Protein Family IF06107

Metagenome Isolate
189 Members
73 Samples
170 Scaffolds
403.07 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_097948|Ga0466713_097948_31476_32885
Length
469 aa
Sequence
MVTACATAAAGTSDADAGNAKSSRMIHPLDAQKNPCYSEPPTAFSPRSHSRGFLNVSVKGGLMQEIVGKYNTAKVFTDKCDDFSLQQVKTLCDQAFTAGSKIRLMPDVHAGAGCTIGTTMTISDKVVPNMVGVDIGCGMETLVVPAESEFAAGFDPAKLDALVRERIPCGREVRDTPHPLIEQAGLDAIRCPAIQKGRARKSLGTLGGGNHFIEADRDEDGNLYLVVHSGSRHLGLEVAGYYQEEAWAQLNHSRSQDINAMIAELKAAGRTKEIPGEIRRVRSQARTNIPKSLAYVSGDLFNDYLHDMKLVQRFALLNRKAMMRVILDGLSMPVDGRLEQWTTIHNYIDTEEMILRKGAVSAKAGEKLLIPINMRDGSLVCRGLGNPDWNCSAPHGAGRVMSRQKAFKELSLEEYQASMQGIYSTSVGRDTLDESPMAYKTMDDIASNIGPTAEVLRVIKPVYNFKAAE

📊 Sample Types

Isolate 9.5%
Metagenome 90.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.4%
Unclassified 26.8%
Kalotermitidae 19.7%
Rhinotermitidae 4.2%
Termopsidae 4.2%
Blattidae 2.8%
Hodotermitidae 1.4%
Passalidae 1.4%

🌳 Taxonomy

Archaea 2
Bacteria 170
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
2 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
3 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
4 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
5 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
9 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
10 2778260937 Unclassified Fibrobacteres Co191P3bin40 Isolate Unclassified
11 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
12 2820651690 Unclassified Firmicutes Cu122P3bin6 Isolate Unclassified
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
15 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
18 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
19 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
20 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
21 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
22 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
23 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
24 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
25 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
26 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
27 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
28 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
29 2820013017 Unclassified Spirochaetes Th196P3bin152 Isolate Unclassified
30 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
31 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
32 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
33 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
36 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
37 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
38 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
40 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
41 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
42 2820010479 Unclassified Spirochaetes Th196P4bin55 Isolate Unclassified
43 2820018428 Unclassified Spirochaetes Nt197P3bin33 Isolate Unclassified
44 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
45 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
46 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
47 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
