 | Ga0466707_048239_495_809 | 104 |
| 36 | 3300042601 | Ga0466707_057045 | Ga0466707_057045_883_1197 | 104 |
| 37 | 3300042601 | Ga0466707_070187 | Ga0466707_070187_3613_3927 | 104 |
| 38 | 3300042602 | Ga0466713_016098 | Ga0466713_016098_4032_4346 | 104 |
| 39 | 3300042602 | Ga0466713_018750 | Ga0466713_018750_14946_15260 | 104 |
| 40 | 3300042602 | Ga0466713_031916 | Ga0466713_031916_7091_7405 | 104 |
| 41 | 3300042602 | Ga0466713_125837 | Ga0466713_125837_21525_21839 | 104 |
| 42 | 3300042603 | Ga0466714_006451 | Ga0466714_006451_1114_1428 | 104 |
| 43 | 3300042603 | Ga0466714_039229 | Ga0466714_039229_13728_14042 | 104 |
| 44 | 3300042603 | Ga0466714_158267 | Ga0466714_158267_151_465 | 104 |
| 45 | 3300042605 | Ga0466716_000643 | Ga0466716_000643_1049_1363 | 104 |
| 46 | 3300042605 | Ga0466716_256504 | Ga0466716_256504_1938_2252 | 104 |
| 47 | 3300042606 | Ga0466719_127199 | Ga0466719_127199_8103_8417 | 104 |
| 48 | 3300042606 | Ga0466719_157463 | Ga0466719_157463_6610_6924 | 104 |
| 49 | 3300042606 | Ga0466719_297315 | Ga0466719_297315_1821_2135 | 104 |
| 50 | 3300042606 | Ga0466719_429838 | Ga0466719_429838_4928_5242 | 104 |
| 51 | 3300042610 | Ga0466698_071784 | Ga0466698_071784_887_1201 | 104 |
| 52 | 3300042610 | Ga0466698_093929 | Ga0466698_093929_269_583 | 104 |
| 53 | 3300042610 | Ga0466698_285782 | Ga0466698_285782_368_682 | 104 |
| 54 | 3300042611 | Ga0466697_097748 | Ga0466697_097748_7482_7796 | 104 |
| 55 | 3300042612 | Ga0466705_018092 | Ga0466705_018092_350_664 | 104 |
| 56 | 3300042612 | Ga0466705_085948 | Ga0466705_085948_15_329 | 104 |
| 57 | 3300042612 | Ga0466705_106089 | Ga0466705_106089_483_797 | 104 |
| 58 | 3300042613 | Ga0466710_261346 | Ga0466710_261346_2139_2453 | 104 |
| 59 | 3300042616 | Ga0466715_102073 | Ga0466715_102073_14185_14499 | 104 |
| 60 | 3300042616 | Ga0466715_175144 | Ga0466715_175144_2439_2753 | 104 |
| 61 | 3300042616 | Ga0466715_243412 | Ga0466715_243412_804_1118 | 104 |
| 62 | 3300042616 | Ga0466715_308003 | Ga0466715_308003_8939_9253 | 104 |
| 63 | 3300042616 | Ga0466715_360885 | Ga0466715_360885_57985_58299 | 104 |
| 64 | 3300042616 | Ga0466715_402287 | Ga0466715_402287_15984_16298 | 104 |
| 65 | 3300042616 | Ga0466715_498857 | Ga0466715_498857_1117_1431 | 104 |
| 66 | 3300042616 | Ga0466715_499377 | Ga0466715_499377_976_1290 | 104 |
| 67 | 3300042616 | Ga0466715_547960 | Ga0466715_547960_19_333 | 104 |
| 68 | 3300042616 | Ga0466715_621967 | Ga0466715_621967_4072_4386 | 104 |
| 69 | 3300042617 | Ga0466718_054158 | Ga0466718_054158_670_984 | 104 |
| 70 | 3300042618 | Ga0466723_011775 | Ga0466723_011775_11644_11958 | 104 |
| 71 | 3300042620 | Ga0466728_052378 | Ga0466728_052378_310_624 | 104 |
| 72 | 3300042621 | Ga0466729_018611 | Ga0466729_018611_3175_3489 | 104 |
