Protein Family IF06091

Metagenome Isolate
193 Members
119 Samples
133 Scaffolds
288.77 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_073699|Ga0466713_073699_15_968
Length
317 aa
Sequence
MNDNEVVVLSAAKDLTGQTKDPAATMPLTPRRKPKKPAKTIGQILLYLALALFSAFLLLPFFWMISSSLKPDNEVFTIPIKWIPETFRWSNYVDIWTVQVTQQASNMSIWLKNTLILAVTVTALQLFTGSFAAYGFARIRFPGRDLLFLAYIATIAVPWQAYMIPQYKMFSMLGLTDTLWSIIILQAFGAFGVFLMKQFYETIPEELSESARLDGLSEYGIYRRIMLPLSVPALASLGLLTFVNTWNDFLGPRLYLRTPPHFTIQVGLKVFQADALGSSLYGLMFAGAVISVLPIAIIFMAGQRYFVEGIATSGMKG

📊 Sample Types

Isolate 31.1%
Metagenome 68.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 26.1%
Termitidae 19.8%
Apidae 14.4%
Kalotermitidae 10.8%
Culicidae 5.4%
Scarabaeidae 4.5%
Tenebrionidae 3.6%
Armadillidiidae 2.7%
Blattidae 2.7%
Rhinotermitidae 2.7%
Formicidae 1.8%
Termopsidae 1.8%
Pyralidae 0.9%
Hydrophilidae 0.9%
Bombycidae 0.9%
Hodotermitidae 0.9%

🌳 Taxonomy

Archaea 1
Bacteria 186
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114555646 Enterococcus sp. DIV1094 Isolate
2 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
3 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
4 2802429577 Bifidobacterium indicum DSM 20214 Isolate Unclassified
5 2627853628 Melissococcus plutonius 82 Isolate Apidae
6 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
7 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
8 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
9 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
10 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
11 2595698198 Melissococcus plutonius L9 Isolate Apidae
12 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
13 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
14 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
15 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
16 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
17 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
18 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
19 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
20 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
21 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
22 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
23 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
24 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
25 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
26 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
27 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
28 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
29 2595698195 Melissococcus plutonius 119 Isolate Apidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
32 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
33 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
34 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
35 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
36 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
37 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
38 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
39 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
40 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
41 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
42 2597490194 Bifidobacterium coryneforme LMG 18911 Isolate Apidae
43 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
44 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
45 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
46 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