48 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
49 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
50 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
51 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
52 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
53 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
54 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
55 2820406809 Unclassified Firmicutes Lab288P4bin87 Isolate Unclassified
56 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
57 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
58 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
59 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
60 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
61 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
62 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
63 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
64 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
65 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
66 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
67 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
68 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
69 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
70 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
71 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
72 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
73 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466721_225174 3300042608 Bacteria 32299
2 AustNasuHG_c1005965 3300000089 Unclassified 4358
3 JGI24698J34947_10001336 3300002449 Bacteria 12966
4 JGI24702J35022_10043846 3300002462 Unclassified 2383
5 Ga0466712_247538 3300042614 Unclassified 3144
6 Ga0466711_510758 3300042615 Bacteria 5190
7 Ga0466726_305226 3300042619 Bacteria 2933
8 Ga0123354_10000037 3300010882 Bacteria 97859
9 Ga0466732_436719 3300042656 Bacteria 2994
10 Ga0466705_078170 3300042612 Bacteria 3760
11 Ga0466703_430565 3300042636 Unclassified 2253
12 Ga0466704_119362 3300042643 Bacteria 5158
13 Ga0466706_166198 3300042599 Bacteria 39918
14 Ga0466707_378263 3300042601 Bacteria 16475
15 Ga0466722_063808 3300042609 Bacteria 7500
16 Ga0466722_100947 3300042609 Bacteria 16833
17 IMNBL1DRAFT_c0008850 3300000062 Bacteria 5069
18 AustNasuHG_c1003260 3300000089 Bacteria 5864
19 AustNasuHG_c1024616 3300000089 Bacteria 1903
20 Ga0072941_1002463 3300005201 Bacteria 31699
21 Ga0264413_135637 3300024493 Bacteria 8818
22 Ga0466690_123716 3300042590 Bacteria 7906
23 Ga0466696_254953 3300042596 Bacteria 27601
24 Ga0466711_192757 3300042615 Bacteria 36180
25 Ga0466718_087275 3300042617 Bacteria 5991
26 Ga0466723_091731 3300042618 Bacteria 2031
27 Ga0466726_401296 3300042619 Bacteria 2977
28 Ga0466726_431332 3300042619 Bacteria 2979
29 Ga0123357_10055311 3300009784 Bacteria 5343
30 Ga0123356_10002367 3300010049 Bacteria 20223
31 Ga0123356_10009080 3300010049 Bacteria 9831
32 Ga0123356_10180964 3300010049 Bacteria 2129
33 Ga0123356_10192129 3300010049 Bacteria 2074
34 Ga0123354_10144616 3300010882 Bacteria 2919
35 Ga0466731_329673 3300042622 Bacteria 3098
36 Ga0466704_149896 3300042643 Bacteria 8911
37 Ga0466725_132819 3300042654 Bacteria 26980
