Protein Family IF06075
Metagenome
Isolate
182
Members
75
Samples
150
Scaffolds
322.82
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_057971|Ga0466713_057971_66_1202
- Length
- 378 aa
- Sequence
- VENQAGTTVAVLHNEDERFSEDGVKIEMCEKPPASFFIGGFLLFVKLFVSLWLKKYLILDCVKIMAKISYRFNRQTLTYEQIRLSIGQRLWIVLKHLITGVGIGVVLFAVATYFFESPYERQLKKENKLLLAQYKVLSKQMDENQKVLDDLQQRDDHLYRAIFNADPIPESLRRPGFGGTNRYEKLMDMPNSDLIISTTQKLDIMTKELYVQTNSYDEIIELIKTKEERMNCIPAIRPVPTKDISSGFGMRLHPLWGDRRFHTGMDMNAPSGTPICATGDGTVEAVGWDGGYGNRVVINHGFGYKTLYGHCKSTLVRVGQKVKRGEKIATVGMTGDASGNHVHYEVRVKDKYDNPAKYFFMDLSPEEYDEMMYISDNR
Sample Types
Isolate
17.6%
Metagenome
82.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
35.6%
Kalotermitidae
19.2%
Termitidae
19.2%
Unclassified
8.2%
Rhinotermitidae
4.1%
Termopsidae
4.1%
Hydrophilidae
2.7%
Passalidae
2.7%
Tenebrionidae
1.4%
Hodotermitidae
1.4%
Daphniidae
1.4%
Taxonomy
Archaea
0
Bacteria
171
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 2 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 3 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 4 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 9 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 10 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 11 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 12 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 13 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 14 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 15 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 16 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 17 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 18 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 22 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 27 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 28 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 29 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 30 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 37 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 38 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 39 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 40 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 41 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 42 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 43 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 44 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 45 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 48 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 51 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 52 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 53 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 54 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 55 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 56 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 57 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 58 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 59 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 60 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 61 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 62 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 