Protein Family IF06105
Metagenome
Isolate
229
Members
81
Samples
195
Scaffolds
401.09
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_094833|Ga0466713_094833_25077_26270
- Length
- 392 aa
- Sequence
- MGRVLIIGAGGVGTVVAHKVAQNSDVFTDIMLASRTKSKCDAIAAAIGGNKIKTAQVDADNVEDLKRLFNDFKPELVINVALPYQDLTIMDACLACGVNYLDTANYEPKEEAKFEAYQDRFKEAGLTAILGCGFDPGVTSVFTAYAVKHHFDEIHELDIVDCNAGDHGKAFATNFNPEINIREVTQKGKYWENGQWVETEPHAIHKALTYPNIGPKESYVIYHEELESLVKNYPSLKRARFWMTFGQEYLTHLRVIQNIGMARIDPVIYNGVEIVPIQFLKAVLPDPGELGENYKGETSIGCRIKGIKDGKERTYYIYNNCSHEAAYKETGTQAVSYTTGVPATIGAMMFMKNLWRKPGVFNVEEFDPDPFMEQLNKQGLPWHELFDIDLEF
Sample Types
Isolate
14.8%
Metagenome
85.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
23.8%
Unclassified
20.0%
Blattidae
20.0%
Kalotermitidae
17.5%
Termopsidae
5.0%
Rhinotermitidae
5.0%
Passalidae
2.5%
Hydrophilidae
2.5%
Hodotermitidae
1.2%
Apidae
1.2%
Tenebrionidae
1.2%
Taxonomy
Archaea
0
Bacteria
223
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 3 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 4 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 5 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 6 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 7 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 8 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 9 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 10 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 11 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 12 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 13 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 14 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 15 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 16 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 17 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 18 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 24 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 30 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 31 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 32 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 33 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 34 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 35 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 36 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 37 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 38 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 39 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 40 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 41 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 42 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 43 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 44 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 45 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 46 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 47 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 48 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 49 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 50 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 51 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 52 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 53 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 54 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 55 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 56 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 57 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 58 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 59 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 60 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 61 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 62 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 63 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 64 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 65 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 66 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 67 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 68 