Protein Family IF06104
Metagenome
Isolate
111
Members
44
Samples
108
Scaffolds
194.32
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_094343|Ga0466713_094343_859_1449
- Length
- 196 aa
- Sequence
- MSLKVKEIFYSLQGEGGRQGEASIFIRLSGCNFKCPFCDTDFSGGDEMTPEAILQTIRAFSCRWIIWTGGEPTLQLTDAILQFFKQAGYRQAIESNGRQRLSALLDYTVVSPKLQYGEDYALRCNPRVDEVRLPIQAGQQIPDIQIFPLAQYYFLSPVFEESLQNTKRNIDYCIEHIMQHPRWRLSVQLHKLVGMK
Sample Types
Isolate
2.7%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.9%
Kalotermitidae
30.2%
Unclassified
11.6%
Rhinotermitidae
7.0%
Termopsidae
7.0%
Passalidae
4.7%
Hodotermitidae
2.3%
Blattidae
2.3%
Taxonomy
Archaea
1
Bacteria
97
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 3 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 4 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 23 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 24 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 29 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 30 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 31 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 39 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_285670 | 3300042612 | Bacteria | 11403 |
| 2 | Ga0466735_110580 | 3300042624 | Bacteria | 1366 |
| 3 | Ga0466704_033639 | 3300042643 | Bacteria | 2388 |
| 4 | Ga0466727_041042 | 3300042655 | Bacteria | 9323 |
| 5 | Ga0466692_001103 | 3300042591 | Bacteria | 29670 |
| 6 | Ga0466692_023608 | 3300042591 | Bacteria | 56587 |
| 7 | Ga0466701_002767 | 3300042598 | Bacteria | 1804 |
| 8 | Ga0123356_10560644 | 3300010049 | Bacteria | 1304 |
| 9 | Ga0123353_10691126 | 3300010167 | Bacteria | 1434 |
| 10 | Ga0466706_028935 | 3300042599 | Bacteria | 40791 |
| 11 | Ga0466707_043579 | 3300042601 | Bacteria | 21754 |
| 12 | Ga0466713_094343 | 3300042602 | Bacteria | 28200 |
| 13 | Ga0466719_291253 | 3300042606 | Unclassified | 1983 |
| 14 | Ga0466697_020630 | 3300042611 | Bacteria | 2653 |
| 15 | 2227611022 | 2225789004 | Bacteria | 2261 |
| 16 | IMNBL1DRAFT_c0000378 | 3300000062 | Bacteria | 38118 |
| 17 | Ga0466703_142844 | 3300042636 | Bacteria | 24403 |
| 18 | Ga0466703_206270 | 3300042636 | Bacteria | 10450 |
| 19 | Ga0123357_10030404 | 3300009784 | Bacteria | 7320 |
| 20 | Ga0123357_10430952 | 3300009784 | Bacteria | 1165 |
| 21 | Ga0123357_10749256 | 3300009784 | Bacteria | 680 |
| 22 | Ga0123356_11854361 | 3300010049 | Bacteria | 750 |
| 23 | Ga0466707_049922 | 3300042601 | Bacteria | 8653 |
| 24 | Ga0466707_229962 | 3300042601 | Bacteria | 21198 |
| 25 | Ga0466721_208826 | 3300042608 | Unclassified | 1321 |
| 26 | Ga0466722_052506 | 3300042609 | Bacteria | 8388 |
| 27 | Ga0466698_146181 | 3300042610 | Bacteria | 1384 |
| 28 | Ga0466698_389347 | 3300042610 | Bacteria | 1594 |
| 29 | 2227494869 | 2225789004 | Unclassified | 770 |
| 30 | JGI24699J35502_11117858 | 3300002509 | Bacteria | 3058 |
| 31 | Ga0068305_10154915 | 3300005083 | Bacteria | 9014 |
| 32 | Ga0466705_269196 | 3300042612 | Unclassified | 1190 |
| 33 | Ga0466711_067522 | 3300042615 | Bacteria | 13065 |
| 34 | Ga0466711_180821 | 3300042615 | Bacteria | 1083 |
| 35 | Ga0466726_285482 | 3300042619 | Unclassified | 1252 |