63 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 64 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 65 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 66 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 67 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 68 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 69 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 70 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 71 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 72 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 73 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 74 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 75 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_059639 | 3300042612 | Bacteria | 4907 |
| 2 | Ga0466705_151333 | 3300042612 | Bacteria | 6273 |
| 3 | Ga0466733_003667 | 3300042659 | Bacteria | 192892 |
| 4 | Ga0466733_149594 | 3300042659 | Bacteria | 12452 |
| 5 | Ga0466715_412624 | 3300042616 | Bacteria | 2369 |
| 6 | Ga0466715_461669 | 3300042616 | Bacteria | 6608 |
| 7 | Ga0466729_140006 | 3300042621 | Bacteria | 9185 |
| 8 | Ga0123357_10020511 | 3300009784 | Bacteria | 8835 |
| 9 | Ga0123354_10084851 | 3300010882 | Bacteria | 4443 |
| 10 | Ga0466735_148687 | 3300042624 | Bacteria | 1789 |
| 11 | Ga0466703_221987 | 3300042636 | Bacteria | 26862 |
| 12 | Ga0466709_265213 | 3300042648 | Bacteria | 4021 |
| 13 | Ga0466708_337902 | 3300042652 | Bacteria | 34703 |
| 14 | Ga0466727_227926 | 3300042655 | Bacteria | 9744 |
| 15 | Ga0466690_100895 | 3300042590 | Bacteria | 21373 |
| 16 | Ga0466696_372063 | 3300042596 | Bacteria | 13457 |
| 17 | 2227480192 | 2225789004 | Bacteria | 22321 |
| 18 | IMNBL1DRAFT_c0000351 | 3300000062 | Bacteria | 38920 |
| 19 | JGI24702J35022_10000079 | 3300002462 | Bacteria | 42407 |
| 20 | JGI24705J35276_12225507 | 3300002504 | Bacteria | 2729 |
| 21 | JGI24699J35502_11133135 | 3300002509 | Bacteria | 8865 |
| 22 | Ga0466706_268163 | 3300042599 | Bacteria | 17265 |
| 23 | Ga0466733_095014 | 3300042659 | Bacteria | 6416 |
| 24 | Ga0466728_122860 | 3300042620 | Bacteria | 67185 |
| 25 | Ga0466728_255251 | 3300042620 | Bacteria | 107081 |
| 26 | Ga0466728_470077 | 3300042620 | Bacteria | 18577 |
| 27 | Ga0123357_10004066 | 3300009784 | Bacteria | 17038 |
| 28 | Ga0123357_10004305 | 3300009784 | Bacteria | 16669 |
| 29 | Ga0123357_10026005 | 3300009784 | Bacteria | 7902 |
| 30 | Ga0123353_10438718 | 3300010167 | Unclassified | 1927 |
| 31 | Ga0466734_100051 | 3300042623 | Bacteria | 4134 |
| 32 | Ga0466703_411812 | 3300042636 | Bacteria | 7950 |
| 33 | Ga0466704_205720 | 3300042643 | Bacteria | 7121 |
| 34 | Ga0466690_359642 | 3300042590 | Bacteria | 21085 |
| 35 | Ga0466692_077150 | 3300042591 | Bacteria | 41956 |
| 36 | Ga0466693_390599 | 3300042592 | Bacteria | 1041 |
| 37 | Ga0466696_395410 | 3300042596 | Bacteria | 17457 |
| 38 | 2227464931 | 2225789004 | Bacteria | 5217 |
| 39 | Ga0123357_10000272 | 3300009784 | Bacteria | 49371 |
| 40 | Ga0123357_10001908 | 3300009784 | Bacteria | 22681 |
| 41 | Ga0466707_265105 | 3300042601 | Bacteria | 17266 |
| 42 | Ga0466713_077069 | 3300042602 | Bacteria | 26251 |
| 43 | Ga0466713_094113 | 3300042602 | Unclassified | 4183 |