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 69 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 70 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 71 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 72 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 73 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 74 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 75 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 76 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 77 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 78 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 79 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 80 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 81 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_082574 | 3300042611 | Bacteria | 3292 |
| 2 | Ga0466705_032521 | 3300042612 | Bacteria | 7211 |
| 3 | Ga0466733_010070 | 3300042659 | Bacteria | 12675 |
| 4 | Ga0466733_010510 | 3300042659 | Bacteria | 12841 |
| 5 | Ga0466733_190167 | 3300042659 | Bacteria | 9240 |
| 6 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 7 | Ga0123355_10000217 | 3300009826 | Bacteria | 72204 |
| 8 | Ga0123356_10007592 | 3300010049 | Bacteria | 10811 |
| 9 | Ga0123353_10000014 | 3300010167 | Bacteria | 204767 |
| 10 | Ga0466690_203626 | 3300042590 | Bacteria | 18251 |
| 11 | Ga0466696_151261 | 3300042596 | Bacteria | 13227 |
| 12 | Ga0466711_443278 | 3300042615 | Bacteria | 16399 |
| 13 | Ga0466715_081681 | 3300042616 | Bacteria | 2197 |
| 14 | Ga0466715_231121 | 3300042616 | Bacteria | 27941 |
| 15 | Ga0466735_060576 | 3300042624 | Bacteria | 1547 |
| 16 | Ga0466704_204908 | 3300042643 | Bacteria | 43948 |
| 17 | Ga0466706_109717 | 3300042599 | Bacteria | 38259 |
| 18 | Ga0466706_123274 | 3300042599 | Bacteria | 9629 |
| 19 | Ga0466700_216390 | 3300042600 | Bacteria | 24849 |
| 20 | Ga0466700_461852 | 3300042600 | Bacteria | 13661 |
| 21 | Ga0466707_088296 | 3300042601 | Bacteria | 21052 |
| 22 | Ga0466713_036864 | 3300042602 | Bacteria | 8349 |
| 23 | Ga0466714_016409 | 3300042603 | Bacteria | 3011 |
| 24 | Ga0466714_027882 | 3300042603 | Bacteria | 10660 |
| 25 | Ga0466714_147746 | 3300042603 | Bacteria | 2166 |
| 26 | Ga0466719_035461 | 3300042606 | Bacteria | 2571 |
| 27 | JGI24696J40584_12958628 | 3300002834 | Bacteria | 4280 |
| 28 | Ga0123357_10001231 | 3300009784 | Bacteria | 26869 |
| 29 | Ga0123357_10001302 | 3300009784 | Bacteria | 26330 |
| 30 | Ga0123353_10028875 | 3300010167 | Bacteria | 8534 |
| 31 | Ga0123353_10068623 | 3300010167 | Bacteria | 5694 |
| 32 | Ga0466690_305371 | 3300042590 | Bacteria | 6702 |
| 33 | Ga0466690_329486 | 3300042590 | Bacteria | 7489 |
| 34 | Ga0466690_381813 | 3300042590 | Bacteria | 66142 |
| 35 | Ga0466692_066865 | 3300042591 | Bacteria | 168349 |
| 36 | Ga0466692_172080 | 3300042591 | Bacteria | 48787 |
| 37 | Ga0466696_501498 | 3300042596 | Bacteria | 3465 |
| 38 | Ga0466711_011148 | 3300042615 | Bacteria | 16719 |
| 39 | Ga0466715_176752 | 3300042616 | Bacteria | 9889 |
| 40 | Ga0466726_041728 | 3300042619 | Bacteria | 12106 |
| 41 | Ga0466726_153064 | 3300042619 | Bacteria | 2776 |
| 42 | Ga0466729_248084 | 3300042621 | Bacteria | 4247 |
| 43 | Ga0466735_152601 | 3300042624 | Bacteria | 3205 |
| 44 | Ga0466703_104988 | 3300042636 | Bacteria | 39552 |
| 45 | Ga0466703_172335 | 3300042636 | Bacteria | 1869 |
| 46 | Ga0466704_492877 | 3300042643 | Bacteria | 18854 |
| 47 | Ga0466709_015483 | 3300042648 | Bacteria | 50381 |
| 48 | Ga0466727_332703 | 3300042655 | Bacteria | 2644 |
| 49 | Ga0466701_038531 | 3300042598 | Bacteria | 8654 |
| 50 | Ga0466706_017737 | 3300042599 | Bacteria | 16038 |
| 51 | Ga0466706_253078 | 3300042599 | Bacteria | 9171 |
| 52 | Ga0466700_139425 | 3300042600 | Bacteria | 1556 |
| 53 | Ga0466713_008663 | 3300042602 | Bacteria | 11984 |
| 54 | Ga0466719_102777 | 3300042606 | Bacteria | 6865 |
| 55 | Ga0466722_023479 | 3300042609 | Bacteria | 103035 |
| 56 | Ga0466722_249823 | 3300042609 | Bacteria | 11103 |
| 57 | 2227255808 | 2225789004 | Bacteria | 7052 |
| 58 | Ga0123357_10001808 | 3300009784 | Bacteria | 23175 |