47 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
48 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
49 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
50 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
51 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
52 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
53 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
54 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
55 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
56 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
57 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
58 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
59 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
60 2595698199 Melissococcus plutonius 60 Isolate Apidae
61 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
62 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
63 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
64 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
65 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
66 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
67 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
68 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
69 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
70 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
71 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
72 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
73 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
74 2595698197 Melissococcus plutonius H6 Isolate Apidae
75 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
76 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
77 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
78 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
79 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
80 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
81 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
82 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
83 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
84 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
85 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
86 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
87 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
88 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
89 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
90 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
91 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
92 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
93 2660238275 Bifidobacterium indicum DSM 20214 Isolate Unclassified
94 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
95 2684622917 Bifidobacterium coryneforme Bi_197 Isolate Unclassified
96 2693429521 Bifidobacterium coryneforme DSM 20216 Isolate Unclassified
97 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
98 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
99 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
100 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
101 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
102 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
103 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
104 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
105 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
106 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
107 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
108 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
109 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
110 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
111 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
112 8032009961 Bifidobacterium indicum ESL0197 Isolate Apidae
113 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
114 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
115 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
116 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
117 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
118 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
119 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_118672 3300042659 Bacteria 22532
2 Ga0466726_398604 3300042619 Bacteria 1771
3 Ga0466729_173722 3300042621 Bacteria 1278
4 Ga0466706_209135 3300042599 Bacteria 7136
5 Ga0466717_239473 3300042604 Bacteria 6914
6 Ga0466719_554266 3300042606 Bacteria 26183
7 Ga0466725_464216 3300042654 Bacteria 3924
8 Ga0123357_10003720 3300009784 Bacteria 17618
9 Ga0123357_10018055 3300009784 Bacteria 9368
10 Ga0123356_10746945 3300010049 Bacteria 1148
11 Ga0123353_10991858 3300010167 Bacteria 1130
12 Ga0160430_101789 3300012852 Bacteria 7525
13 Ga0466696_367274 3300042596 Bacteria 3862
14 JGI24703J35330_11747998 3300002501 Archaea 9756
15 JGI24705J35276_12225614 3300002504 Unclassified 2744
16 Ga0466733_117310 3300042659 Bacteria 18714
17 Ga0466729_169695 3300042621 Bacteria 14289
18 Ga0466706_103556 3300042599 Bacteria 2124
19 Ga0466706_239508 3300042599 Bacteria 58799
20 Ga0466707_072993 3300042601 Bacteria 64242
21 Ga0466716_328546 3300042605 Bacteria 2345
22 Ga0466719_555520 3300042606 Bacteria 3333
23 Ga0466722_054280 3300042609 Bacteria 2349
24 Ga0123357_10083835 3300009784 Bacteria 4181
25 Ga0123355_10000409 3300009826 Bacteria 55870
26 Ga0123356_10000010 3300010049 Bacteria 220063
27 Ga0123356_10030922 3300010049 Bacteria 5010
28 Ga0123356_10033639 3300010049 Bacteria 4794
29 Ga0123353_10656424 3300010167 Bacteria 1484
30 Ga0160445_103689 3300012847 Bacteria 2998
31 Ga0160436_1000059 3300012861 Bacteria 59959
32 JGI24695J34938_10020765 3300002450 Bacteria 3226
33 JGI24699J35502_11051298 3300002509 Bacteria 1654
34 Ga0466705_244887 3300042612 Bacteria 4182
35 Ga0562375_0062 3300056856 Bacteria 424406
36 Ga0466728_308270 3300042620 Bacteria 16503
37 Ga0466714_144747 3300042603 Bacteria 6543
38 Ga0466730_000393 3300042625 Bacteria 1156
39 Ga0466703_426558 3300042636 Bacteria 3302
40 Ga0123357_10126614 3300009784 Bacteria 3197
41 Ga0123353_10018993 3300010167 Bacteria 10198
42 Ga0123354_10055617 3300010882 Bacteria 5918
43 Ga0466690_260168 3300042590 Bacteria 1132
44 Ga0072941_1168593 3300005201 Bacteria 10206
45 Ga0562375_0054 3300056856 Bacteria 456645
46 Ga0466723_077145 3300042618 Bacteria 54484
47 Ga0466726_296929 3300042619 Bacteria 2283
48 Ga0466726_311250 3300042619 Bacteria 2527
49 Ga0466700_396302 3300042600 Bacteria 7445
50 Ga0466719_228736 3300042606 Bacteria 92829
51 Ga0466704_412729 3300042643 Bacteria 61439
52 Ga0466725_467554 3300042654 Bacteria 18328
53 Ga0466727_245978 3300042655 Bacteria 7486
54 Ga0123357_10029577 3300009784 Bacteria 7423
55 Ga0123355_10529010 3300009826 Bacteria 1438
56 Ga0123353_10000060 3300010167 Bacteria 123051
57 Ga0123354_10000253 3300010882 Bacteria 47997
58 Ga0160442_100518 3300012806 Bacteria 8926
59 Ga0160446_100148 3300012835 Bacteria 56660
60 Ga0160460_101041 3300012845 Bacteria 11242
61 Ga0160434_100007 3300012850 Bacteria 314941
62 JGI24698J34947_10009067 3300002449 Bacteria 5458
63 Ga0466733_042229 3300042659 Bacteria 24292