| 44 | Ga0466719_503768 | 3300042606 | Bacteria | 16604 |
| 45 | Ga0466698_064330 | 3300042610 | Bacteria | 1801 |
| 46 | Ga0466733_103421 | 3300042659 | Bacteria | 32380 |
| 47 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 48 | Ga0466711_412725 | 3300042615 | Bacteria | 2457 |
| 49 | Ga0466715_281118 | 3300042616 | Bacteria | 34148 |
| 50 | Ga0466723_019917 | 3300042618 | Bacteria | 20700 |
| 51 | Ga0123354_10135209 | 3300010882 | Bacteria | 3087 |
| 52 | Ga0466735_055295 | 3300042624 | Bacteria | 5890 |
| 53 | Ga0466703_230297 | 3300042636 | Bacteria | 5371 |
| 54 | JGI24699J35502_11132691 | 3300002509 | Bacteria | 7406 |
| 55 | JGI24699J35502_11134052 | 3300002509 | Bacteria | 27076 |
| 56 | Ga0068305_10352541 | 3300005083 | Bacteria | 1696 |
| 57 | Ga0068305_10537957 | 3300005083 | Unclassified | 1325 |
| 58 | Ga0466707_009914 | 3300042601 | Bacteria | 13246 |
| 59 | Ga0466707_140878 | 3300042601 | Bacteria | 5870 |
| 60 | Ga0466722_067088 | 3300042609 | Bacteria | 5895 |
| 61 | Ga0466722_113742 | 3300042609 | Bacteria | 1177 |
| 62 | Ga0466722_157555 | 3300042609 | Bacteria | 19109 |
| 63 | Ga0466705_042685 | 3300042612 | Bacteria | 5658 |
| 64 | Ga0466733_085947 | 3300042659 | Bacteria | 3268 |
| 65 | Ga0466711_022565 | 3300042615 | Bacteria | 5150 |
| 66 | Ga0466711_087587 | 3300042615 | Bacteria | 5283 |
| 67 | Ga0466715_026356 | 3300042616 | Bacteria | 26060 |
| 68 | Ga0466715_309137 | 3300042616 | Bacteria | 21840 |
| 69 | Ga0466729_011467 | 3300042621 | Bacteria | 19112 |
| 70 | Ga0123357_10167193 | 3300009784 | Unclassified | 2614 |
| 71 | Ga0123354_10004834 | 3300010882 | Bacteria | 19285 |
| 72 | Ga0123354_10049852 | 3300010882 | Unclassified | 6345 |
| 73 | Ga0123354_10122840 | 3300010882 | Bacteria | 3340 |
| 74 | Ga0466690_068996 | 3300042590 | Bacteria | 19057 |
| 75 | Ga0466691_058023 | 3300042593 | Bacteria | 15509 |
| 76 | Ga0466694_204419 | 3300042594 | Bacteria | 2060 |
| 77 | Ga0068305_10186199 | 3300005083 | Bacteria | 11406 |
| 78 | Ga0123357_10002736 | 3300009784 | Bacteria | 19873 |
| 79 | Ga0466700_218839 | 3300042600 | Bacteria | 3525 |
| 80 | Ga0466707_104144 | 3300042601 | Bacteria | 4059 |
| 81 | Ga0466713_019527 | 3300042602 | Bacteria | 7785 |
| 82 | Ga0466713_129032 | 3300042602 | Unclassified | 5925 |
| 83 | Ga0466716_034523 | 3300042605 | Bacteria | 16626 |
| 84 | Ga0466722_167338 | 3300042609 | Bacteria | 21617 |
| 85 | Ga0466722_201092 | 3300042609 | Bacteria | 5120 |
| 86 | Ga0466705_006744 | 3300042612 | Bacteria | 55663 |
| 87 | Ga0466711_078060 | 3300042615 | Bacteria | 15304 |
| 88 | Ga0123353_10135293 | 3300010167 | Bacteria | 3953 |
| 89 | Ga0123354_10001398 | 3300010882 | Bacteria | 29178 |
| 90 | Ga0466735_193940 | 3300042624 | Bacteria | 1798 |
| 91 | Ga0466735_224980 | 3300042624 | Bacteria | 3372 |
| 92 | Ga0466703_267922 | 3300042636 | Bacteria | 10005 |
| 93 | Ga0466690_133199 | 3300042590 | Bacteria | 27284 |
| 94 | 2227646840 | 2225789004 | Bacteria | 10941 |
| 95 | IMNBL1DRAFT_c0000775 | 3300000062 | Bacteria | 25199 |
| 96 | Ga0466700_376901 | 3300042600 | Bacteria | 8092 |
| 97 | Ga0466716_105775 | 3300042605 | Bacteria | 9188 |
| 98 | Ga0466716_207145 | 3300042605 | Bacteria | 17441 |