| 59 | Ga0466705_200893 | 3300042612 | Unclassified | 3120 |
| 60 | Ga0123354_10000043 | 3300010882 | Bacteria | 94179 |
| 61 | Ga0123354_10006906 | 3300010882 | Bacteria | 16953 |
| 62 | Ga0466705_415571 | 3300042612 | Bacteria | 12820 |
| 63 | Ga0466729_195540 | 3300042621 | Bacteria | 5248 |
| 64 | Ga0466735_064598 | 3300042624 | Bacteria | 1825 |
| 65 | Ga0466703_413955 | 3300042636 | Unclassified | 1914 |
| 66 | Ga0466704_564931 | 3300042643 | Bacteria | 57319 |
| 67 | Ga0466714_026555 | 3300042603 | Bacteria | 7817 |
| 68 | Ga0466714_034524 | 3300042603 | Bacteria | 4267 |
| 69 | Ga0466714_115773 | 3300042603 | Bacteria | 12601 |
| 70 | Ga0466716_033455 | 3300042605 | Bacteria | 5469 |
| 71 | Ga0466716_223439 | 3300042605 | Bacteria | 4893 |
| 72 | 2227571296 | 2225789004 | Bacteria | 2610 |
| 73 | JGI24699J35502_11134119 | 3300002509 | Bacteria | 33315 |
| 74 | Ga0466733_093618 | 3300042659 | Bacteria | 4402 |
| 75 | Ga0123355_10004460 | 3300009826 | Bacteria | 20355 |
| 76 | Ga0123354_10015975 | 3300010882 | Bacteria | 11760 |
| 77 | Ga0466657_099598 | 3300042582 | Unclassified | 2371 |
| 78 | Ga0466657_205176 | 3300042582 | Bacteria | 5348 |
| 79 | Ga0466690_196869 | 3300042590 | Bacteria | 20384 |
| 80 | Ga0466696_194060 | 3300042596 | Bacteria | 9186 |
| 81 | Ga0466703_187848 | 3300042636 | Bacteria | 24483 |
| 82 | Ga0466709_143143 | 3300042648 | Bacteria | 7564 |
| 83 | Ga0466708_213620 | 3300042652 | Bacteria | 16319 |
| 84 | Ga0466706_032582 | 3300042599 | Bacteria | 5183 |
| 85 | Ga0466706_062701 | 3300042599 | Bacteria | 30756 |
| 86 | Ga0466706_147046 | 3300042599 | Bacteria | 3052 |
| 87 | Ga0466706_154785 | 3300042599 | Bacteria | 38589 |
| 88 | Ga0466700_102266 | 3300042600 | Bacteria | 11894 |
| 89 | Ga0466714_097468 | 3300042603 | Bacteria | 30428 |
| 90 | Ga0466714_157285 | 3300042603 | Bacteria | 5556 |
| 91 | Ga0466722_014948 | 3300042609 | Bacteria | 1348 |
| 92 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 93 | JGI24699J35502_11133131 | 3300002509 | Bacteria | 8859 |
| 94 | Ga0466705_237273 | 3300042612 | Unclassified | 4077 |
| 95 | Ga0466733_165496 | 3300042659 | Bacteria | 147790 |
| 96 | Ga0123353_10221045 | 3300010167 | Bacteria | 2961 |
| 97 | Ga0123353_10360801 | 3300010167 | Bacteria | 2184 |
| 98 | Ga0265387_1008476 | 3300024582 | Bacteria | 1382 |
| 99 | Ga0466690_162531 | 3300042590 | Bacteria | 19605 |
| 100 | Ga0466692_085384 | 3300042591 | Bacteria | 3065 |
| 101 | Ga0466696_036786 | 3300042596 | Bacteria | 23414 |
| 102 | Ga0466696_194601 | 3300042596 | Bacteria | 4972 |
| 103 | Ga0466711_379326 | 3300042615 | Bacteria | 15263 |
| 104 | Ga0466711_505647 | 3300042615 | Bacteria | 2315 |
| 105 | Ga0466715_204325 | 3300042616 | Bacteria | 15731 |
| 106 | Ga0466735_023009 | 3300042624 | Bacteria | 2552 |
| 107 | Ga0466735_108845 | 3300042624 | Bacteria | 1830 |
| 108 | Ga0466735_180342 | 3300042624 | Bacteria | 4543 |
| 109 | Ga0466708_178346 | 3300042652 | Bacteria | 7202 |
| 110 | Ga0466725_468350 | 3300042654 | Bacteria | 1523 |
| 111 | Ga0466707_244909 | 3300042601 | Bacteria | 19983 |
| 112 | Ga0466707_252281 | 3300042601 | Bacteria | 31745 |
| 113 | Ga0466707_365185 | 3300042601 | Bacteria | 38210 |
| 114 | Ga0466713_006207 | 3300042602 | Bacteria | 30471 |
| 115 | Ga0466714_013282 | 3300042603 | Bacteria | 46229 |
| 116 | Ga0466714_061090 | 3300042603 | Bacteria | 1322 |
| 117 | Ga0466714_138622 | 3300042603 | Bacteria | 2050 |
| 118 | Ga0466717_291278 | 3300042604 | Bacteria | 2382 |
| 119 | Ga0466719_135195 | 3300042606 | Bacteria | 5520 |
| 120 | Ga0466722_149423 | 3300042609 | Bacteria | 12812 |
| 121 | IMNBL1DRAFT_c0001938 | 3300000062 | Bacteria | 14919 |
| 122 | IMNBL1DRAFT_c0022593 | 3300000062 | Bacteria | 2484 |
| 123 | JGI24705J35276_12235581 | 3300002504 | Bacteria | 6692 |
| 124 | JGI24699J35502_11134185 | 3300002509 | Bacteria | 47737 |
| 125 | Ga0466705_043486 | 3300042612 | Bacteria | 12337 |
| 126 | Ga0466732_197724 | 3300042656 | Bacteria | 2170 |
| 127 | Ga0123357_10012959 | 3300009784 | Bacteria | 10778 |