38 Ga0466701_070007 3300042598 Bacteria 2119
39 Ga0466713_097948 3300042602 Bacteria 33369
40 Ga0466717_286165 3300042604 Unclassified 5015
41 Ga0466720_029459 3300042607 Bacteria 10191
42 Ga0466722_006386 3300042609 Bacteria 5340
43 Ga0466698_028159 3300042610 Bacteria 6821
44 JGI24698J34947_10003085 3300002449 Bacteria 9019
45 JGI24695J34938_10031733 3300002450 Bacteria 2447
46 Ga0415639_138215 3300038395 Bacteria 1432
47 Ga0466691_218612 3300042593 Bacteria 7134
48 Ga0466696_097197 3300042596 Archaea 2017
49 Ga0466699_034790 3300042597 Bacteria 4050
50 Ga0466712_244462 3300042614 Bacteria 26322
51 Ga0466715_206839 3300042616 Bacteria 1412
52 Ga0466728_087954 3300042620 Bacteria 6228
53 Ga0123356_10391232 3300010049 Unclassified 1525
54 Ga0123353_10129167 3300010167 Bacteria 4057
55 Ga0466733_039904 3300042659 Bacteria 2813
56 Ga0466731_375477 3300042622 Bacteria 1639
57 Ga0466704_064098 3300042643 Bacteria 8776
58 Ga0466704_065068 3300042643 Bacteria 4300
59 Ga0466704_541316 3300042643 Bacteria 2575
60 Ga0466706_159313 3300042599 Bacteria 2826
61 Ga0466707_155509 3300042601 Bacteria 1319
62 Ga0466714_111583 3300042603 Bacteria 2243
63 Ga0466717_074038 3300042604 Bacteria 2175
64 Ga0466716_285211 3300042605 Unclassified 3279
65 JGI24698J34947_10002023 3300002449 Bacteria 10810
66 JGI24695J34938_10049248 3300002450 Bacteria 1852
67 Ga0068305_10063519 3300005083 Bacteria 6141
68 Ga0466690_060536 3300042590 Bacteria 2288
69 Ga0466696_246029 3300042596 Bacteria 1716
70 Ga0466699_074311 3300042597 Bacteria 20737
71 Ga0466712_072099 3300042614 Unclassified 3101
72 Ga0466712_077165 3300042614 Bacteria 14267
73 Ga0466712_185644 3300042614 Bacteria 11163
74 Ga0466718_071750 3300042617 Bacteria 1847
75 Ga0466723_116209 3300042618 Bacteria 2113
76 Ga0466729_097884 3300042621 Bacteria 1939
77 Ga0123356_10002265 3300010049 Bacteria 20756
78 Ga0123356_10004233 3300010049 Unclassified 14843
79 Ga0123356_10004392 3300010049 Bacteria 14570
80 Ga0123353_10378712 3300010167 Bacteria 2118
81 Ga0466731_359346 3300042622 Bacteria 4401
82 Ga0466703_133030 3300042636 Unclassified 2019
83 Ga0466727_266933 3300042655 Unclassified 3278
84 Ga0466700_039672 3300042600 Bacteria 1898
85 Ga0466713_048745 3300042602 Bacteria 4691
86 Ga0466719_314367 3300042606 Bacteria 1711
87 Ga0466719_403544 3300042606 Bacteria 1742
88 AustNasuHG_c1004628 3300000089 Bacteria 4936
89 AustNasuHG_c1008454 3300000089 Bacteria 3640
90 AustNasuHG_c1012440 3300000089 Bacteria 2938
91 JGI24698J34947_10033172 3300002449 Bacteria 2709
92 JGI24695J34938_10018874 3300002450 Unclassified 3433
93 Ga0264413_133904 3300024493 Bacteria 2465
94 Ga0466692_130610 3300042591 Bacteria 16865
95 Ga0466691_079544 3300042593 Bacteria 1746
96 Ga0466705_416682 3300042612 Bacteria 13885
97 Ga0466723_327100 3300042618 Bacteria 1724
98 Ga0123356_10005273 3300010049 Bacteria 13195
99 Ga0123353_10012196 3300010167 Bacteria 12192
100 Ga0123353_10148252 3300010167 Bacteria 3749
101 Ga0466729_223936 3300042621 Bacteria 3554
102 Ga0466731_339199 3300042622 Bacteria 43843
103 Ga0466703_430151 3300042636 Bacteria 25228
104 Ga0466704_094044 3300042643 Bacteria 4205
105 Ga0466727_232801 3300042655 Bacteria 2721