| 99 | Ga0466719_101266 | 3300042606 | Bacteria | 11054 |
| 100 | Ga0466705_059520 | 3300042612 | Unclassified | 7179 |
| 101 | Ga0466705_370330 | 3300042612 | Bacteria | 3284 |
| 102 | Ga0466711_030287 | 3300042615 | Bacteria | 18879 |
| 103 | Ga0466711_166017 | 3300042615 | Bacteria | 6650 |
| 104 | Ga0466715_109224 | 3300042616 | Bacteria | 75833 |
| 105 | Ga0466723_212262 | 3300042618 | Bacteria | 19907 |
| 106 | Ga0123354_10059942 | 3300010882 | Bacteria | 5639 |
| 107 | Ga0466703_054439 | 3300042636 | Bacteria | 3239 |
| 108 | Ga0466703_102664 | 3300042636 | Bacteria | 11783 |
| 109 | Ga0466704_068819 | 3300042643 | Bacteria | 11441 |
| 110 | Ga0466704_280386 | 3300042643 | Bacteria | 3113 |
| 111 | Ga0466727_235070 | 3300042655 | Bacteria | 3236 |
| 112 | Ga0265387_1003297 | 3300024582 | Bacteria | 2240 |
| 113 | Ga0466713_035409 | 3300042602 | Bacteria | 4989 |
| 114 | Ga0466719_059414 | 3300042606 | Bacteria | 8718 |
| 115 | Ga0466719_141867 | 3300042606 | Bacteria | 5856 |
| 116 | Ga0466722_015207 | 3300042609 | Bacteria | 8887 |
| 117 | Ga0466722_090557 | 3300042609 | Bacteria | 30177 |
| 118 | Ga0466698_289359 | 3300042610 | Bacteria | 2340 |
| 119 | Ga0466697_148637 | 3300042611 | Bacteria | 1581 |
| 120 | Ga0466726_193705 | 3300042619 | Bacteria | 7848 |
| 121 | Ga0466726_470599 | 3300042619 | Bacteria | 9793 |
| 122 | Ga0466728_234478 | 3300042620 | Bacteria | 23263 |
| 123 | Ga0466728_319822 | 3300042620 | Bacteria | 3131 |
| 124 | Ga0123357_10003749 | 3300009784 | Bacteria | 17566 |
| 125 | Ga0466703_149988 | 3300042636 | Bacteria | 19852 |
| 126 | Ga0466725_353653 | 3300042654 | Bacteria | 6727 |
| 127 | Ga0466727_066339 | 3300042655 | Bacteria | 75167 |
| 128 | Ga0466692_140391 | 3300042591 | Bacteria | 136970 |
| 129 | 2227430807 | 2225789004 | Bacteria | 5561 |
| 130 | Ga0466707_210372 | 3300042601 | Bacteria | 12662 |
| 131 | Ga0466713_110968 | 3300042602 | Bacteria | 4554 |
| 132 | Ga0466697_237347 | 3300042611 | Bacteria | 2379 |
| 133 | Ga0466705_186559 | 3300042612 | Unclassified | 5363 |
| 134 | Ga0466715_074944 | 3300042616 | Bacteria | 23528 |
| 135 | Ga0466728_417368 | 3300042620 | Bacteria | 2719 |
| 136 | Ga0466729_120951 | 3300042621 | Bacteria | 33674 |
| 137 | Ga0123357_10375313 | 3300009784 | Unclassified | 1327 |
| 138 | Ga0123354_10001330 | 3300010882 | Bacteria | 29556 |
| 139 | Ga0466703_413252 | 3300042636 | Bacteria | 25457 |
| 140 | Ga0466727_250073 | 3300042655 | Unclassified | 3332 |
| 141 | Ga0466696_161501 | 3300042596 | Bacteria | 10074 |
| 142 | Ga0466696_286417 | 3300042596 | Bacteria | 6230 |
| 143 | Ga0068305_10020271 | 3300005083 | Bacteria | 17549 |
| 144 | Ga0072941_1033778 | 3300005201 | Bacteria | 2661 |
| 145 | Ga0466713_057971 | 3300042602 | Bacteria | 3689 |
| 146 | Ga0466713_065152 | 3300042602 | Bacteria | 12347 |
| 147 | Ga0466713_134989 | 3300042602 | Bacteria | 147812 |
| 148 | Ga0466713_148967 | 3300042602 | Unclassified | 1411 |
| 149 | Ga0466719_259568 | 3300042606 | Bacteria | 11479 |
| 150 | Ga0466722_056596 | 3300042609 | Bacteria | 3886 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010167 | Ga0123353_10438718 | Ga0123353_104387182 | 259 |
| 2 | 3300010167 | Ga0123353_10135293 | Ga0123353_101352933 | 297 |