| 73 | 3300042621 | Ga0466729_038453 | Ga0466729_038453_3677_3991 | 104 |
| 74 | 3300042621 | Ga0466729_233065 | Ga0466729_233065_1875_2189 | 104 |
| 75 | 3300042624 | Ga0466735_041732 | Ga0466735_041732_857_1171 | 104 |
| 76 | 3300042624 | Ga0466735_198159 | Ga0466735_198159_34_348 | 104 |
| 77 | 3300042636 | Ga0466703_050628 | Ga0466703_050628_558_872 | 104 |
| 78 | 3300042636 | Ga0466703_102690 | Ga0466703_102690_310_624 | 104 |
| 79 | 3300042643 | Ga0466704_043892 | Ga0466704_043892_3667_3981 | 104 |
| 80 | 3300042643 | Ga0466704_186674 | Ga0466704_186674_3880_4194 | 104 |
| 81 | 3300042643 | Ga0466704_204908 | Ga0466704_204908_21939_22253 | 104 |
| 82 | 3300042643 | Ga0466704_368221 | Ga0466704_368221_2936_3250 | 104 |
| 83 | 3300042643 | Ga0466704_377167 | Ga0466704_377167_1597_1911 | 104 |
| 84 | 3300042643 | Ga0466704_436254 | Ga0466704_436254_424_738 | 104 |
| 85 | 3300042648 | Ga0466709_202524 | Ga0466709_202524_6971_7285 | 104 |
| 86 | 3300042649 | Ga0466724_56145 | Ga0466724_56145_75_389 | 104 |
| 87 | 3300042652 | Ga0466708_090929 | Ga0466708_090929_1327_1641 | 104 |
| 88 | 3300042652 | Ga0466708_140172 | Ga0466708_140172_13301_13615 | 104 |
| 89 | 3300042652 | Ga0466708_353035 | Ga0466708_353035_2338_2652 | 104 |
| 90 | 3300042654 | Ga0466725_036713 | Ga0466725_036713_3847_4161 | 104 |
| 91 | 3300042655 | Ga0466727_078398 | Ga0466727_078398_7123_7437 | 104 |
| 92 | 3300042655 | Ga0466727_263885 | Ga0466727_263885_23_337 | 104 |
| 93 | 3300042656 | Ga0466732_262067 | Ga0466732_262067_106_420 | 104 |
| 94 | 3300042659 | Ga0466733_034634 | Ga0466733_034634_660_974 | 104 |
| 95 | 3300056842 | Ga0562377_0004 | Ga0562377_0004_3232972_3233286 | 104 |
| 96 | iso_pr_bacteria | 2820740053 | 2820741516 | 104 |
| 97 | iso_pr_bacteria | 2820762746 | 2820763028 | 104 |
| 98 | iso_pr_bacteria | 2820776227 | 2820777249 | 104 |
| 99 | iso_pr_bacteria | 2820778767 | 2820779510 | 104 |
| 100 | iso_pr_bacteria | 2920168565 | 2920170579 | 104 |
| 101 | iso_pr_bacteria | 2940202316 | 2940202474 | 104 |
| 102 | iso_pr_bacteria | 2940205530 | 2940208960 | 104 |
| 103 | iso_pr_bacteria | 2940212447 | 2940215875 | 104 |
| 104 | iso_pr_bacteria | 2940298504 | 2940301965 | 104 |
| 105 | iso_pr_bacteria | 2940302308 | 2940305768 | 104 |
| 106 | iso_pr_bacteria | 2940306115 | 2940309660 | 104 |
| 107 | iso_pr_bacteria | 2940309933 | 2940313496 | 104 |
| 108 | iso_pr_bacteria | 2940313741 | 2940317274 | 104 |
| 109 | iso_pr_bacteria | 2940317558 | 2940321087 | 104 |
| 110 | iso_pr_bacteria | 2940321370 | 2940324880 | 104 |
| 111 | iso_pr_bacteria | 2940325180 | 2940328638 | 104 |
| 112 | iso_pr_bacteria | 2940328985 | 2940332445 | 104 |
| 113 | iso_pr_bacteria | 2940332795 | 2940336325 | 104 |
| 114 | iso_pr_bacteria | 2967483437 | 2967483997 | 104 |
| 115 | iso_pr_bacteria | 643348524 | 643423002 | 104 |