106 Ga0466720_151977 3300042607 Bacteria 30631
107 Ga0466721_081636 3300042608 Bacteria 4384
108 AustNasuHG_c1002254 3300000089 Bacteria 6956
109 JGI24698J34947_10000990 3300002449 Bacteria 14566
110 JGI24695J34938_10000217 3300002450 Bacteria 55213
111 JGI24695J34938_10003047 3300002450 Bacteria 12017
112 JGI24695J34938_10021166 3300002450 Bacteria 3185
113 JGI24702J35022_10015641 3300002462 Bacteria 4169
114 JGI24697J35500_11186038 3300002507 Bacteria 1551
115 JGI24700J35501_10928786 3300002508 Bacteria 8081
116 Ga0072941_1000579 3300005201 Bacteria 109731
117 Ga0415639_009901 3300038395 Bacteria 3030
118 Ga0415639_017152 3300038395 Bacteria 18110
119 Ga0466693_079624 3300042592 Bacteria 1628
120 Ga0466699_225053 3300042597 Bacteria 3491
121 Ga0466715_213993 3300042616 Bacteria 2340
122 Ga0466718_078640 3300042617 Bacteria 14183
123 Ga0466726_067803 3300042619 Bacteria 8139
124 Ga0466726_097352 3300042619 Bacteria 7396
125 Ga0123356_10039645 3300010049 Bacteria 4388
126 Ga0466731_145473 3300042622 Bacteria 2519
127 Ga0466709_187107 3300042648 Bacteria 3039
128 Ga0466708_127844 3300042652 Bacteria 9577
129 Ga0466708_399536 3300042652 Bacteria 3091
130 Ga0466719_263815 3300042606 Bacteria 1531
131 Ga0466719_376233 3300042606 Bacteria 1701
132 Ga0466720_173739 3300042607 Unclassified 4714
133 Ga0466722_217333 3300042609 Bacteria 2614
134 JGI24698J34947_10000635 3300002449 Bacteria 16938
135 JGI24698J34947_10004732 3300002449 Bacteria 7432
136 JGI24695J34938_10059536 3300002450 Bacteria 1633
137 JGI24702J35022_10001389 3300002462 Bacteria 15049
138 JGI24702J35022_10011673 3300002462 Bacteria 4898
139 JGI24705J35276_12185451 3300002504 Bacteria 1410
140 Ga0415639_102177 3300038395 Bacteria 1429
141 Ga0466690_386234 3300042590 Bacteria 6160
142 Ga0466693_039288 3300042592 Bacteria 17723
143 Ga0466718_026920 3300042617 Unclassified 2251
144 Ga0466718_074084 3300042617 Bacteria 4007
145 Ga0123357_10197160 3300009784 Bacteria 2302
146 Ga0466705_199226 3300042612 Bacteria 2695
147 Ga0466727_292247 3300042655 Bacteria 1659
148 Ga0466719_568263 3300042606 Bacteria 3881
149 JGI24695J34938_10000724 3300002450 Bacteria 31069
150 JGI24702J35022_10010796 3300002462 Archaea 5096
151 JGI24702J35022_10036629 3300002462 Bacteria 2622
152 JGI24705J35276_12214555 3300002504 Bacteria 1966
153 Ga0072941_1072014 3300005201 Bacteria 1721
154 Ga0072941_1141773 3300005201 Bacteria 3380
155 Ga0415639_011109 3300038395 Bacteria 33335
156 Ga0415639_042255 3300038395 Bacteria 13028
157 Ga0466690_170268 3300042590 Bacteria 2681
158 Ga0466699_122134 3300042597 Bacteria 18512
159 Ga0466699_140424 3300042597 Bacteria 4468
160 Ga0466699_264710 3300042597 Bacteria 2351
161 Ga0466711_458167 3300042615 Bacteria 21346
162 Ga0466718_117611 3300042617 Bacteria 5074
163 Ga0466728_010321 3300042620 Bacteria 2582
164 Ga0123355_10193732 3300009826 Bacteria 2986
165 Ga0123353_10138272 3300010167 Bacteria 3905
166 Ga0466732_066115 3300042656 Bacteria 6890
167 Ga0466735_091987 3300042624 Bacteria 2905
168 Ga0466703_138482 3300042636 Bacteria 7710
169 Ga0466703_195532 3300042636 Unclassified 5660
170 Ga0466704_522378 3300042643 Unclassified 5151