| 3 | 3300042593 | Ga0466691_058023 | Ga0466691_058023_8000_8953 | 304 |
| 4 | 3300042590 | Ga0466690_068996 | Ga0466690_068996_6083_7036 | 305 |
| 5 | 3300042606 | Ga0466719_259568 | Ga0466719_259568_6899_7852 | 305 |
| 6 | 3300042594 | Ga0466694_204419 | Ga0466694_204419_796_1755 | 307 |
| 7 | 3300042612 | Ga0466705_186559 | Ga0466705_186559_2487_3419 | 310 |
| 8 | 3300042618 | Ga0466723_212262 | Ga0466723_212262_3659_4612 | 310 |
| 9 | 3300042590 | Ga0466690_100895 | Ga0466690_100895_4343_5278 | 311 |
| 10 | 3300042605 | Ga0466716_034523 | Ga0466716_034523_9371_10306 | 311 |
| 11 | 3300042618 | Ga0466723_019917 | Ga0466723_019917_4257_5192 | 311 |
| 12 | 3300042616 | Ga0466715_281118 | Ga0466715_281118_29499_30452 | 312 |
| 13 | 3300042616 | Ga0466715_309137 | Ga0466715_309137_13457_14410 | 312 |
| 14 | 3300042601 | Ga0466707_140878 | Ga0466707_140878_4494_5435 | 313 |
| 15 | 3300042602 | Ga0466713_019527 | Ga0466713_019527_692_1636 | 314 |
| 16 | 3300042636 | Ga0466703_413252 | Ga0466703_413252_22702_23646 | 314 |
| 17 | 3300005083 | Ga0068305_10537957 | Ga0068305_105379572 | 316 |
| 18 | 3300042596 | Ga0466696_161501 | Ga0466696_161501_8119_9069 | 316 |
| 19 | 3300042602 | Ga0466713_077069 | Ga0466713_077069_9845_10795 | 316 |
| 20 | 3300042619 | Ga0466726_193705 | Ga0466726_193705_5603_6553 | 316 |
| 21 | 3300042655 | Ga0466727_227926 | Ga0466727_227926_640_1590 | 316 |
| 22 | 3300042655 | Ga0466727_250073 | Ga0466727_250073_2304_3254 | 316 |
| 23 | 3300042659 | Ga0466733_103421 | Ga0466733_103421_14339_15289 | 316 |
| 24 | 2225789004 | 2227464931 | 2227902391 | 317 |
| 25 | 3300042600 | Ga0466700_218839 | Ga0466700_218839_1850_2803 | 317 |
| 26 | 3300042600 | Ga0466700_376901 | Ga0466700_376901_6160_7113 | 317 |
| 27 | 3300042601 | Ga0466707_009914 | Ga0466707_009914_10479_11432 | 317 |
| 28 | 3300042601 | Ga0466707_104144 | Ga0466707_104144_2790_3743 | 317 |
| 29 | 3300042606 | Ga0466719_503768 | Ga0466719_503768_5667_6620 | 317 |
| 30 | 3300042609 | Ga0466722_056596 | Ga0466722_056596_162_1115 | 317 |
| 31 | 3300042609 | Ga0466722_113742 | Ga0466722_113742_184_1137 | 317 |
| 32 | 3300042609 | Ga0466722_157555 | Ga0466722_157555_184_1137 | 317 |
| 33 | 3300042610 | Ga0466698_064330 | Ga0466698_064330_150_1103 | 317 |
| 34 | 3300042611 | Ga0466697_148637 | Ga0466697_148637_552_1505 | 317 |
| 35 | 3300042611 | Ga0466697_237347 | Ga0466697_237347_229_1182 | 317 |
| 36 | 3300042619 | Ga0466726_470599 | Ga0466726_470599_943_1896 | 317 |
| 37 | 3300042620 | Ga0466728_417368 | Ga0466728_417368_1411_2364 | 317 |
| 38 | 3300042621 | Ga0466729_140006 | Ga0466729_140006_4996_5949 | 317 |
| 39 | 3300042623 | Ga0466734_100051 | Ga0466734_100051_569_1522 | 317 |
| 40 | 3300042624 | Ga0466735_055295 | Ga0466735_055295_2155_3108 | 317 |
| 41 | 3300042624 | Ga0466735_148687 | Ga0466735_148687_481_1434 | 317 |
| 42 | 3300042636 | Ga0466703_054439 | Ga0466703_054439_1939_2892 | 317 |
| 43 | 3300042655 | Ga0466727_066339 | Ga0466727_066339_31214_32167 | 317 |
| 44 | 3300042655 | Ga0466727_235070 | Ga0466727_235070_1904_2857 | 317 |
| 45 | iso_pr_bacteria | 2820759988 | 2820760440 | 317 |
| 46 | 3300000062 | IMNBL1DRAFT_c0000351 | IMNBL1DRAFT_000035111 | 318 |