| 36 | Ga0466703_058349 | 3300042636 | Bacteria | 2756 |
| 37 | Ga0466708_069111 | 3300042652 | Bacteria | 9957 |
| 38 | Ga0123356_10165946 | 3300010049 | Bacteria | 2212 |
| 39 | Ga0466707_286272 | 3300042601 | Bacteria | 22213 |
| 40 | 2227175245 | 2225789004 | Bacteria | 8150 |
| 41 | IMNBL1DRAFT_c0002749 | 3300000062 | Bacteria | 11956 |
| 42 | JGI24699J35502_11133981 | 3300002509 | Bacteria | 22510 |
| 43 | Ga0466705_171942 | 3300042612 | Bacteria | 3540 |
| 44 | Ga0466733_151782 | 3300042659 | Bacteria | 38867 |
| 45 | Ga0466711_414115 | 3300042615 | Bacteria | 1330 |
| 46 | Ga0466726_147809 | 3300042619 | Bacteria | 13302 |
| 47 | Ga0466735_033307 | 3300042624 | Bacteria | 1578 |
| 48 | Ga0466735_198133 | 3300042624 | Bacteria | 1490 |
| 49 | Ga0466703_104304 | 3300042636 | Unclassified | 2617 |
| 50 | Ga0466704_339221 | 3300042643 | Bacteria | 6084 |
| 51 | Ga0466727_254373 | 3300042655 | Bacteria | 6810 |
| 52 | Ga0466690_039406 | 3300042590 | Bacteria | 20122 |
| 53 | Ga0123353_10821870 | 3300010167 | Bacteria | 1279 |
| 54 | Ga0466701_102589 | 3300042598 | Bacteria | 16726 |
| 55 | Ga0466700_171123 | 3300042600 | Bacteria | 10801 |
| 56 | Ga0466707_404532 | 3300042601 | Bacteria | 3556 |
| 57 | Ga0466713_000548 | 3300042602 | Bacteria | 3463 |
| 58 | Ga0466719_219545 | 3300042606 | Bacteria | 7205 |
| 59 | JGI24705J35276_12211676 | 3300002504 | Unclassified | 1863 |
| 60 | JGI24699J35502_11133933 | 3300002509 | Bacteria | 19996 |
| 61 | Ga0466711_506918 | 3300042615 | Bacteria | 9365 |
| 62 | Ga0466715_070660 | 3300042616 | Bacteria | 9155 |
| 63 | Ga0466731_329290 | 3300042622 | Unclassified | 1170 |
| 64 | Ga0466704_543094 | 3300042643 | Bacteria | 8025 |
| 65 | Ga0466727_167127 | 3300042655 | Bacteria | 3449 |
| 66 | Ga0466727_173858 | 3300042655 | Bacteria | 64235 |
| 67 | Ga0466691_195596 | 3300042593 | Bacteria | 68522 |
| 68 | Ga0466694_215952 | 3300042594 | Bacteria | 3015 |
| 69 | Ga0123357_10197865 | 3300009784 | Bacteria | 2296 |
| 70 | Ga0123353_10490316 | 3300010167 | Bacteria | 1794 |
| 71 | Ga0466719_221878 | 3300042606 | Bacteria | 1757 |
| 72 | Ga0466722_132870 | 3300042609 | Bacteria | 22775 |
| 73 | Ga0466722_197440 | 3300042609 | Bacteria | 36283 |
| 74 | IMNBL1DRAFT_c0019853 | 3300000062 | Unclassified | 2739 |
| 75 | Ga0466705_122802 | 3300042612 | Bacteria | 4581 |
| 76 | Ga0466715_031058 | 3300042616 | Bacteria | 18036 |
| 77 | Ga0466735_091112 | 3300042624 | Bacteria | 2146 |
| 78 | Ga0466703_134817 | 3300042636 | Bacteria | 1215 |
| 79 | Ga0466709_275974 | 3300042648 | Bacteria | 6582 |
| 80 | Ga0466727_268437 | 3300042655 | Bacteria | 7860 |
| 81 | Ga0466696_156506 | 3300042596 | Bacteria | 11427 |
| 82 | Ga0123357_10034714 | 3300009784 | Bacteria | 6857 |
| 83 | Ga0123356_10726632 | 3300010049 | Unclassified | 1163 |
| 84 | Ga0123353_10864405 | 3300010167 | Archaea | 1237 |
| 85 | Ga0123353_10933363 | 3300010167 | Unclassified | 1176 |
| 86 | Ga0123354_10568519 | 3300010882 | Bacteria | 846 |
| 87 | Ga0466700_042032 | 3300042600 | Bacteria | 28290 |
| 88 | Ga0466716_024644 | 3300042605 | Bacteria | 13405 |