| 128 | Ga0466692_084653 | 3300042591 | Bacteria | 16158 |
| 129 | Ga0466715_453359 | 3300042616 | Bacteria | 14511 |
| 130 | Ga0466735_196434 | 3300042624 | Bacteria | 1552 |
| 131 | Ga0466704_060441 | 3300042643 | Unclassified | 15430 |
| 132 | Ga0466727_127654 | 3300042655 | Bacteria | 16726 |
| 133 | Ga0466706_003303 | 3300042599 | Bacteria | 41304 |
| 134 | Ga0466706_062858 | 3300042599 | Bacteria | 29571 |
| 135 | Ga0466706_145887 | 3300042599 | Bacteria | 3050 |
| 136 | Ga0466707_111460 | 3300042601 | Bacteria | 13128 |
| 137 | Ga0466707_177166 | 3300042601 | Bacteria | 6088 |
| 138 | Ga0466713_140967 | 3300042602 | Bacteria | 12110 |
| 139 | Ga0466719_462970 | 3300042606 | Bacteria | 1439 |
| 140 | Ga0466722_177930 | 3300042609 | Bacteria | 5579 |
| 141 | IMNBL1DRAFT_c0001342 | 3300000062 | Bacteria | 18557 |
| 142 | IMNBL1DRAFT_c0002854 | 3300000062 | Bacteria | 11607 |
| 143 | IMNBL1DRAFT_c0003670 | 3300000062 | Bacteria | 9676 |
| 144 | JGI24702J35022_10039937 | 3300002462 | Bacteria | 2503 |
| 145 | Ga0068302_10022774 | 3300005071 | Bacteria | 3195 |
| 146 | Ga0123357_10001096 | 3300009784 | Bacteria | 28022 |
| 147 | Ga0466705_241963 | 3300042612 | Bacteria | 10058 |
| 148 | Ga0466732_042886 | 3300042656 | Bacteria | 18549 |
| 149 | Ga0466733_043227 | 3300042659 | Bacteria | 9069 |
| 150 | Ga0466733_061004 | 3300042659 | Bacteria | 2718 |
| 151 | Ga0123353_10218061 | 3300010167 | Unclassified | 2987 |
| 152 | Ga0123354_10000098 | 3300010882 | Bacteria | 64634 |
| 153 | Ga0123354_10224880 | 3300010882 | Bacteria | 1981 |
| 154 | Ga0466692_152956 | 3300042591 | Bacteria | 1693 |
| 155 | Ga0466695_248421 | 3300042595 | Bacteria | 28685 |
| 156 | Ga0466715_056993 | 3300042616 | Bacteria | 5461 |
| 157 | Ga0466715_168192 | 3300042616 | Bacteria | 33620 |
| 158 | Ga0466715_376224 | 3300042616 | Bacteria | 43713 |
| 159 | Ga0466723_028187 | 3300042618 | Bacteria | 12265 |
| 160 | Ga0466723_103710 | 3300042618 | Bacteria | 16785 |
| 161 | Ga0466728_259710 | 3300042620 | Bacteria | 3759 |
| 162 | Ga0466735_011617 | 3300042624 | Bacteria | 1829 |
| 163 | Ga0466703_046369 | 3300042636 | Bacteria | 2546 |
| 164 | Ga0466704_407929 | 3300042643 | Bacteria | 7255 |
| 165 | Ga0466727_027649 | 3300042655 | Bacteria | 5716 |
| 166 | Ga0466701_078950 | 3300042598 | Bacteria | 2629 |
| 167 | Ga0466700_002018 | 3300042600 | Bacteria | 2483 |
| 168 | Ga0466707_075455 | 3300042601 | Bacteria | 9140 |
| 169 | Ga0466713_094833 | 3300042602 | Bacteria | 47599 |
| 170 | Ga0466713_095475 | 3300042602 | Bacteria | 20507 |
| 171 | Ga0466713_113804 | 3300042602 | Bacteria | 13271 |
| 172 | Ga0466716_179352 | 3300042605 | Bacteria | 6928 |
| 173 | Ga0466722_110233 | 3300042609 | Bacteria | 35927 |
| 174 | Ga0466733_200459 | 3300042659 | Bacteria | 8775 |
| 175 | Ga0123357_10008343 | 3300009784 | Bacteria | 12931 |
| 176 | Ga0123353_10000303 | 3300010167 | Bacteria | 61266 |
| 177 | Ga0466691_188418 | 3300042593 | Bacteria | 4344 |
| 178 | Ga0466696_013345 | 3300042596 | Bacteria | 16053 |
| 179 | Ga0466696_459794 | 3300042596 | Bacteria | 2841 |
| 180 | Ga0466711_052513 | 3300042615 | Bacteria | 13382 |
| 181 | Ga0466711_239482 | 3300042615 | Bacteria | 2737 |
| 182 | Ga0466729_050488 | 3300042621 | Bacteria | 3592 |
| 183 | Ga0466735_129196 | 3300042624 | Bacteria | 5733 |
| 184 | Ga0466703_239628 | 3300042636 | Bacteria | 2408 |
| 185 | Ga0466704_347337 | 3300042643 | Bacteria | 2273 |
| 186 | Ga0466727_113322 | 3300042655 | Bacteria | 53270 |
| 187 | Ga0466706_003095 | 3300042599 | Bacteria | 3250 |
| 188 | Ga0466706_031338 | 3300042599 | Bacteria | 4019 |
| 189 | Ga0466706_157421 | 3300042599 | Bacteria | 9861 |
| 190 | Ga0466707_126978 | 3300042601 | Bacteria | 67227 |
| 191 | Ga0466714_075893 | 3300042603 | Bacteria | 13927 |
| 192 | Ga0466719_497203 | 3300042606 | Bacteria | 34034 |
| 193 | 2227499067 | 2225789004 | Bacteria | 3852 |
| 194 | IMNBL1DRAFT_c0028485 | 3300000062 | Bacteria | 2082 |
| 195 | JGI24699J35502_11134090 | 3300002509 | Bacteria | 29402 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300000062 | IMNBL1DRAFT_c0001342 | IMNBL1DRAFT_000134213 | 386 |