64 Ga0562378_0103 3300056814 Bacteria 223931
65 Ga0466723_154196 3300042618 Bacteria 18223
66 Ga0466706_219053 3300042599 Bacteria 1515
67 Ga0466713_035511 3300042602 Bacteria 4423
68 Ga0466703_411922 3300042636 Bacteria 3694
69 Ga0123355_10005986 3300009826 Bacteria 17935
70 Ga0123353_10338956 3300010167 Bacteria 2272
71 Ga0160452_100265 3300012834 Bacteria 50112
72 Ga0160445_102316 3300012847 Bacteria 4472
73 Ga0160443_100221 3300012848 Bacteria 69197
74 Ga0466691_024900 3300042593 Bacteria 9069
75 JGI24703J35330_11747988 3300002501 Bacteria 9677
76 JGI24705J35276_12193992 3300002504 Unclassified 1506
77 CVPL010L_1001027 3300002932 Unclassified 6722
78 Ga0072940_1049611 3300005200 Bacteria 7187
79 Ga0072940_1399281 3300005200 Bacteria 1097
80 Ga0466705_322911 3300042612 Unclassified 3044
81 Ga0466705_451134 3300042612 Bacteria 6942
82 Ga0466711_201079 3300042615 Bacteria 18389
83 Ga0466726_211605 3300042619 Bacteria 1554
84 Ga0466728_104307 3300042620 Bacteria 1649
85 Ga0466713_039454 3300042602 Bacteria 10704
86 Ga0466714_006450 3300042603 Bacteria 4444
87 Ga0466719_243853 3300042606 Bacteria 6014
88 Ga0466704_069847 3300042643 Bacteria 3659
89 Ga0466709_272603 3300042648 Bacteria 7574
90 Ga0466725_348724 3300042654 Bacteria 1583
91 Ga0123353_10041323 3300010167 Bacteria 7282
92 Ga0160467_100073 3300012829 Bacteria 152393
93 Ga0466692_186235 3300042591 Bacteria 5178
94 JGI24696J40584_12958168 3300002834 Bacteria 3936
95 Ga0123357_10000020 3300009784 Bacteria 141555
96 Ga0466733_048903 3300042659 Bacteria 2811
97 Ga0466718_132739 3300042617 Bacteria 13210
98 Ga0466723_108354 3300042618 Bacteria 2396
99 Ga0466706_147359 3300042599 Bacteria 36054
100 Ga0466713_061160 3300042602 Bacteria 3238
101 Ga0466713_073699 3300042602 Bacteria 1319
102 Ga0466703_067898 3300042636 Bacteria 8268
103 Ga0466703_103691 3300042636 Bacteria 71973
104 Ga0466704_034783 3300042643 Bacteria 163660
105 Ga0466704_078263 3300042643 Bacteria 5911
106 Ga0466727_278783 3300042655 Bacteria 2473
107 Ga0123357_10005156 3300009784 Unclassified 15587
108 Ga0123355_10011109 3300009826 Bacteria 13866
109 Ga0123353_10378596 3300010167 Bacteria 2118
110 Ga0160441_100191 3300012825 Bacteria 63368
111 Ga0160430_100018 3300012852 Bacteria 229539
112 Ga0160435_1000593 3300012857 Bacteria 10855
113 Ga0415639_228980 3300038395 Bacteria 1271
114 Ga0562379_0155 3300056790 Bacteria 206141
115 Ga0562378_0207 3300056814 Bacteria 140012
116 Ga0466706_117900 3300042599 Bacteria 2155
117 Ga0466713_142150 3300042602 Bacteria 1902
118 Ga0466713_147943 3300042602 Bacteria 10360
119 Ga0466722_188390 3300042609 Bacteria 13075
120 Ga0466731_374711 3300042622 Bacteria 3899
121 Ga0466704_314706 3300042643 Bacteria 2857
122 Ga0466724_02376 3300042649 Bacteria 14153
123 Ga0123357_10046014 3300009784 Bacteria 5918
124 Ga0123355_10054342 3300009826 Bacteria 6489
125 Ga0123356_10059243 3300010049 Bacteria 3572
126 Ga0123353_10171865 3300010167 Bacteria 3439
127 Ga0123353_10220920 3300010167 Bacteria 2962
128 Ga0160454_100788 3300012798 Bacteria 6284
129 Ga0160447_104871 3300012849 Unclassified 3865
130 Ga0466696_481081 3300042596 Bacteria 6524
131 JGI24699J35502_11123047 3300002509 Bacteria 3499
132 Ga0068305_10118276 3300005083 Bacteria 19654
133 Ga0074278_143184 3300005721 Bacteria 1453

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042659 Ga0466733_042229 Ga0466733_042229_21551_22378 255
2 3300042625 Ga0466730_000393 Ga0466730_000393_150_938 262
3 3300042620 Ga0466728_104307 Ga0466728_104307_561_1361 266