| 89 | Ga0466722_061682 | 3300042609 | Bacteria | 7102 |
| 90 | JGI24699J35502_11133955 | 3300002509 | Bacteria | 21167 |
| 91 | Ga0072941_1142408 | 3300005201 | Bacteria | 1826 |
| 92 | Ga0466728_446108 | 3300042620 | Bacteria | 9754 |
| 93 | Ga0466734_063961 | 3300042623 | Bacteria | 1283 |
| 94 | Ga0466735_055931 | 3300042624 | Bacteria | 6840 |
| 95 | Ga0466735_105390 | 3300042624 | Unclassified | 1177 |
| 96 | Ga0466703_331730 | 3300042636 | Bacteria | 2034 |
| 97 | Ga0466709_115025 | 3300042648 | Bacteria | 26433 |
| 98 | Ga0123356_10008114 | 3300010049 | Bacteria | 10459 |
| 99 | Ga0123356_10331187 | 3300010049 | Bacteria | 1639 |
| 100 | Ga0123353_11625858 | 3300010167 | Unclassified | 814 |
| 101 | Ga0466706_174920 | 3300042599 | Bacteria | 12699 |
| 102 | Ga0466700_156051 | 3300042600 | Bacteria | 11233 |
| 103 | Ga0466719_545997 | 3300042606 | Bacteria | 4165 |
| 104 | Ga0466729_185141 | 3300042621 | Bacteria | 6724 |
| 105 | Ga0466703_017024 | 3300042636 | Bacteria | 4840 |
| 106 | Ga0466703_022363 | 3300042636 | Bacteria | 6961 |
| 107 | Ga0466707_228190 | 3300042601 | Bacteria | 1433 |
| 108 | Ga0466713_048749 | 3300042602 | Bacteria | 15078 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042606 | Ga0466719_221878 | Ga0466719_221878_13_564 | 183 |
| 2 | 3300042643 | Ga0466704_033639 | Ga0466704_033639_1304_1888 | 185 |
| 3 | 3300042602 | Ga0466713_000548 | Ga0466713_000548_350_925 | 191 |
| 4 | 3300042624 | Ga0466735_055931 | Ga0466735_055931_1089_1667 | 192 |
| 5 | 2225789004 | 2227175245 | 2227590927 | 194 |
| 6 | 2225789004 | 2227494869 | 2227971103 | 194 |
| 7 | 2225789004 | 2227611022 | 2228182971 | 194 |
| 8 | 3300042590 | Ga0466690_039406 | Ga0466690_039406_13239_13823 | 194 |
| 9 | 3300042591 | Ga0466692_001103 | Ga0466692_001103_22378_22962 | 194 |
| 10 | 3300042591 | Ga0466692_023608 | Ga0466692_023608_23704_24288 | 194 |
| 11 | 3300042593 | Ga0466691_195596 | Ga0466691_195596_34416_35000 | 194 |
| 12 | 3300042594 | Ga0466694_215952 | Ga0466694_215952_1737_2321 | 194 |
| 13 | 3300042596 | Ga0466696_156506 | Ga0466696_156506_10187_10771 | 194 |
| 14 | 3300042598 | Ga0466701_002767 | Ga0466701_002767_904_1488 | 194 |
| 15 | 3300042598 | Ga0466701_102589 | Ga0466701_102589_14575_15159 | 194 |
| 16 | 3300042599 | Ga0466706_174920 | Ga0466706_174920_6551_7135 | 194 |
| 17 | 3300042600 | Ga0466700_042032 | Ga0466700_042032_11744_12328 | 194 |
| 18 | 3300042600 | Ga0466700_156051 | Ga0466700_156051_6587_7171 | 194 |
| 19 | 3300042600 | Ga0466700_171123 | Ga0466700_171123_1696_2280 | 194 |
| 20 | 3300042601 | Ga0466707_043579 | Ga0466707_043579_3841_4425 | 194 |
| 21 | 3300042601 | Ga0466707_049922 | Ga0466707_049922_3185_3769 | 194 |
| 22 | 3300042601 | Ga0466707_228190 | Ga0466707_228190_562_1146 | 194 |
| 23 | 3300042601 | Ga0466707_229962 | Ga0466707_229962_10703_11287 | 194 |
| 24 | 3300042601 | Ga0466707_286272 | Ga0466707_286272_10965_11549 | 194 |
| 25 | 3300042601 | Ga0466707_404532 | Ga0466707_404532_942_1526 | 194 |
| 26 | 3300042605 | Ga0466716_024644 | Ga0466716_024644_6272_6856 | 194 |
| 27 | 3300042606 | Ga0466719_219545 | Ga0466719_219545_1768_2352 | 194 |