| 116 | 2225789003 | 2227077737 | 2227444119 | 105 |
| 117 | 2225789004 | 2227490204 | 2227961174 | 105 |
| 118 | 3300000062 | IMNBL1DRAFT_c0000686 | IMNBL1DRAFT_00006866 | 105 |
| 119 | 3300000062 | IMNBL1DRAFT_c0001815 | IMNBL1DRAFT_00018153 | 105 |
| 120 | 3300000062 | IMNBL1DRAFT_c0001978 | IMNBL1DRAFT_00019782 | 105 |
| 121 | 3300000062 | IMNBL1DRAFT_c0003948 | IMNBL1DRAFT_00039485 | 105 |
| 122 | 3300000062 | IMNBL1DRAFT_c0004449 | IMNBL1DRAFT_00044495 | 105 |
| 123 | 3300000062 | IMNBL1DRAFT_c0006111 | IMNBL1DRAFT_00061112 | 105 |
| 124 | 3300000062 | IMNBL1DRAFT_c0017432 | IMNBL1DRAFT_00174321 | 105 |
| 125 | 3300000062 | IMNBL1DRAFT_c0107820 | IMNBL1DRAFT_01078202 | 105 |
| 126 | 3300002462 | JGI24702J35022_10000589 | JGI24702J35022_1000058916 | 105 |
| 127 | 3300002462 | JGI24702J35022_10093597 | JGI24702J35022_100935972 | 105 |
| 128 | 3300002462 | JGI24702J35022_10115877 | JGI24702J35022_101158772 | 105 |
| 129 | 3300002462 | JGI24702J35022_10141519 | JGI24702J35022_101415192 | 105 |
| 130 | 3300002504 | JGI24705J35276_11940248 | JGI24705J35276_119402482 | 105 |
| 131 | 3300002509 | JGI24699J35502_11133502 | JGI24699J35502_111335022 | 105 |
| 132 | 3300002509 | JGI24699J35502_11134069 | JGI24699J35502_1113406919 | 105 |
| 133 | 3300002834 | JGI24696J40584_12561045 | JGI24696J40584_125610451 | 105 |
| 134 | 3300005083 | Ga0068305_10001914 | Ga0068305_100019145 | 105 |
| 135 | 3300005083 | Ga0068305_10024597 | Ga0068305_1002459719 | 105 |
| 136 | 3300005201 | Ga0072941_1211495 | Ga0072941_12114954 | 105 |
| 137 | 3300009784 | Ga0123357_10000567 | Ga0123357_1000056719 | 105 |
| 138 | 3300009784 | Ga0123357_10002393 | Ga0123357_100023932 | 105 |
| 139 | 3300009784 | Ga0123357_10006384 | Ga0123357_100063849 | 105 |
| 140 | 3300009784 | Ga0123357_10105402 | Ga0123357_101054022 | 105 |
| 141 | 3300009784 | Ga0123357_10127609 | Ga0123357_101276092 | 105 |
| 142 | 3300009784 | Ga0123357_10735898 | Ga0123357_107358982 | 105 |
| 143 | 3300010049 | Ga0123356_10224922 | Ga0123356_102249222 | 105 |
| 144 | 3300010049 | Ga0123356_11610465 | Ga0123356_116104653 | 105 |
| 145 | 3300010049 | Ga0123356_11648774 | Ga0123356_116487741 | 105 |
| 146 | 3300010167 | Ga0123353_10210712 | Ga0123353_102107121 | 105 |
| 147 | 3300010882 | Ga0123354_10234304 | Ga0123354_102343042 | 105 |
| 148 | 3300024582 | Ga0265387_1005597 | Ga0265387_10055972 | 105 |
| 149 | 3300042582 | Ga0466657_102682 | Ga0466657_102682_34108_34425 | 105 |
| 150 | 3300042590 | Ga0466690_144121 | Ga0466690_144121_18124_18441 | 105 |
| 151 | 3300042591 | Ga0466692_034946 | Ga0466692_034946_656_973 | 105 |
| 152 | 3300042595 | Ga0466695_253029 | Ga0466695_253029_302_619 | 105 |
| 153 | 3300042599 | Ga0466706_055901 | Ga0466706_055901_546_863 | 105 |