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_305226 Ga0466726_305226_93_1172 359
2 iso_pr_bacteria 2781125640 2781287954 375
3 3300002450 JGI24695J34938_10000724 JGI24695J34938_1000072426 376
4 3300002450 JGI24695J34938_10021166 JGI24695J34938_100211662 376
5 3300002450 JGI24695J34938_10049248 JGI24695J34938_100492481 376
6 3300042601 Ga0466707_155509 Ga0466707_155509_65_1195 376
7 iso_pr_bacteria 2778260937 2778348487 376
8 iso_pr_bacteria 2781125661 2781334147 376
9 3300002450 JGI24695J34938_10003047 JGI24695J34938_100030474 377
10 3300002450 JGI24695J34938_10059536 JGI24695J34938_100595361 377
11 3300005201 Ga0072941_1141773 Ga0072941_11417732 377
12 3300010049 Ga0123356_10002265 Ga0123356_1000226510 377
13 3300010049 Ga0123356_10004392 Ga0123356_1000439214 377
14 3300010049 Ga0123356_10039645 Ga0123356_100396453 377
15 3300038395 Ga0415639_138215 Ga0415639_138215_261_1394 377
16 3300042621 Ga0466729_097884 Ga0466729_097884_80_1213 377
17 3300002462 JGI24702J35022_10010796 JGI24702J35022_100107966 378
18 3300010049 Ga0123356_10192129 Ga0123356_101921292 378
19 3300010167 Ga0123353_10012196 Ga0123353_100121962 378
20 3300002504 JGI24705J35276_12185451 JGI24705J35276_121854511 379
21 3300042620 Ga0466728_010321 Ga0466728_010321_341_1480 379
22 iso_pr_bacteria 2820018428 2820018486 379
23 3300042596 Ga0466696_246029 Ga0466696_246029_361_1563 380
24 iso_pr_bacteria 2781125658 2781325627 380
25 3300010049 Ga0123356_10002367 Ga0123356_100023675 381
26 iso_pr_bacteria 2820010479 2820011035 381
27 3300010049 Ga0123356_10005273 Ga0123356_1000527312 382
28 3300038395 Ga0415639_009901 Ga0415639_009901_936_2084 382
29 3300042622 Ga0466731_145473 Ga0466731_145473_1163_2311 382
30 iso_pr_bacteria 2781125656 2781322069 382
31 3300000089 AustNasuHG_c1002254 AustNasuHG_10022543 383
32 3300000089 AustNasuHG_c1005965 AustNasuHG_10059652 383
33 3300009826 Ga0123355_10193732 Ga0123355_101937325 383
34 3300042604 Ga0466717_074038 Ga0466717_074038_688_1839 383
35 3300042622 Ga0466731_339199 Ga0466731_339199_20499_21650 383
36 3300042592 Ga0466693_039288 Ga0466693_039288_2494_3648 384
37 iso_pr_bacteria 2781125631 2781268798 384
38 3300002450 JGI24695J34938_10018874 JGI24695J34938_100188743 385
39 3300042600 Ga0466700_039672 Ga0466700_039672_348_1505 385
40 3300042618 Ga0466723_091731 Ga0466723_091731_170_1327 385
41 3300000089 AustNasuHG_c1024616 AustNasuHG_10246162 386
42 3300038395 Ga0415639_017152 Ga0415639_017152_1991_3151 386
43 3300010049 Ga0123356_10004233 Ga0123356_100042339 387
44 3300038395 Ga0415639_042255 Ga0415639_042255_3779_4972 387
45 3300042622 Ga0466731_329673 Ga0466731_329673_340_1503 387
46 3300042612 Ga0466705_416682 Ga0466705_416682_5767_6978 388
47 3300042596 Ga0466696_097197 Ga0466696_097197_142_1344 389
48 3300042616 Ga0466715_213993 Ga0466715_213993_350_1540 389
49 3300002462 JGI24702J35022_10001389 JGI24702J35022_1000138911 391
50 3300042609 Ga0466722_100947 Ga0466722_100947_408_1670 392
51 iso_pr_bacteria 2819994798 2819995818 392
52 iso_pr_bacteria 2820414148 2820415409 393
53 3300042617 Ga0466718_078640 Ga0466718_078640_7180_8403 394
54 3300042620 Ga0466728_087954 Ga0466728_087954_1153_2337 394
55 3300042616 Ga0466715_206839 Ga0466715_206839_116_1306 396