| 28 | 3300042606 | Ga0466719_291253 | Ga0466719_291253_48_632 | 194 |
| 29 | 3300042606 | Ga0466719_545997 | Ga0466719_545997_345_929 | 194 |
| 30 | 3300042608 | Ga0466721_208826 | Ga0466721_208826_30_614 | 194 |
| 31 | 3300042609 | Ga0466722_052506 | Ga0466722_052506_5045_5629 | 194 |
| 32 | 3300042609 | Ga0466722_061682 | Ga0466722_061682_5689_6273 | 194 |
| 33 | 3300042609 | Ga0466722_132870 | Ga0466722_132870_8177_8761 | 194 |
| 34 | 3300042609 | Ga0466722_197440 | Ga0466722_197440_7097_7681 | 194 |
| 35 | 3300042610 | Ga0466698_146181 | Ga0466698_146181_331_915 | 194 |
| 36 | 3300042610 | Ga0466698_389347 | Ga0466698_389347_85_669 | 194 |
| 37 | 3300042611 | Ga0466697_020630 | Ga0466697_020630_1504_2088 | 194 |
| 38 | 3300042612 | Ga0466705_122802 | Ga0466705_122802_3073_3657 | 194 |
| 39 | 3300042612 | Ga0466705_171942 | Ga0466705_171942_465_1049 | 194 |
| 40 | 3300042612 | Ga0466705_269196 | Ga0466705_269196_554_1138 | 194 |
| 41 | 3300042612 | Ga0466705_285670 | Ga0466705_285670_3957_4541 | 194 |
| 42 | 3300042615 | Ga0466711_067522 | Ga0466711_067522_7372_7956 | 194 |
| 43 | 3300042615 | Ga0466711_180821 | Ga0466711_180821_217_801 | 194 |
| 44 | 3300042615 | Ga0466711_414115 | Ga0466711_414115_512_1096 | 194 |
| 45 | 3300042615 | Ga0466711_506918 | Ga0466711_506918_2554_3138 | 194 |
| 46 | 3300042616 | Ga0466715_031058 | Ga0466715_031058_5868_6452 | 194 |
| 47 | 3300042616 | Ga0466715_070660 | Ga0466715_070660_8255_8839 | 194 |
| 48 | 3300042619 | Ga0466726_147809 | Ga0466726_147809_7568_8152 | 194 |
| 49 | 3300042619 | Ga0466726_285482 | Ga0466726_285482_66_650 | 194 |
| 50 | 3300042620 | Ga0466728_446108 | Ga0466728_446108_8624_9208 | 194 |
| 51 | 3300042621 | Ga0466729_185141 | Ga0466729_185141_582_1166 | 194 |
| 52 | 3300042622 | Ga0466731_329290 | Ga0466731_329290_420_1004 | 194 |
| 53 | 3300042623 | Ga0466734_063961 | Ga0466734_063961_54_638 | 194 |
| 54 | 3300042624 | Ga0466735_033307 | Ga0466735_033307_128_712 | 194 |
| 55 | 3300042624 | Ga0466735_091112 | Ga0466735_091112_300_884 | 194 |
| 56 | 3300042624 | Ga0466735_105390 | Ga0466735_105390_106_690 | 194 |
| 57 | 3300042624 | Ga0466735_110580 | Ga0466735_110580_691_1275 | 194 |
| 58 | 3300042624 | Ga0466735_198133 | Ga0466735_198133_534_1118 | 194 |
| 59 | 3300042636 | Ga0466703_017024 | Ga0466703_017024_275_859 | 194 |
| 60 | 3300042636 | Ga0466703_022363 | Ga0466703_022363_5127_5711 | 194 |
| 61 | 3300042636 | Ga0466703_058349 | Ga0466703_058349_1424_2008 | 194 |
| 62 | 3300042636 | Ga0466703_104304 | Ga0466703_104304_1015_1599 | 194 |
| 63 | 3300042636 | Ga0466703_134817 | Ga0466703_134817_560_1144 | 194 |
| 64 | 3300042636 | Ga0466703_142844 | Ga0466703_142844_19321_19905 | 194 |
| 65 | 3300042636 | Ga0466703_206270 | Ga0466703_206270_4418_5002 | 194 |
| 66 | 3300042636 | Ga0466703_331730 | Ga0466703_331730_1052_1636 | 194 |
| 67 | 3300042643 | Ga0466704_339221 | Ga0466704_339221_753_1337 | 194 |
| 68 | 3300042643 | Ga0466704_543094 | Ga0466704_543094_687_1271 | 194 |
| 69 | 3300042648 | Ga0466709_115025 | Ga0466709_115025_1152_1736 | 194 |
| 70 | 3300042648 | Ga0466709_275974 | Ga0466709_275974_3974_4558 | 194 |