| 2 | 3300042590 | Ga0466690_203626 | Ga0466690_203626_9546_10754 | 388 |
| 3 | 3300042599 | Ga0466706_157421 | Ga0466706_157421_7254_8426 | 390 |
| 4 | 3300042601 | Ga0466707_244909 | Ga0466707_244909_11350_12561 | 390 |
| 5 | 3300042621 | Ga0466729_248084 | Ga0466729_248084_2763_3974 | 390 |
| 6 | 3300042598 | Ga0466701_078950 | Ga0466701_078950_395_1603 | 391 |
| 7 | 3300042602 | Ga0466713_140967 | Ga0466713_140967_9263_10462 | 391 |
| 8 | 3300042609 | Ga0466722_014948 | Ga0466722_014948_13_1188 | 391 |
| 9 | 3300042656 | Ga0466732_197724 | Ga0466732_197724_931_2130 | 391 |
| 10 | 3300042602 | Ga0466713_094833 | Ga0466713_094833_25077_26270 | 392 |
| 11 | 2225789004 | 2227499067 | 2227979549 | 394 |
| 12 | 3300009784 | Ga0123357_10001808 | Ga0123357_100018083 | 395 |
| 13 | 3300002509 | JGI24699J35502_11133131 | JGI24699J35502_111331318 | 396 |
| 14 | 3300002509 | JGI24699J35502_11134090 | JGI24699J35502_1113409022 | 396 |
| 15 | 3300024582 | Ga0265387_1008476 | Ga0265387_10084761 | 396 |
| 16 | 3300042591 | Ga0466692_085384 | Ga0466692_085384_1378_2568 | 396 |
| 17 | 3300042599 | Ga0466706_031338 | Ga0466706_031338_2712_3902 | 396 |
| 18 | 3300042599 | Ga0466706_062701 | Ga0466706_062701_5223_6413 | 396 |
| 19 | 3300042603 | Ga0466714_034524 | Ga0466714_034524_969_2159 | 396 |
| 20 | 3300042603 | Ga0466714_157285 | Ga0466714_157285_1979_3169 | 396 |
| 21 | 3300000062 | IMNBL1DRAFT_c0028485 | IMNBL1DRAFT_00284852 | 397 |
| 22 | 3300042590 | Ga0466690_196869 | Ga0466690_196869_11609_12802 | 397 |
| 23 | 3300042599 | Ga0466706_003095 | Ga0466706_003095_1662_2855 | 397 |
| 24 | 3300042599 | Ga0466706_003303 | Ga0466706_003303_25075_26268 | 397 |
| 25 | 3300042599 | Ga0466706_017737 | Ga0466706_017737_2484_3677 | 397 |
| 26 | 3300042599 | Ga0466706_109717 | Ga0466706_109717_24723_25916 | 397 |
| 27 | 3300042599 | Ga0466706_123274 | Ga0466706_123274_6479_7672 | 397 |
| 28 | 3300042599 | Ga0466706_154785 | Ga0466706_154785_1196_2389 | 397 |
| 29 | 3300042599 | Ga0466706_253078 | Ga0466706_253078_4197_5390 | 397 |
| 30 | 3300042600 | Ga0466700_139425 | Ga0466700_139425_64_1257 | 397 |
| 31 | 3300042601 | Ga0466707_111460 | Ga0466707_111460_1236_2429 | 397 |
| 32 | 3300042602 | Ga0466713_095475 | Ga0466713_095475_6466_7659 | 397 |
| 33 | 3300042603 | Ga0466714_115773 | Ga0466714_115773_11203_12396 | 397 |
| 34 | 3300042603 | Ga0466714_138622 | Ga0466714_138622_169_1362 | 397 |
| 35 | 3300042604 | Ga0466717_291278 | Ga0466717_291278_200_1393 | 397 |
| 36 | 3300042605 | Ga0466716_179352 | Ga0466716_179352_1759_3036 | 397 |
| 37 | 3300042611 | Ga0466697_082574 | Ga0466697_082574_716_1909 | 397 |
| 38 | 3300042612 | Ga0466705_200893 | Ga0466705_200893_525_1718 | 397 |
| 39 | 3300042612 | Ga0466705_237273 | Ga0466705_237273_1387_2580 | 397 |
| 40 | 3300042615 | Ga0466711_379326 | Ga0466711_379326_13230_14423 | 397 |
| 41 | 3300042621 | Ga0466729_195540 | Ga0466729_195540_2208_3401 | 397 |
| 42 | 3300042624 | Ga0466735_060576 | Ga0466735_060576_63_1256 | 397 |
| 43 | 3300042643 | Ga0466704_060441 | Ga0466704_060441_4762_5955 | 397 |
| 44 | 3300042643 | Ga0466704_347337 | Ga0466704_347337_163_1356 | 397 |
| 45 | 3300042656 | Ga0466732_042886 | Ga0466732_042886_10564_11757 | 397 |
| 46 | 3300042659 | Ga0466733_061004 | Ga0466733_061004_1350_2543 | 397 |
| 47 | 3300042659 | Ga0466733_165496 | Ga0466733_165496_70857_72050 | 397 |
| 48 | 3300042659 | Ga0466733_200459 | Ga0466733_200459_6277_7470 | 397 |
| 49 | 3300056842 | Ga0562377_0004 | Ga0562377_0004_1638570_1639763 | 397 |
| 50 | iso_pr_bacteria | 2695420317 | 2695483239 | 397 |
| 51 | iso_pr_bacteria | 2695420931 | 2698111729 | 397 |
| 52 | iso_pr_bacteria | 2820757377 | 2820759221 | 397 |
| 53 | iso_pr_bacteria | 2820789850 | 2820792089 | 397 |
| 54 | iso_pr_bacteria | 2873600114 | 2873600288 | 397 |
| 55 | iso_pr_bacteria | 2873610414 | 2873610663 | 397 |
| 56 | iso_pr_bacteria | 2910930387 | 2910933002 | 397 |
| 57 | iso_pr_bacteria | 2910942425 | 2910945478 | 397 |
| 58 | iso_pr_bacteria | 2910949487 | 2910950923 | 397 |
| 59 | iso_pr_bacteria | 2923982719 | 2923984188 | 397 |