56 iso_pr_bacteria 2820013017 2820014004 396
57 iso_pr_bacteria 2820398208 2820400109 396
58 3300002462 JGI24702J35022_10011673 JGI24702J35022_100116734 397
59 3300010167 Ga0123353_10138272 Ga0123353_101382722 397
60 3300042622 Ga0466731_359346 Ga0466731_359346_904_2097 397
61 3300042614 Ga0466712_185644 Ga0466712_185644_6993_8237 398
62 3300042614 Ga0466712_247538 Ga0466712_247538_327_1523 398
63 iso_pr_bacteria 2820651690 2820652443 399
64 3300005201 Ga0072941_1002463 Ga0072941_10024635 400
65 3300042592 Ga0466693_079624 Ga0466693_079624_101_1303 400
66 3300042596 Ga0466696_254953 Ga0466696_254953_17666_18868 400
67 3300042618 Ga0466723_327100 Ga0466723_327100_10_1212 400
68 3300042643 Ga0466704_094044 Ga0466704_094044_2604_3806 400
69 3300010167 Ga0123353_10129167 Ga0123353_101291676 401
70 3300010167 Ga0123353_10148252 Ga0123353_101482525 401
71 3300010882 Ga0123354_10000037 Ga0123354_1000003740 401
72 3300042597 Ga0466699_034790 Ga0466699_034790_243_1487 401
73 3300005201 Ga0072941_1072014 Ga0072941_10720142 402
74 3300042601 Ga0466707_378263 Ga0466707_378263_8806_10014 402
75 3300042615 Ga0466711_458167 Ga0466711_458167_14152_15360 402
76 3300042617 Ga0466718_087275 Ga0466718_087275_2196_3431 402
77 3300002449 JGI24698J34947_10004732 JGI24698J34947_100047326 403
78 3300042602 Ga0466713_048745 Ga0466713_048745_285_1496 403
79 3300042624 Ga0466735_091987 Ga0466735_091987_1110_2321 403
80 3300042590 Ga0466690_386234 Ga0466690_386234_4264_5481 405
81 3300042606 Ga0466719_314367 Ga0466719_314367_299_1516 405
82 3300042591 Ga0466692_130610 Ga0466692_130610_5507_6727 406
83 3300042615 Ga0466711_192757 Ga0466711_192757_21392_22612 406
84 iso_pr_bacteria 2820406809 2820406963 406
85 3300024493 Ga0264413_135637 Ga0264413_1356372 407
86 3300042597 Ga0466699_264710 Ga0466699_264710_237_1460 407
87 3300042603 Ga0466714_111583 Ga0466714_111583_987_2210 407
88 3300042606 Ga0466719_403544 Ga0466719_403544_421_1644 407
89 3300042607 Ga0466720_029459 Ga0466720_029459_5340_6563 407
90 3300042607 Ga0466720_151977 Ga0466720_151977_13974_15197 407
91 3300042608 Ga0466721_081636 Ga0466721_081636_2675_3898 407
92 3300042608 Ga0466721_225174 Ga0466721_225174_17996_19219 407
93 3300042610 Ga0466698_028159 Ga0466698_028159_3226_4449 407
94 3300042617 Ga0466718_026920 Ga0466718_026920_328_1551 407
95 3300042617 Ga0466718_071750 Ga0466718_071750_323_1546 407
96 3300042617 Ga0466718_074084 Ga0466718_074084_2425_3648 407
97 3300042617 Ga0466718_117611 Ga0466718_117611_234_1457 407
98 3300042619 Ga0466726_097352 Ga0466726_097352_1326_2549 407
99 3300042619 Ga0466726_401296 Ga0466726_401296_1417_2640 407
100 3300042619 Ga0466726_431332 Ga0466726_431332_820_2043 407
101 3300042622 Ga0466731_375477 Ga0466731_375477_228_1451 407
102 3300042652 Ga0466708_127844 Ga0466708_127844_4188_5411 407
103 3300042655 Ga0466727_292247 Ga0466727_292247_358_1581 407
104 3300042656 Ga0466732_066115 Ga0466732_066115_356_1579 407
105 3300042656 Ga0466732_436719 Ga0466732_436719_1270_2493 407
106 iso_pr_bacteria 2781125693 2781432769 407
107 3300000089 AustNasuHG_c1003260 AustNasuHG_10032604 408
108 3300000089 AustNasuHG_c1004628 AustNasuHG_10046282 408