| 154 | 3300042599 | Ga0466706_118666 | Ga0466706_118666_1219_1536 | 105 |
| 155 | 3300042602 | Ga0466713_020351 | Ga0466713_020351_8175_8492 | 105 |
| 156 | 3300042602 | Ga0466713_029415 | Ga0466713_029415_15500_15817 | 105 |
| 157 | 3300042603 | Ga0466714_002120 | Ga0466714_002120_1244_1561 | 105 |
| 158 | 3300042603 | Ga0466714_058176 | Ga0466714_058176_2428_2745 | 105 |
| 159 | 3300042603 | Ga0466714_075760 | Ga0466714_075760_2184_2501 | 105 |
| 160 | 3300042603 | Ga0466714_096799 | Ga0466714_096799_1784_2101 | 105 |
| 161 | 3300042608 | Ga0466721_003572 | Ga0466721_003572_11928_12245 | 105 |
| 162 | 3300042609 | Ga0466722_073927 | Ga0466722_073927_16010_16327 | 105 |
| 163 | 3300042609 | Ga0466722_132870 | Ga0466722_132870_18258_18575 | 105 |
| 164 | 3300042609 | Ga0466722_194052 | Ga0466722_194052_382_699 | 105 |
| 165 | 3300042610 | Ga0466698_458397 | Ga0466698_458397_319_636 | 105 |
| 166 | 3300042612 | Ga0466705_191792 | Ga0466705_191792_6563_6880 | 105 |
| 167 | 3300042612 | Ga0466705_196208 | Ga0466705_196208_2263_2580 | 105 |
| 168 | 3300042615 | Ga0466711_064784 | Ga0466711_064784_5089_5406 | 105 |
| 169 | 3300042615 | Ga0466711_117224 | Ga0466711_117224_10462_10779 | 105 |
| 170 | 3300042615 | Ga0466711_172335 | Ga0466711_172335_6782_7099 | 105 |
| 171 | 3300042615 | Ga0466711_339108 | Ga0466711_339108_10978_11295 | 105 |
| 172 | 3300042616 | Ga0466715_594964 | Ga0466715_594964_3947_4264 | 105 |
| 173 | 3300042618 | Ga0466723_310878 | Ga0466723_310878_7255_7572 | 105 |
| 174 | 3300042625 | Ga0466730_006581 | Ga0466730_006581_1704_2021 | 105 |
| 175 | 3300042625 | Ga0466730_102793 | Ga0466730_102793_71_388 | 105 |
| 176 | 3300042636 | Ga0466703_200566 | Ga0466703_200566_2397_2714 | 105 |
| 177 | 3300042643 | Ga0466704_040894 | Ga0466704_040894_13617_13934 | 105 |
| 178 | 3300042648 | Ga0466709_242055 | Ga0466709_242055_30398_30715 | 105 |
| 179 | 3300042652 | Ga0466708_429560 | Ga0466708_429560_6430_6747 | 105 |
| 180 | 3300042654 | Ga0466725_014462 | Ga0466725_014462_347_664 | 105 |
| 181 | 3300042655 | Ga0466727_213127 | Ga0466727_213127_4054_4371 | 105 |
| 182 | 3300042655 | Ga0466727_333073 | Ga0466727_333073_1143_1460 | 105 |
| 183 | 3300042659 | Ga0466733_174420 | Ga0466733_174420_1941_2258 | 105 |
| 184 | 3300042659 | Ga0466733_192917 | Ga0466733_192917_33540_33857 | 105 |
| 185 | iso_pr_bacteria | 2695420314 | 2695472827 | 105 |
| 186 | iso_pr_bacteria | 2910942425 | 2910945949 | 105 |
| 187 | iso_pr_bacteria | 2910959314 | 2910959363 | 105 |
| 188 | iso_pr_bacteria | 8100166142 | 8100170026 | 105 |
| 189 | 3300000062 | IMNBL1DRAFT_c0014882 | IMNBL1DRAFT_00148823 | 106 |
| 190 | 3300000062 | IMNBL1DRAFT_c0026135 | IMNBL1DRAFT_00261354 | 106 |
| 191 | 3300002462 | JGI24702J35022_10291684 | JGI24702J35022_102916842 | 106 |