| 60 | iso_pr_bacteria | 2940193328 | 2940193743 | 397 |
| 61 | iso_pr_bacteria | 2940244548 | 2940246017 | 397 |
| 62 | iso_pr_bacteria | 2940248789 | 2940249841 | 397 |
| 63 | iso_pr_bacteria | 2940253009 | 2940253915 | 397 |
| 64 | iso_pr_bacteria | 2940257232 | 2940258083 | 397 |
| 65 | iso_pr_bacteria | 2940336608 | 2940337091 | 397 |
| 66 | iso_pr_bacteria | 2940371297 | 2940371861 | 397 |
| 67 | iso_pr_bacteria | 8100157865 | 8100159858 | 397 |
| 68 | 3300002509 | JGI24699J35502_11134185 | JGI24699J35502_1113418527 | 398 |
| 69 | 3300010167 | Ga0123353_10028875 | Ga0123353_100288755 | 398 |
| 70 | 3300010167 | Ga0123353_10068623 | Ga0123353_100686234 | 398 |
| 71 | 3300010167 | Ga0123353_10360801 | Ga0123353_103608012 | 398 |
| 72 | 3300010882 | Ga0123354_10015975 | Ga0123354_100159758 | 398 |
| 73 | 3300042582 | Ga0466657_205176 | Ga0466657_205176_2306_3502 | 398 |
| 74 | 3300042595 | Ga0466695_248421 | Ga0466695_248421_16688_17884 | 398 |
| 75 | 3300042600 | Ga0466700_461852 | Ga0466700_461852_3360_4556 | 398 |
| 76 | 3300042615 | Ga0466711_443278 | Ga0466711_443278_3712_4908 | 398 |
| 77 | 3300042616 | Ga0466715_204325 | Ga0466715_204325_2302_3498 | 398 |
| 78 | 3300042619 | Ga0466726_153064 | Ga0466726_153064_489_1700 | 398 |
| 79 | iso_pr_bacteria | 2820746860 | 2820747745 | 398 |
| 80 | iso_pr_bacteria | 2820770630 | 2820771588 | 398 |
| 81 | iso_pr_bacteria | 2820788205 | 2820789650 | 398 |
| 82 | iso_pr_bacteria | 2940199050 | 2940199629 | 398 |
| 83 | iso_pr_bacteria | 2940346213 | 2940347042 | 398 |
| 84 | 3300002462 | JGI24702J35022_10039937 | JGI24702J35022_100399374 | 399 |
| 85 | 3300002509 | JGI24699J35502_11134119 | JGI24699J35502_1113411918 | 399 |
| 86 | 3300009826 | Ga0123355_10004460 | Ga0123355_1000446013 | 399 |
| 87 | 3300010167 | Ga0123353_10000303 | Ga0123353_100003032 | 399 |
| 88 | 3300010167 | Ga0123353_10218061 | Ga0123353_102180613 | 399 |
| 89 | 3300042590 | Ga0466690_329486 | Ga0466690_329486_3320_4519 | 399 |
| 90 | 3300042609 | Ga0466722_249823 | Ga0466722_249823_1435_2634 | 399 |
| 91 | iso_pr_bacteria | 2820785563 | 2820786074 | 399 |
| 92 | 3300009826 | Ga0123355_10000217 | Ga0123355_100002175 | 400 |
| 93 | 3300042582 | Ga0466657_099598 | Ga0466657_099598_169_1371 | 400 |
| 94 | 3300042596 | Ga0466696_013345 | Ga0466696_013345_14097_15299 | 400 |
| 95 | 3300042596 | Ga0466696_151261 | Ga0466696_151261_10185_11387 | 400 |
| 96 | 3300042596 | Ga0466696_194060 | Ga0466696_194060_517_1719 | 400 |
| 97 | 3300042599 | Ga0466706_062858 | Ga0466706_062858_27827_29029 | 400 |
| 98 | 3300042602 | Ga0466713_008663 | Ga0466713_008663_7313_8515 | 400 |
| 99 | 3300042603 | Ga0466714_013282 | Ga0466714_013282_26599_27801 | 400 |
| 100 | 3300042603 | Ga0466714_061090 | Ga0466714_061090_16_1218 | 400 |
| 101 | 3300042603 | Ga0466714_097468 | Ga0466714_097468_24716_25918 | 400 |
| 102 | 3300042603 | Ga0466714_147746 | Ga0466714_147746_482_1684 | 400 |
| 103 | 3300042605 | Ga0466716_223439 | Ga0466716_223439_1330_2532 | 400 |
| 104 | 3300042616 | Ga0466715_056993 | Ga0466715_056993_124_1326 | 400 |
| 105 | 3300042616 | Ga0466715_176752 | Ga0466715_176752_5294_6496 | 400 |
| 106 | 3300042619 | Ga0466726_041728 | Ga0466726_041728_3778_4980 | 400 |
| 107 | 3300042659 | Ga0466733_010070 | Ga0466733_010070_941_2143 | 400 |
| 108 | 3300042659 | Ga0466733_043227 | Ga0466733_043227_424_1626 | 400 |
| 109 | 3300042659 | Ga0466733_093618 | Ga0466733_093618_2388_3590 | 400 |
| 110 | iso_pr_bacteria | 2820768849 | 2820769470 | 400 |
| 111 | iso_pr_bacteria | 2820774381 | 2820775663 | 400 |
| 112 | iso_pr_bacteria | 2920168565 | 2920171042 | 400 |
| 113 | 3300010167 | Ga0123353_10000014 | Ga0123353_1000001434 | 401 |
| 114 | 3300010882 | Ga0123354_10000043 | Ga0123354_1000004356 | 401 |
| 115 | 3300042596 | Ga0466696_501498 | Ga0466696_501498_283_1488 | 401 |
| 116 | 3300042599 | Ga0466706_032582 | Ga0466706_032582_1407_2612 | 401 |
| 117 | 3300042599 | Ga0466706_145887 | Ga0466706_145887_1155_2360 | 401 |
| 118 | 3300042599 | Ga0466706_147046 | Ga0466706_147046_1164_2369 | 401 |