109 3300000089 AustNasuHG_c1008454 AustNasuHG_10084542 408
110 3300000089 AustNasuHG_c1012440 AustNasuHG_10124402 408
111 3300002462 JGI24702J35022_10036629 JGI24702J35022_100366293 408
112 3300002462 JGI24702J35022_10043846 JGI24702J35022_100438463 408
113 3300010049 Ga0123356_10009080 Ga0123356_100090807 408
114 3300010049 Ga0123356_10180964 Ga0123356_101809642 408
115 3300038395 Ga0415639_102177 Ga0415639_102177_98_1324 408
116 3300002462 JGI24702J35022_10015641 JGI24702J35022_100156413 409
117 3300042599 Ga0466706_166198 Ga0466706_166198_30372_31676 409
118 3300042599 Ga0466706_159313 Ga0466706_159313_81_1313 410
119 3300042648 Ga0466709_187107 Ga0466709_187107_1621_2853 410
120 3300042655 Ga0466727_266933 Ga0466727_266933_1879_3111 410
121 3300024493 Ga0264413_133904 Ga0264413_1339044 411
122 3300042605 Ga0466716_285211 Ga0466716_285211_1118_2353 411
123 3300042604 Ga0466717_286165 Ga0466717_286165_1299_2537 412
124 iso_pr_bacteria 2781125687 2781422010 412
125 3300002450 JGI24695J34938_10000217 JGI24695J34938_1000021733 413
126 3300002504 JGI24705J35276_12214555 JGI24705J35276_122145551 413
127 3300009784 Ga0123357_10055311 Ga0123357_100553114 413
128 3300009784 Ga0123357_10197160 Ga0123357_101971602 413
129 3300010049 Ga0123356_10391232 Ga0123356_103912321 413
130 3300010167 Ga0123353_10378712 Ga0123353_103787122 413
131 3300010882 Ga0123354_10144616 Ga0123354_101446162 413
132 3300042590 Ga0466690_170268 Ga0466690_170268_1197_2438 413
133 3300042619 Ga0466726_067803 Ga0466726_067803_4641_5882 413
134 3300042652 Ga0466708_399536 Ga0466708_399536_431_1672 413
135 3300042655 Ga0466727_232801 Ga0466727_232801_1163_2404 413
136 3300000062 IMNBL1DRAFT_c0008850 IMNBL1DRAFT_00088505 415
137 3300002508 JGI24700J35501_10928786 JGI24700J35501_109287863 415
138 3300042590 Ga0466690_123716 Ga0466690_123716_673_1920 415
139 3300042597 Ga0466699_140424 Ga0466699_140424_2490_3737 415
140 3300042606 Ga0466719_376233 Ga0466719_376233_306_1553 415
141 3300042609 Ga0466722_063808 Ga0466722_063808_6029_7276 415
142 3300042609 Ga0466722_217333 Ga0466722_217333_310_1557 415
143 3300002449 JGI24698J34947_10003085 JGI24698J34947_100030854 416
144 3300005201 Ga0072941_1000579 Ga0072941_100057955 416
145 3300042593 Ga0466691_079544 Ga0466691_079544_304_1596 416
146 3300042597 Ga0466699_225053 Ga0466699_225053_1462_2712 416
147 3300042607 Ga0466720_173739 Ga0466720_173739_2740_3990 416
148 3300042614 Ga0466712_072099 Ga0466712_072099_215_1465 416
149 3300042654 Ga0466725_132819 Ga0466725_132819_2493_3743 416
150 3300002507 JGI24697J35500_11186038 JGI24697J35500_111860382 417
151 3300038395 Ga0415639_011109 Ga0415639_011109_25820_27073 417
152 3300042593 Ga0466691_218612 Ga0466691_218612_5337_6590 417
153 3300042606 Ga0466719_263815 Ga0466719_263815_197_1450 417
154 3300042606 Ga0466719_568263 Ga0466719_568263_398_1651 417
155 3300042606 Ga0466719_568263 Ga0466719_568263_398_1651 417
156 3300042609 Ga0466722_006386 Ga0466722_006386_3221_4474 417
157 3300042612 Ga0466705_078170 Ga0466705_078170_2346_3599 417
158 3300042615 Ga0466711_510758 Ga0466711_510758_2605_3858 417
159 3300042636 Ga0466703_133030 Ga0466703_133030_281_1534 417
160 3300042636 Ga0466703_138482 Ga0466703_138482_2130_3383 417