| 47 | 3300002504 | JGI24705J35276_12225507 | JGI24705J35276_122255073 | 318 |
| 48 | 3300002509 | JGI24699J35502_11132691 | JGI24699J35502_111326915 | 318 |
| 49 | 3300002509 | JGI24699J35502_11133135 | JGI24699J35502_1113313510 | 318 |
| 50 | 3300005201 | Ga0072941_1033778 | Ga0072941_10337782 | 318 |
| 51 | 3300009784 | Ga0123357_10001908 | Ga0123357_1000190819 | 318 |
| 52 | 3300009784 | Ga0123357_10002736 | Ga0123357_100027367 | 318 |
| 53 | 3300009784 | Ga0123357_10003749 | Ga0123357_1000374914 | 318 |
| 54 | 3300009784 | Ga0123357_10004066 | Ga0123357_100040663 | 318 |
| 55 | 3300009784 | Ga0123357_10004305 | Ga0123357_100043058 | 318 |
| 56 | 3300009784 | Ga0123357_10020511 | Ga0123357_100205112 | 318 |
| 57 | 3300009784 | Ga0123357_10026005 | Ga0123357_100260057 | 318 |
| 58 | 3300009784 | Ga0123357_10167193 | Ga0123357_101671932 | 318 |
| 59 | 3300009784 | Ga0123357_10375313 | Ga0123357_103753132 | 318 |
| 60 | 3300010882 | Ga0123354_10001330 | Ga0123354_1000133020 | 318 |
| 61 | 3300010882 | Ga0123354_10001398 | Ga0123354_1000139815 | 318 |
| 62 | 3300010882 | Ga0123354_10004834 | Ga0123354_1000483411 | 318 |
| 63 | 3300010882 | Ga0123354_10049852 | Ga0123354_100498528 | 318 |
| 64 | 3300010882 | Ga0123354_10059942 | Ga0123354_100599423 | 318 |
| 65 | 3300010882 | Ga0123354_10084851 | Ga0123354_100848515 | 318 |
| 66 | 3300010882 | Ga0123354_10122840 | Ga0123354_101228403 | 318 |
| 67 | 3300010882 | Ga0123354_10135209 | Ga0123354_101352094 | 318 |
| 68 | 3300042602 | Ga0466713_110968 | Ga0466713_110968_627_1595 | 322 |
| 69 | 3300042621 | Ga0466729_011467 | Ga0466729_011467_8054_9022 | 322 |
| 70 | 3300042636 | Ga0466703_221987 | Ga0466703_221987_4635_5603 | 322 |
| 71 | iso_pr_bacteria | 2590828803 | 2592928716 | 322 |
| 72 | iso_pr_bacteria | 2820757377 | 2820758512 | 322 |
| 73 | iso_pr_bacteria | 2820778767 | 2820779177 | 322 |
| 74 | iso_pr_bacteria | 2910926975 | 2910927803 | 322 |
| 75 | 3300002509 | JGI24699J35502_11134052 | JGI24699J35502_1113405226 | 323 |
| 76 | 3300005083 | Ga0068305_10352541 | Ga0068305_103525412 | 323 |
| 77 | 3300009784 | Ga0123357_10000272 | Ga0123357_1000027231 | 323 |
| 78 | 3300042592 | Ga0466693_390599 | Ga0466693_390599_57_1028 | 323 |
| 79 | 3300042602 | Ga0466713_134989 | Ga0466713_134989_31015_31986 | 323 |
| 80 | 3300042605 | Ga0466716_105775 | Ga0466716_105775_3802_4773 | 323 |
| 81 | 3300042605 | Ga0466716_207145 | Ga0466716_207145_14829_15800 | 323 |
| 82 | 3300042610 | Ga0466698_289359 | Ga0466698_289359_119_1090 | 323 |
| 83 | 3300042612 | Ga0466705_370330 | Ga0466705_370330_390_1361 | 323 |
| 84 | 3300042620 | Ga0466728_255251 | Ga0466728_255251_72706_73677 | 323 |
| 85 | 3300042659 | Ga0466733_003667 | Ga0466733_003667_176856_177827 | 323 |
| 86 | 3300042659 | Ga0466733_149594 | Ga0466733_149594_6960_7931 | 323 |
| 87 | iso_pr_bacteria | 2910942425 | 2910946061 | 323 |
| 88 | iso_pr_bacteria | 2910959314 | 2910961489 | 323 |
| 89 | 3300000062 | IMNBL1DRAFT_c0000775 | IMNBL1DRAFT_00007754 | 324 |
| 90 | 3300042602 | Ga0466713_035409 | Ga0466713_035409_3227_4201 | 324 |
| 91 | 3300042620 | Ga0466728_234478 | Ga0466728_234478_17408_18382 | 324 |
| 92 | 3300056842 | Ga0562377_0004 | Ga0562377_0004_844972_845946 | 324 |