4 3300002504 JGI24705J35276_12193992 JGI24705J35276_121939921 267
5 3300042618 Ga0466723_154196 Ga0466723_154196_12477_13343 272
6 3300042596 Ga0466696_481081 Ga0466696_481081_1256_2077 273
7 3300012857 Ga0160435_1000593 Ga0160435_100059310 274
8 iso_pr_bacteria 2820825283 2820825583 274
9 3300042600 Ga0466700_396302 Ga0466700_396302_5511_6341 276
10 3300042609 Ga0466722_188390 Ga0466722_188390_7852_8682 276
11 3300042619 Ga0466726_211605 Ga0466726_211605_466_1296 276
12 3300042654 Ga0466725_464216 Ga0466725_464216_1889_2719 276
13 3300042655 Ga0466727_278783 Ga0466727_278783_842_1672 276
14 3300056814 Ga0562378_0207 Ga0562378_0207_68303_69133 276
15 3300009826 Ga0123355_10011109 Ga0123355_100111094 277
16 3300042619 Ga0466726_296929 Ga0466726_296929_1146_1979 277
17 3300042619 Ga0466726_311250 Ga0466726_311250_1684_2517 277
18 3300042636 Ga0466703_411922 Ga0466703_411922_1157_2023 277
19 3300002501 JGI24703J35330_11747988 JGI24703J35330_117479885 278
20 3300002932 CVPL010L_1001027 CVPL010L_10010273 278
21 3300010167 Ga0123353_10000060 Ga0123353_1000006014 278
22 3300042606 Ga0466719_554266 Ga0466719_554266_21161_21997 278
23 3300042636 Ga0466703_426558 Ga0466703_426558_2324_3160 278
24 3300042643 Ga0466704_314706 Ga0466704_314706_1929_2765 278
25 3300042654 Ga0466725_467554 Ga0466725_467554_576_1412 278
26 3300042659 Ga0466733_048903 Ga0466733_048903_1666_2502 278
27 iso_pr_bacteria 2836973655 2836973915 278
28 iso_pr_bacteria 8038268975 8038270574 278
29 iso_pr_bacteria 8114555646 8114557952 278
30 3300002501 JGI24703J35330_11747998 JGI24703J35330_117479985 279
31 3300002509 JGI24699J35502_11051298 JGI24699J35502_110512981 279
32 3300002509 JGI24699J35502_11123047 JGI24699J35502_111230473 279
33 3300005083 Ga0068305_10118276 Ga0068305_1011827611 279
34 3300009826 Ga0123355_10000409 Ga0123355_1000040933 279
35 3300009826 Ga0123355_10054342 Ga0123355_100543423 279
36 3300012829 Ga0160467_100073 Ga0160467_10007365 279
37 3300038395 Ga0415639_228980 Ga0415639_228980_183_1022 279
38 3300042591 Ga0466692_186235 Ga0466692_186235_2742_3581 279
39 3300042602 Ga0466713_147943 Ga0466713_147943_2117_2956 279
40 3300042606 Ga0466719_243853 Ga0466719_243853_2853_3692 279
41 3300042622 Ga0466731_374711 Ga0466731_374711_2805_3644 279
42 3300042654 Ga0466725_348724 Ga0466725_348724_262_1101 279
43 iso_pr_bacteria 2940221333 2940223376 279
44 3300010049 Ga0123356_10000010 Ga0123356_100000105 280
45 3300010049 Ga0123356_10030922 Ga0123356_100309222 280
46 3300010049 Ga0123356_10033639 Ga0123356_100336394 280
47 3300010049 Ga0123356_10059243 Ga0123356_100592432 280
48 3300010049 Ga0123356_10746945 Ga0123356_107469452 280
49 3300010167 Ga0123353_10041323 Ga0123353_100413233 280
50 3300010167 Ga0123353_10991858 Ga0123353_109918582 280
51 3300012834 Ga0160452_100265 Ga0160452_10026529 280
52 3300012847 Ga0160445_102316 Ga0160445_1023163 280
53 iso_pr_bacteria 2820897376 2820898645 280
54 iso_pr_bacteria 2820901319 2820902025 280
55 iso_pr_bacteria 2820909719 2820911228 280
56 3300002504 JGI24705J35276_12225614 JGI24705J35276_122256142 281
57 3300002834 JGI24696J40584_12958168 JGI24696J40584_129581682 281
58 3300005201 Ga0072941_1168593 Ga0072941_11685939 281
59 3300009784 Ga0123357_10000020 Ga0123357_100000209 281
60 3300009784 Ga0123357_10003720 Ga0123357_100037202 281
61 3300009784 Ga0123357_10005156 Ga0123357_100051565 281
62 3300009784 Ga0123357_10018055 Ga0123357_100180552 281
63 3300009784 Ga0123357_10029577 Ga0123357_100295776 281
64 3300009784 Ga0123357_10046014 Ga0123357_100460145 281
65 3300009784 Ga0123357_10083835 Ga0123357_100838352 281