| 71 | 3300042652 | Ga0466708_069111 | Ga0466708_069111_2188_2772 | 194 |
| 72 | 3300042655 | Ga0466727_041042 | Ga0466727_041042_7077_7661 | 194 |
| 73 | 3300042655 | Ga0466727_167127 | Ga0466727_167127_2743_3327 | 194 |
| 74 | 3300042655 | Ga0466727_173858 | Ga0466727_173858_2978_3562 | 194 |
| 75 | 3300042655 | Ga0466727_254373 | Ga0466727_254373_5100_5684 | 194 |
| 76 | 3300042655 | Ga0466727_268437 | Ga0466727_268437_40_624 | 194 |
| 77 | 3300042659 | Ga0466733_151782 | Ga0466733_151782_30765_31349 | 194 |
| 78 | iso_pr_bacteria | 2820759988 | 2820761282 | 194 |
| 79 | iso_pr_bacteria | 2820762746 | 2820763585 | 194 |
| 80 | iso_pr_bacteria | 2940216256 | 2940217651 | 194 |
| 81 | 3300000062 | IMNBL1DRAFT_c0000378 | IMNBL1DRAFT_000037814 | 195 |
| 82 | 3300000062 | IMNBL1DRAFT_c0002749 | IMNBL1DRAFT_00027493 | 195 |
| 83 | 3300000062 | IMNBL1DRAFT_c0019853 | IMNBL1DRAFT_00198533 | 195 |
| 84 | 3300002504 | JGI24705J35276_12211676 | JGI24705J35276_122116764 | 195 |
| 85 | 3300002509 | JGI24699J35502_11117858 | JGI24699J35502_111178581 | 195 |
| 86 | 3300002509 | JGI24699J35502_11133933 | JGI24699J35502_1113393314 | 195 |
| 87 | 3300002509 | JGI24699J35502_11133955 | JGI24699J35502_111339558 | 195 |
| 88 | 3300005201 | Ga0072941_1142408 | Ga0072941_11424083 | 195 |
| 89 | 3300009784 | Ga0123357_10030404 | Ga0123357_100304046 | 195 |
| 90 | 3300009784 | Ga0123357_10034714 | Ga0123357_100347145 | 195 |
| 91 | 3300009784 | Ga0123357_10430952 | Ga0123357_104309522 | 195 |
| 92 | 3300009784 | Ga0123357_10749256 | Ga0123357_107492561 | 195 |
| 93 | 3300010049 | Ga0123356_10008114 | Ga0123356_1000811411 | 195 |
| 94 | 3300010049 | Ga0123356_10165946 | Ga0123356_101659462 | 195 |
| 95 | 3300010049 | Ga0123356_10331187 | Ga0123356_103311872 | 195 |
| 96 | 3300010049 | Ga0123356_10560644 | Ga0123356_105606443 | 195 |
| 97 | 3300010049 | Ga0123356_10726632 | Ga0123356_107266321 | 195 |
| 98 | 3300010049 | Ga0123356_11854361 | Ga0123356_118543611 | 195 |
| 99 | 3300010167 | Ga0123353_10490316 | Ga0123353_104903164 | 195 |
| 100 | 3300010167 | Ga0123353_10691126 | Ga0123353_106911262 | 195 |
| 101 | 3300010167 | Ga0123353_10821870 | Ga0123353_108218702 | 195 |
| 102 | 3300010167 | Ga0123353_10864405 | Ga0123353_108644053 | 195 |
| 103 | 3300010167 | Ga0123353_10933363 | Ga0123353_109333632 | 195 |
| 104 | 3300010167 | Ga0123353_11625858 | Ga0123353_116258582 | 195 |
| 105 | 3300010882 | Ga0123354_10568519 | Ga0123354_105685191 | 195 |
| 106 | 3300042599 | Ga0466706_028935 | Ga0466706_028935_20164_20754 | 196 |
| 107 | 3300042602 | Ga0466713_094343 | Ga0466713_094343_859_1449 | 196 |
| 108 | 3300005083 | Ga0068305_10154915 | Ga0068305_101549152 | 197 |
| 109 | 3300009784 | Ga0123357_10197865 | Ga0123357_101978653 | 199 |
| 110 | 3300042602 | Ga0466713_048749 | Ga0466713_048749_10913_11521 | 202 |
| 111 | 3300002509 | JGI24699J35502_11133981 | JGI24699J35502_1113398113 | 209 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04055 | Radical_SAM | Radical SAM superfamily | 29 | 119 | 0.83 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.87 | 0.87 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.