| 93 | iso_pr_bacteria | 2873600114 | 2873602947 | 324 |
| 94 | iso_pr_bacteria | 2873610414 | 2873613311 | 324 |
| 95 | iso_pr_bacteria | 2910930387 | 2910932950 | 324 |
| 96 | 3300042602 | Ga0466713_065152 | Ga0466713_065152_4376_5356 | 326 |
| 97 | 3300042602 | Ga0466713_094113 | Ga0466713_094113_2614_3594 | 326 |
| 98 | 3300042602 | Ga0466713_148967 | Ga0466713_148967_340_1320 | 326 |
| 99 | iso_pr_bacteria | 2940244548 | 2940247190 | 326 |
| 100 | iso_pr_bacteria | 2940253009 | 2940255364 | 326 |
| 101 | iso_pr_bacteria | 2940257232 | 2940259361 | 326 |
| 102 | 2225789004 | 2227430807 | 2227870434 | 327 |
| 103 | 2225789004 | 2227480192 | 2227939392 | 327 |
| 104 | 2225789004 | 2227646840 | 2228240200 | 327 |
| 105 | 3300042590 | Ga0466690_133199 | Ga0466690_133199_5516_6499 | 327 |
| 106 | 3300042590 | Ga0466690_359642 | Ga0466690_359642_3972_4955 | 327 |
| 107 | 3300042591 | Ga0466692_077150 | Ga0466692_077150_4558_5541 | 327 |
| 108 | 3300042591 | Ga0466692_140391 | Ga0466692_140391_876_1859 | 327 |
| 109 | 3300042596 | Ga0466696_286417 | Ga0466696_286417_4199_5182 | 327 |
| 110 | 3300042596 | Ga0466696_372063 | Ga0466696_372063_5210_6193 | 327 |
| 111 | 3300042596 | Ga0466696_395410 | Ga0466696_395410_12435_13418 | 327 |
| 112 | 3300042599 | Ga0466706_268163 | Ga0466706_268163_15636_16619 | 327 |
| 113 | 3300042601 | Ga0466707_210372 | Ga0466707_210372_10326_11309 | 327 |
| 114 | 3300042601 | Ga0466707_265105 | Ga0466707_265105_12328_13311 | 327 |
| 115 | 3300042602 | Ga0466713_129032 | Ga0466713_129032_386_1369 | 327 |
| 116 | 3300042606 | Ga0466719_059414 | Ga0466719_059414_664_1647 | 327 |
| 117 | 3300042606 | Ga0466719_101266 | Ga0466719_101266_13_996 | 327 |
| 118 | 3300042606 | Ga0466719_141867 | Ga0466719_141867_4424_5407 | 327 |
| 119 | 3300042609 | Ga0466722_015207 | Ga0466722_015207_3442_4425 | 327 |
| 120 | 3300042609 | Ga0466722_067088 | Ga0466722_067088_799_1782 | 327 |
| 121 | 3300042609 | Ga0466722_090557 | Ga0466722_090557_20299_21282 | 327 |
| 122 | 3300042609 | Ga0466722_201092 | Ga0466722_201092_1712_2695 | 327 |
| 123 | 3300042612 | Ga0466705_006744 | Ga0466705_006744_50773_51756 | 327 |
| 124 | 3300042612 | Ga0466705_042685 | Ga0466705_042685_4013_4996 | 327 |
| 125 | 3300042612 | Ga0466705_059520 | Ga0466705_059520_1291_2274 | 327 |
| 126 | 3300042612 | Ga0466705_059639 | Ga0466705_059639_67_1050 | 327 |
| 127 | 3300042612 | Ga0466705_151333 | Ga0466705_151333_1577_2560 | 327 |
| 128 | 3300042615 | Ga0466711_022565 | Ga0466711_022565_55_1038 | 327 |
| 129 | 3300042615 | Ga0466711_030287 | Ga0466711_030287_14832_15815 | 327 |
| 130 | 3300042615 | Ga0466711_078060 | Ga0466711_078060_3025_4008 | 327 |
| 131 | 3300042615 | Ga0466711_087587 | Ga0466711_087587_3681_4664 | 327 |
| 132 | 3300042615 | Ga0466711_166017 | Ga0466711_166017_4080_5063 | 327 |
| 133 | 3300042615 | Ga0466711_412725 | Ga0466711_412725_862_1845 | 327 |
| 134 | 3300042616 | Ga0466715_026356 | Ga0466715_026356_11514_12497 | 327 |
| 135 | 3300042616 | Ga0466715_074944 | Ga0466715_074944_15865_16848 | 327 |
| 136 | 3300042616 | Ga0466715_109224 | Ga0466715_109224_70892_71875 | 327 |
| 137 | 3300042616 | Ga0466715_412624 | Ga0466715_412624_1000_1983 | 327 |