| 119 | 3300042603 | Ga0466714_026555 | Ga0466714_026555_263_1468 | 401 |
| 120 | 3300042603 | Ga0466714_027882 | Ga0466714_027882_1810_3015 | 401 |
| 121 | 3300042603 | Ga0466714_075893 | Ga0466714_075893_3154_4359 | 401 |
| 122 | 3300042606 | Ga0466719_462970 | Ga0466719_462970_129_1334 | 401 |
| 123 | 3300042616 | Ga0466715_453359 | Ga0466715_453359_10190_11395 | 401 |
| 124 | 3300042624 | Ga0466735_108845 | Ga0466735_108845_198_1403 | 401 |
| 125 | 3300042652 | Ga0466708_213620 | Ga0466708_213620_3162_4367 | 401 |
| 126 | iso_pr_bacteria | 2820776227 | 2820776846 | 401 |
| 127 | 2225789004 | 2227571296 | 2228116463 | 402 |
| 128 | 3300002504 | JGI24705J35276_12235581 | JGI24705J35276_122355811 | 402 |
| 129 | 3300002834 | JGI24696J40584_12958628 | JGI24696J40584_129586284 | 402 |
| 130 | 3300009784 | Ga0123357_10001096 | Ga0123357_1000109614 | 402 |
| 131 | 3300010167 | Ga0123353_10221045 | Ga0123353_102210452 | 402 |
| 132 | 3300010882 | Ga0123354_10006906 | Ga0123354_100069064 | 402 |
| 133 | 3300042590 | Ga0466690_305371 | Ga0466690_305371_3238_4446 | 402 |
| 134 | 3300042590 | Ga0466690_381813 | Ga0466690_381813_42635_43843 | 402 |
| 135 | 3300042591 | Ga0466692_084653 | Ga0466692_084653_12667_13875 | 402 |
| 136 | 3300042591 | Ga0466692_152956 | Ga0466692_152956_300_1508 | 402 |
| 137 | 3300042591 | Ga0466692_172080 | Ga0466692_172080_38046_39254 | 402 |
| 138 | 3300042593 | Ga0466691_188418 | Ga0466691_188418_58_1266 | 402 |
| 139 | 3300042596 | Ga0466696_194601 | Ga0466696_194601_2748_3956 | 402 |
| 140 | 3300042596 | Ga0466696_459794 | Ga0466696_459794_508_1716 | 402 |
| 141 | 3300042600 | Ga0466700_102266 | Ga0466700_102266_1795_3003 | 402 |
| 142 | 3300042600 | Ga0466700_216390 | Ga0466700_216390_381_1589 | 402 |
| 143 | 3300042601 | Ga0466707_088296 | Ga0466707_088296_15982_17190 | 402 |
| 144 | 3300042601 | Ga0466707_126978 | Ga0466707_126978_15378_16586 | 402 |
| 145 | 3300042601 | Ga0466707_177166 | Ga0466707_177166_3026_4234 | 402 |
| 146 | 3300042602 | Ga0466713_006207 | Ga0466713_006207_23327_24535 | 402 |
| 147 | 3300042602 | Ga0466713_036864 | Ga0466713_036864_4986_6194 | 402 |
| 148 | 3300042602 | Ga0466713_113804 | Ga0466713_113804_8706_9914 | 402 |
| 149 | 3300042605 | Ga0466716_033455 | Ga0466716_033455_1254_2462 | 402 |
| 150 | 3300042606 | Ga0466719_035461 | Ga0466719_035461_663_1871 | 402 |
| 151 | 3300042606 | Ga0466719_102777 | Ga0466719_102777_914_2122 | 402 |
| 152 | 3300042606 | Ga0466719_135195 | Ga0466719_135195_518_1726 | 402 |
| 153 | 3300042606 | Ga0466719_497203 | Ga0466719_497203_15419_16627 | 402 |
| 154 | 3300042609 | Ga0466722_023479 | Ga0466722_023479_96879_98087 | 402 |
| 155 | 3300042609 | Ga0466722_110233 | Ga0466722_110233_26953_28161 | 402 |
| 156 | 3300042609 | Ga0466722_149423 | Ga0466722_149423_10494_11702 | 402 |
| 157 | 3300042611 | Ga0466697_056567 | Ga0466697_056567_80690_81898 | 402 |
| 158 | 3300042612 | Ga0466705_032521 | Ga0466705_032521_2188_3396 | 402 |
| 159 | 3300042615 | Ga0466711_011148 | Ga0466711_011148_2051_3259 | 402 |
| 160 | 3300042615 | Ga0466711_052513 | Ga0466711_052513_4996_6204 | 402 |
| 161 | 3300042615 | Ga0466711_239482 | Ga0466711_239482_194_1402 | 402 |
| 162 | 3300042615 | Ga0466711_505647 | Ga0466711_505647_751_1959 | 402 |
| 163 | 3300042616 | Ga0466715_081681 | Ga0466715_081681_386_1594 | 402 |
| 164 | 3300042616 | Ga0466715_168192 | Ga0466715_168192_26146_27354 | 402 |
| 165 | 3300042616 | Ga0466715_231121 | Ga0466715_231121_24079_25287 | 402 |
| 166 | 3300042616 | Ga0466715_376224 | Ga0466715_376224_8402_9610 | 402 |
| 167 | 3300042618 | Ga0466723_028187 | Ga0466723_028187_8618_9826 | 402 |
| 168 | 3300042620 | Ga0466728_259710 | Ga0466728_259710_2093_3301 | 402 |
| 169 | 3300042621 | Ga0466729_050488 | Ga0466729_050488_1271_2479 | 402 |
| 170 | 3300042624 | Ga0466735_011617 | Ga0466735_011617_190_1398 | 402 |
| 171 | 3300042624 | Ga0466735_064598 | Ga0466735_064598_464_1672 | 402 |
| 172 | 3300042624 | Ga0466735_152601 | Ga0466735_152601_828_2036 | 402 |
| 173 | 3300042624 | Ga0466735_180342 | Ga0466735_180342_1023_2231 | 402 |
| 174 | 3300042624 | Ga0466735_196434 | Ga0466735_196434_112_1320 | 402 |