161 3300042636 Ga0466703_430151 Ga0466703_430151_22628_23881 417
162 3300042636 Ga0466703_430565 Ga0466703_430565_408_1661 417
163 3300042643 Ga0466704_064098 Ga0466704_064098_2541_3794 417
164 3300042643 Ga0466704_065068 Ga0466704_065068_2072_3325 417
165 3300042643 Ga0466704_119362 Ga0466704_119362_2407_3660 417
166 3300042643 Ga0466704_149896 Ga0466704_149896_1350_2603 417
167 3300042643 Ga0466704_522378 Ga0466704_522378_587_1840 417
168 3300042659 Ga0466733_039904 Ga0466733_039904_526_1779 417
169 3300002449 JGI24698J34947_10033172 JGI24698J34947_100331724 418
170 3300042597 Ga0466699_074311 Ga0466699_074311_850_2109 419
171 3300042614 Ga0466712_077165 Ga0466712_077165_5064_6323 419
172 3300042614 Ga0466712_244462 Ga0466712_244462_5009_6268 419
173 3300042636 Ga0466703_195532 Ga0466703_195532_2910_4169 419
174 3300002449 JGI24698J34947_10000990 JGI24698J34947_1000099011 420
175 3300002449 JGI24698J34947_10001336 JGI24698J34947_1000133610 420
176 3300002449 JGI24698J34947_10002023 JGI24698J34947_100020233 420
177 3300042618 Ga0466723_116209 Ga0466723_116209_634_1896 420
178 3300002449 JGI24698J34947_10000635 JGI24698J34947_100006358 421
179 3300002450 JGI24695J34938_10031733 JGI24695J34938_100317333 421
180 3300042643 Ga0466704_541316 Ga0466704_541316_219_1484 421
181 3300042590 Ga0466690_060536 Ga0466690_060536_51_1319 422
182 3300042612 Ga0466705_199226 Ga0466705_199226_69_1337 422
183 3300042597 Ga0466699_122134 Ga0466699_122134_10064_11335 423
184 3300042621 Ga0466729_223936 Ga0466729_223936_340_1614 424
185 iso_pr_bacteria 2940241992 2940243844 427
186 iso_pr_bacteria 2940349480 2940351346 427
187 3300042598 Ga0466701_070007 Ga0466701_070007_267_1622 439
188 3300005083 Ga0068305_10063519 Ga0068305_100635192 445
189 3300042602 Ga0466713_097948 Ga0466713_097948_31476_32885 469

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01139 RtcB tRNA-splicing ligase RtcB 194 466 0.86

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
7p3b-assembly2.cif.gz_B Human RNA ligase RTCB in complex with GMP and Co(II) 0.733 56 467
8dcb-assembly2.cif.gz_B RNA ligase RtcB from Pyrococcus horikoshii in complex with Ni2+ and GTP 0.728 54 467
4dwr-assembly3.cif.gz_C RNA ligase RtcB/Mn2+ complex 0.726 53 468
7p3b-assembly1.cif.gz_A Human RNA ligase RTCB in complex with GMP and Co(II) 0.719 56 467
2epg-assembly1.cif.gz_A Crystal structure of TTHA1785 0.677 56 467
IDDescriptionScoreStartEndSuperfamily
af_Q8I5J3_323_568_3.90.1860.10 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.8229 227 467 3.90.1860.10
af_Q4DZR4_37_449_3.90.1860.10 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.794 75 467 3.90.1860.10
af_A4I8R9_1_351_3.90.1860.10 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.7669 139 467 3.90.1860.10
af_Q99LF4_9_505_3.90.1860.10 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.7628 56 467 3.90.1860.10
1uc2A00 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.7376 53 467 3.90.1860.10
IDDescriptionScoreStartEndGO Terms
AF-A0A150CA90-F1-model_v4 Uncharacterized/unreviewed 0.9917 65 124
AF-A0A7X8CHM5-F1-model_v4 Uncharacterized/unreviewed 0.9895 351 467

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.