66 3300010167 Ga0123353_10171865 Ga0123353_101718653 281
67 3300010167 Ga0123353_10378596 Ga0123353_103785962 281
68 3300010167 Ga0123353_10656424 Ga0123353_106564242 281
69 3300010882 Ga0123354_10055617 Ga0123354_100556173 281
70 iso_pr_bacteria 2517572100 2517754506 281
71 iso_pr_bacteria 2639763185 2642343704 281
72 iso_pr_bacteria 2639763186 2642351169 281
73 iso_pr_bacteria 2820829137 2820829294 281
74 iso_pr_bacteria 2857493320 2857498058 281
75 iso_pr_bacteria 2857498920 2857503444 281
76 iso_pr_bacteria 8030347546 8030349441 281
77 3300009784 Ga0123357_10126614 Ga0123357_101266143 282
78 3300042603 Ga0466714_006450 Ga0466714_006450_2297_3145 282
79 3300042621 Ga0466729_173722 Ga0466729_173722_114_962 282
80 3300010882 Ga0123354_10000253 Ga0123354_1000025337 283
81 3300042599 Ga0466706_117900 Ga0466706_117900_926_1780 284
82 3300042618 Ga0466723_077145 Ga0466723_077145_2115_2969 284
83 3300042593 Ga0466691_024900 Ga0466691_024900_3449_4306 285
84 3300042599 Ga0466706_239508 Ga0466706_239508_18127_19113 285
85 3300042606 Ga0466719_228736 Ga0466719_228736_63507_64364 285
86 3300042636 Ga0466703_067898 Ga0466703_067898_6412_7269 285
87 iso_pr_bacteria 2940218408 2940219370 285
88 iso_pr_bacteria 2940261461 2940262417 285
89 3300042599 Ga0466706_147359 Ga0466706_147359_22509_23369 286
90 3300042599 Ga0466706_219053 Ga0466706_219053_445_1305 286
91 3300042605 Ga0466716_328546 Ga0466716_328546_820_1680 286
92 3300042612 Ga0466705_244887 Ga0466705_244887_750_1610 286
93 3300042618 Ga0466723_108354 Ga0466723_108354_1421_2281 286
94 3300042621 Ga0466729_169695 Ga0466729_169695_6383_7243 286
95 3300042643 Ga0466704_078263 Ga0466704_078263_493_1353 286
96 3300042648 Ga0466709_272603 Ga0466709_272603_2475_3335 286
97 3300042590 Ga0466690_260168 Ga0466690_260168_83_946 287
98 3300042612 Ga0466705_322911 Ga0466705_322911_187_1209 287
99 3300002449 JGI24698J34947_10009067 JGI24698J34947_100090673 288
100 3300010167 Ga0123353_10220920 Ga0123353_102209202 288
101 3300042606 Ga0466719_555520 Ga0466719_555520_296_1162 288
102 3300042615 Ga0466711_201079 Ga0466711_201079_9901_10767 288
103 iso_pr_bacteria 2595698190 2596205329 288
104 iso_pr_bacteria 2595698194 2596213815 288
105 iso_pr_bacteria 2595698195 2596214427 288
106 iso_pr_bacteria 2595698196 2596216240 288
107 iso_pr_bacteria 2595698197 2596218080 288
108 iso_pr_bacteria 2595698198 2596219907 288
109 iso_pr_bacteria 2595698199 2596221723 288
110 iso_pr_bacteria 2627853628 2628280065 288
111 iso_pr_bacteria 2820530790 2820532914 288
112 iso_pr_bacteria 2820654856 2820656757 288
113 iso_pr_bacteria 650716050 650844644 288
114 iso_pr_bacteria 8007215774 8007216461 288
115 3300009826 Ga0123355_10005986 Ga0123355_1000598616 289
116 3300009826 Ga0123355_10529010 Ga0123355_105290102 289
117 3300010167 Ga0123353_10018993 Ga0123353_100189932 289
118 3300010167 Ga0123353_10338956 Ga0123353_103389562 289
119 3300042596 Ga0466696_367274 Ga0466696_367274_870_1739 289
120 3300042609 Ga0466722_054280 Ga0466722_054280_598_1467 289
121 iso_pr_bacteria 2940218408 2940219359 289
122 iso_pr_bacteria 2940261461 2940262406 289
123 iso_pr_bacteria 8007211731 8007213745 289
124 3300042603 Ga0466714_144747 Ga0466714_144747_1636_2508 290
125 3300042604 Ga0466717_239473 Ga0466717_239473_20_892 290
126 3300056790 Ga0562379_0155 Ga0562379_0155_92216_93088 290
127 iso_pr_bacteria 8007215774 8007217508 290
128 iso_pr_bacteria 8018794549 8018795225 290
129 iso_pr_bacteria 2684622918 2686086449 291
130 iso_pr_bacteria 2808606957 2811756726 291