| 138 | 3300042616 | Ga0466715_461669 | Ga0466715_461669_5255_6238 | 327 |
| 139 | 3300042620 | Ga0466728_319822 | Ga0466728_319822_833_1816 | 327 |
| 140 | 3300042620 | Ga0466728_470077 | Ga0466728_470077_11692_12675 | 327 |
| 141 | 3300042624 | Ga0466735_193940 | Ga0466735_193940_595_1578 | 327 |
| 142 | 3300042624 | Ga0466735_224980 | Ga0466735_224980_1284_2267 | 327 |
| 143 | 3300042636 | Ga0466703_102664 | Ga0466703_102664_6213_7196 | 327 |
| 144 | 3300042636 | Ga0466703_149988 | Ga0466703_149988_6003_6986 | 327 |
| 145 | 3300042636 | Ga0466703_230297 | Ga0466703_230297_4038_5021 | 327 |
| 146 | 3300042636 | Ga0466703_267922 | Ga0466703_267922_97_1080 | 327 |
| 147 | 3300042636 | Ga0466703_411812 | Ga0466703_411812_2468_3451 | 327 |
| 148 | 3300042643 | Ga0466704_068819 | Ga0466704_068819_3898_4881 | 327 |
| 149 | 3300042643 | Ga0466704_205720 | Ga0466704_205720_4491_5474 | 327 |
| 150 | 3300042643 | Ga0466704_280386 | Ga0466704_280386_1162_2145 | 327 |
| 151 | 3300042648 | Ga0466709_265213 | Ga0466709_265213_1471_2454 | 327 |
| 152 | 3300042652 | Ga0466708_337902 | Ga0466708_337902_15027_16010 | 327 |
| 153 | 3300042654 | Ga0466725_353653 | Ga0466725_353653_4461_5444 | 327 |
| 154 | 3300042659 | Ga0466733_085947 | Ga0466733_085947_116_1099 | 327 |
| 155 | 3300042659 | Ga0466733_095014 | Ga0466733_095014_3297_4280 | 327 |
| 156 | iso_pr_bacteria | 2923982719 | 2923984672 | 327 |
| 157 | iso_pr_bacteria | 2940195863 | 2940196332 | 327 |
| 158 | iso_pr_bacteria | 2940199050 | 2940199480 | 327 |
| 159 | iso_pr_bacteria | 2940202316 | 2940203316 | 327 |
| 160 | iso_pr_bacteria | 2940205530 | 2940208694 | 327 |
| 161 | iso_pr_bacteria | 2940209341 | 2940209380 | 327 |
| 162 | iso_pr_bacteria | 2940212447 | 2940215644 | 327 |
| 163 | iso_pr_bacteria | 2940298504 | 2940301698 | 327 |
| 164 | iso_pr_bacteria | 2940302308 | 2940305464 | 327 |
| 165 | iso_pr_bacteria | 2940306115 | 2940309274 | 327 |
| 166 | iso_pr_bacteria | 2940309933 | 2940313111 | 327 |
| 167 | iso_pr_bacteria | 2940313741 | 2940316961 | 327 |
| 168 | iso_pr_bacteria | 2940317558 | 2940320775 | 327 |
| 169 | iso_pr_bacteria | 2940321370 | 2940324496 | 327 |
| 170 | iso_pr_bacteria | 2940325180 | 2940328370 | 327 |
| 171 | iso_pr_bacteria | 2940328985 | 2940332141 | 327 |
| 172 | iso_pr_bacteria | 2940332795 | 2940335977 | 327 |
| 173 | iso_pr_bacteria | 2940346213 | 2940347191 | 327 |
| 174 | iso_pr_bacteria | 2940371297 | 2940372039 | 327 |
| 175 | 3300002462 | JGI24702J35022_10000079 | JGI24702J35022_1000007913 | 328 |
| 176 | 3300005083 | Ga0068305_10020271 | Ga0068305_100202715 | 328 |
| 177 | 3300042609 | Ga0466722_167338 | Ga0466722_167338_3543_4556 | 337 |
| 178 | 3300024582 | Ga0265387_1003297 | Ga0265387_10032972 | 346 |
| 179 | 3300005083 | Ga0068305_10186199 | Ga0068305_1018619910 | 348 |
| 180 | 3300042620 | Ga0466728_122860 | Ga0466728_122860_8627_9697 | 356 |
| 181 | 3300042602 | Ga0466713_057971 | Ga0466713_057971_66_1202 | 378 |
| 182 | 3300042621 | Ga0466729_120951 | Ga0466729_120951_6541_7695 | 384 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01551 | Peptidase_M23 | Peptidase family M23 | 260 | 355 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.52 | 0.59 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.