| 175 | 3300042636 | Ga0466703_046369 | Ga0466703_046369_723_1931 | 402 |
| 176 | 3300042636 | Ga0466703_104988 | Ga0466703_104988_5410_6618 | 402 |
| 177 | 3300042636 | Ga0466703_172335 | Ga0466703_172335_30_1238 | 402 |
| 178 | 3300042636 | Ga0466703_187848 | Ga0466703_187848_13337_14545 | 402 |
| 179 | 3300042636 | Ga0466703_239628 | Ga0466703_239628_513_1721 | 402 |
| 180 | 3300042636 | Ga0466703_413955 | Ga0466703_413955_70_1278 | 402 |
| 181 | 3300042643 | Ga0466704_492877 | Ga0466704_492877_868_2076 | 402 |
| 182 | 3300042648 | Ga0466709_015483 | Ga0466709_015483_11789_12997 | 402 |
| 183 | 3300042648 | Ga0466709_143143 | Ga0466709_143143_4017_5225 | 402 |
| 184 | 3300042652 | Ga0466708_178346 | Ga0466708_178346_3442_4650 | 402 |
| 185 | 3300042655 | Ga0466727_027649 | Ga0466727_027649_843_2051 | 402 |
| 186 | 3300042655 | Ga0466727_113322 | Ga0466727_113322_14423_15631 | 402 |
| 187 | 3300042655 | Ga0466727_127654 | Ga0466727_127654_2150_3358 | 402 |
| 188 | iso_pr_bacteria | 2820778767 | 2820779968 | 402 |
| 189 | iso_pr_bacteria | 643348524 | 643422953 | 402 |
| 190 | iso_pr_bacteria | 8065497608 | 8065500550 | 402 |
| 191 | 3300000062 | IMNBL1DRAFT_c0001938 | IMNBL1DRAFT_00019383 | 403 |
| 192 | 3300000062 | IMNBL1DRAFT_c0002854 | IMNBL1DRAFT_00028545 | 403 |
| 193 | 3300000062 | IMNBL1DRAFT_c0003670 | IMNBL1DRAFT_00036709 | 403 |
| 194 | 3300000062 | IMNBL1DRAFT_c0022593 | IMNBL1DRAFT_00225935 | 403 |
| 195 | 3300009784 | Ga0123357_10001231 | Ga0123357_100012317 | 403 |
| 196 | 3300009784 | Ga0123357_10001302 | Ga0123357_1000130211 | 403 |
| 197 | 3300009784 | Ga0123357_10008343 | Ga0123357_100083432 | 403 |
| 198 | 3300009784 | Ga0123357_10012959 | Ga0123357_100129591 | 403 |
| 199 | 3300010882 | Ga0123354_10000098 | Ga0123354_100000986 | 403 |
| 200 | 3300010882 | Ga0123354_10224880 | Ga0123354_102248802 | 403 |
| 201 | 3300042601 | Ga0466707_252281 | Ga0466707_252281_29786_30997 | 403 |
| 202 | 3300042609 | Ga0466722_177930 | Ga0466722_177930_58_1269 | 403 |
| 203 | 3300042612 | Ga0466705_415571 | Ga0466705_415571_6175_7386 | 403 |
| 204 | 3300042618 | Ga0466723_103710 | Ga0466723_103710_12667_13878 | 403 |
| 205 | 3300042624 | Ga0466735_023009 | Ga0466735_023009_1239_2450 | 403 |
| 206 | iso_pr_bacteria | 2820759988 | 2820760430 | 403 |
| 207 | iso_pr_bacteria | 2940216256 | 2940217024 | 403 |
| 208 | 3300005071 | Ga0068302_10022774 | Ga0068302_100227742 | 404 |
| 209 | 3300042601 | Ga0466707_075455 | Ga0466707_075455_3803_5017 | 404 |
| 210 | 3300042659 | Ga0466733_190167 | Ga0466733_190167_4650_5897 | 404 |
| 211 | 3300042600 | Ga0466700_002018 | Ga0466700_002018_733_1953 | 406 |
| 212 | 3300042654 | Ga0466725_468350 | Ga0466725_468350_124_1347 | 407 |
| 213 | 3300042603 | Ga0466714_016409 | Ga0466714_016409_195_1421 | 408 |
| 214 | 3300042601 | Ga0466707_365185 | Ga0466707_365185_3281_4510 | 409 |
| 215 | 3300042591 | Ga0466692_066865 | Ga0466692_066865_43469_44701 | 410 |
| 216 | 3300042624 | Ga0466735_129196 | Ga0466735_129196_3456_4688 | 410 |
| 217 | 3300042655 | Ga0466727_332703 | Ga0466727_332703_108_1340 | 410 |
| 218 | 3300042659 | Ga0466733_010510 | Ga0466733_010510_11262_12500 | 412 |
| 219 | 3300042643 | Ga0466704_407929 | Ga0466704_407929_2092_3339 | 415 |
| 220 | 2225789004 | 2227255808 | 2227700435 | 417 |
| 221 | 3300010049 | Ga0123356_10007592 | Ga0123356_1000759210 | 417 |
| 222 | 3300042598 | Ga0466701_038531 | Ga0466701_038531_912_2165 | 417 |
| 223 | 3300042612 | Ga0466705_241963 | Ga0466705_241963_1034_2287 | 417 |
| 224 | 3300042612 | Ga0466705_043486 | Ga0466705_043486_8123_9379 | 418 |
| 225 | 3300042643 | Ga0466704_204908 | Ga0466704_204908_13684_14943 | 419 |
| 226 | iso_pr_bacteria | 2940209341 | 2940209348 | 427 |
| 227 | 3300042643 | Ga0466704_564931 | Ga0466704_564931_37805_39109 | 434 |
| 228 | 3300042590 | Ga0466690_162531 | Ga0466690_162531_14363_15670 | 435 |
| 229 | 3300042596 | Ga0466696_036786 | Ga0466696_036786_20015_21460 | 481 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.92 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.