131 iso_pr_bacteria 8024986378 8024987861 291
132 iso_pr_bacteria 8110341875 8110342685 291
133 3300042619 Ga0466726_398604 Ga0466726_398604_802_1680 292
134 3300042643 Ga0466704_069847 Ga0466704_069847_545_1423 292
135 iso_pr_bacteria 2781125632 2781269937 292
136 iso_pr_bacteria 2820894511 2820895197 292
137 iso_pr_bacteria 8007211731 8007213052 292
138 iso_pr_bacteria 8077780672 8077782567 292
139 iso_pr_bacteria 8118075156 8118082099 292
140 3300002450 JGI24695J34938_10020765 JGI24695J34938_100207654 293
141 3300042655 Ga0466727_245978 Ga0466727_245978_2338_3288 294
142 3300042620 Ga0466728_308270 Ga0466728_308270_12965_13852 295
143 iso_pr_bacteria 2873586004 2873588939 296
144 3300012852 Ga0160430_100018 Ga0160430_10001838 297
145 3300042612 Ga0466705_451134 Ga0466705_451134_1091_1984 297
146 3300042636 Ga0466703_103691 Ga0466703_103691_13002_13895 297
147 3300042643 Ga0466704_034783 Ga0466704_034783_61943_62836 297
148 3300042659 Ga0466733_118672 Ga0466733_118672_7544_8518 297
149 3300042643 Ga0466704_412729 Ga0466704_412729_11847_12806 298
150 iso_pr_bacteria 2884351759 2884354084 298
151 3300012850 Ga0160434_100007 Ga0160434_100007138 299
152 iso_pr_bacteria 2513237174 2514074375 299
153 iso_pr_bacteria 2519899775 2520953395 299
154 iso_pr_bacteria 2597490194 2598674793 299
155 iso_pr_bacteria 2660238275 2661719248 299
156 iso_pr_bacteria 2671180601 2673428515 299
157 iso_pr_bacteria 2684622916 2686083278 299
158 iso_pr_bacteria 2684622917 2686084762 299
159 iso_pr_bacteria 2693429521 2693516377 299
160 iso_pr_bacteria 2802429577 2805812932 299
161 iso_pr_bacteria 8024981139 8024982637 299
162 iso_pr_bacteria 8032009961 8032011158 299
163 3300005721 Ga0074278_143184 Ga0074278_1431842 300
164 3300042602 Ga0466713_061160 Ga0466713_061160_418_1320 300
165 3300042617 Ga0466718_132739 Ga0466718_132739_1496_2398 300
166 3300056856 Ga0562375_0062 Ga0562375_0062_178731_179636 301
167 3300042649 Ga0466724_02376 Ga0466724_02376_4352_5260 302
168 iso_pr_bacteria 2884613238 2884614506 302
169 iso_pr_bacteria 2847305884 2847307895 303
170 3300012825 Ga0160441_100191 Ga0160441_1001918 304
171 3300042602 Ga0466713_142150 Ga0466713_142150_193_1107 304
172 3300042659 Ga0466733_117310 Ga0466733_117310_7472_8386 304
173 3300012848 Ga0160443_100221 Ga0160443_10022154 305
174 3300012847 Ga0160445_103689 Ga0160445_1036893 306
175 3300012861 Ga0160436_1000059 Ga0160436_100005941 306
176 3300042602 Ga0466713_035511 Ga0466713_035511_584_1504 306
177 iso_pr_bacteria 2820818506 2820820159 306
178 iso_pr_bacteria 2918394494 2918396880 306
179 3300005200 Ga0072940_1399281 Ga0072940_13992811 307
180 3300042601 Ga0466707_072993 Ga0466707_072993_16596_17519 307
181 3300056814 Ga0562378_0103 Ga0562378_0103_61664_62587 307
182 3300056856 Ga0562375_0054 Ga0562375_0054_393447_394370 307
183 3300042599 Ga0466706_209135 Ga0466706_209135_5243_6187 314
184 3300042599 Ga0466706_103556 Ga0466706_103556_1077_2024 315
185 3300042602 Ga0466713_039454 Ga0466713_039454_9494_10444 316
186 3300042602 Ga0466713_073699 Ga0466713_073699_15_968 317
187 3300012852 Ga0160430_101789 Ga0160430_1017896 320
188 3300012806 Ga0160442_100518 Ga0160442_1005184 321
189 3300012845 Ga0160460_101041 Ga0160460_10104110 321
190 3300012798 Ga0160454_100788 Ga0160454_1007882 322
191 3300012835 Ga0160446_100148 Ga0160446_10014830 322
192 3300012849 Ga0160447_104871 Ga0160447_1048714 322
193 3300005200 Ga0072940_1049611 Ga0072940_10496116 345

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 126 309 0.83

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.