| 192 | 3300002462 | JGI24702J35022_10306086 | JGI24702J35022_103060862 | 106 |
| 193 | 3300002462 | JGI24702J35022_10768789 | JGI24702J35022_107687891 | 106 |
| 194 | 3300002462 | JGI24702J35022_10929779 | JGI24702J35022_109297792 | 106 |
| 195 | 3300005201 | Ga0072941_1091990 | Ga0072941_10919904 | 106 |
| 196 | 3300007190 | Ga0103267_1000006 | Ga0103267_10000063 | 106 |
| 197 | 3300007190 | Ga0103267_1000101 | Ga0103267_100010116 | 106 |
| 198 | 3300007190 | Ga0103267_1000112 | Ga0103267_100011221 | 106 |
| 199 | 3300010049 | Ga0123356_10049682 | Ga0123356_100496824 | 106 |
| 200 | 3300010049 | Ga0123356_10335714 | Ga0123356_103357142 | 106 |
| 201 | 3300010049 | Ga0123356_11501937 | Ga0123356_115019372 | 106 |
| 202 | 3300010167 | Ga0123353_10171707 | Ga0123353_101717073 | 106 |
| 203 | 3300012824 | Ga0160469_115093 | Ga0160469_1150931 | 106 |
| 204 | 3300012847 | Ga0160445_100274 | Ga0160445_1002743 | 106 |
| 205 | 3300012848 | Ga0160443_105025 | Ga0160443_1050252 | 106 |
| 206 | 3300042593 | Ga0466691_049926 | Ga0466691_049926_5552_5872 | 106 |
| 207 | 3300042603 | Ga0466714_048910 | Ga0466714_048910_751_1071 | 106 |
| 208 | 3300042605 | Ga0466716_432688 | Ga0466716_432688_371_691 | 106 |
| 209 | 3300042614 | Ga0466712_208422 | Ga0466712_208422_142_462 | 106 |
| 210 | 3300042615 | Ga0466711_263178 | Ga0466711_263178_4883_5203 | 106 |
| 211 | 3300042615 | Ga0466711_488038 | Ga0466711_488038_2335_2655 | 106 |
| 212 | 3300042618 | Ga0466723_245376 | Ga0466723_245376_7970_8290 | 106 |
| 213 | 3300042621 | Ga0466729_089960 | Ga0466729_089960_5080_5400 | 106 |
| 214 | 3300042636 | Ga0466703_217922 | Ga0466703_217922_3015_3335 | 106 |
| 215 | 3300042652 | Ga0466708_044096 | Ga0466708_044096_64219_64539 | 106 |
| 216 | iso_pr_bacteria | 2785510743 | 2785736668 | 106 |
| 217 | iso_pr_bacteria | 2799112231 | 2799234623 | 106 |
| 218 | iso_pr_bacteria | 2832298047 | 2832299945 | 106 |
| 219 | iso_pr_bacteria | 2998907766 | 2998909959 | 106 |
| 220 | 3300000333 | HBC_ctgsDRAFT_1000062 | HBC_ctgsDRAFT_100006210 | 107 |
| 221 | 3300002462 | JGI24702J35022_10371940 | JGI24702J35022_103719401 | 107 |
| 222 | 3300002834 | JGI24696J40584_12322872 | JGI24696J40584_123228721 | 107 |
| 223 | 3300042596 | Ga0466696_304362 | Ga0466696_304362_34636_34959 | 107 |
| 224 | 3300042598 | Ga0466701_024556 | Ga0466701_024556_21173_21496 | 107 |
| 225 | 3300042598 | Ga0466701_082480 | Ga0466701_082480_231_554 | 107 |
| 226 | 3300042643 | Ga0466704_205364 | Ga0466704_205364_769_1092 | 107 |
| 227 | 3300042596 | Ga0466696_263272 | Ga0466696_263272_1586_1912 | 108 |
| 228 | iso_pr_bacteria | 2695420931 | 2698111255 | 113 |
| 229 | 3300042603 | Ga0466714_146137 | Ga0466714_146137_27281_27649 | 122 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.88 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.