Protein Family IF06065
Metagenome
Isolate
279
Members
234
Samples
97
Scaffolds
218.67
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_047188|Ga0466713_047188_126513_127337
- Length
- 240 aa
- Sequence
- LTAILHTLWIPFDFILHIDTHLPAIMDSYGLWVYAILFLILFCETGLVVTPFLPGDSLIFAAGALAASGAMNIWLLAVLLAVAAVGGDACNYLIGEKFGDALLRRLNGRLIKPQHITETEAFFDRHGGKTILLARFVPFIRTFAPFVAGIGKMHYGRFARYNVTGGLIWTWGFLLLGFFFGNIPFVKHNFEYVILGIIAISLIPMVVKAIQGRLKARRQPAPGVTTDEGRRAPGTRNGDA
Sample Types
Isolate
65.2%
Metagenome
34.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
28.9%
Drosophilidae
10.2%
Apidae
9.8%
Anthocoridae
6.7%
Muscidae
5.8%
Termitidae
5.3%
Curculionidae
4.4%
Calliphoridae
4.0%
Culicidae
3.6%
Tenebrionidae
3.6%
Tephritidae
2.2%
Aphididae
1.8%
Cerambycidae
1.8%
Kalotermitidae
1.3%
Sarcophagidae
0.9%
Pentatomidae
0.9%
Armadillidiidae
0.9%
Pteromalidae
0.9%
Formicidae
0.9%
Scarabaeidae
0.4%
Ceratophyllidae
0.4%
Daphniidae
0.4%
Hodotermitidae
0.4%
Rhinotermitidae
0.4%
Thripidae
0.4%
Anthomyiidae
0.4%
Reduviidae
0.4%
Rhopalidae
0.4%
Carabidae
0.4%
Siricidae
0.4%
Passalidae
0.4%
Crambidae
0.4%
Plutellidae
0.4%
Taxonomy
Archaea
0
Bacteria
250
Eukaryota
0
Viruses
0
Unclassified
29
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 2 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 3 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 4 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 5 | 2684622911 | Lactobacillus kullabergensis Lb_186 | Isolate | Unclassified |
| 6 | 2684622914 | Lactobacillus helsinborgensis Lb_183 | Isolate | Unclassified |
| 7 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 8 | 2758568507 | Lactobacillus bombicola ESL0237 | Isolate | Unclassified |
| 9 | 2758568508 | Lactobacillus bombicola ESL0236 | Isolate | Unclassified |
| 10 | 2758568512 | Lactobacillus helsingborgensis ESL0262 | Isolate | Unclassified |
| 11 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 12 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 13 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 14 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 15 | 2958885890 | Lactobacillus sp. ESL0234 | Isolate | Apidae |
| 16 | 2961465228 | Lactobacillus sp. ESL0233 | Isolate | Apidae |
| 17 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 18 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 19 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 20 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 21 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 22 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 23 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 26 | 2968368220 | Lactobacillus bombicola OCC3 | Isolate | Apidae |
| 27 | 2971062614 | Lactobacillus bombicola BI-4G | Isolate | Apidae |
| 28 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 29 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 30 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 31 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 32 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 33 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 34 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 35 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 36 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 37 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 38 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 39 | 2758568501 | Lactobacillus bombicola ESL0228 | Isolate | Unclassified |
| 40 | 2758568502 | Lactobacillus bombicola ESL0247 | Isolate | Unclassified |
| 41 | 2758568503 | Lactobacillus bombicola ESL0246 | Isolate | Unclassified |
| 42 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 43 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 44 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 45 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 46 | 2820907832 | Unclassified Actinobacteria Emb289P4bin29 | Isolate | Unclassified |
| 47 | 2851410423 | Lactobacillus helsingborgensis ESL0183 | Isolate | Apidae |
| 48 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 49 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 50 | 8004832522 | Lactobacillus sp. ESL0236 | Isolate | Apidae |
| 51 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 52 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 53 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 54 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 55 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 56 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 57 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 58 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 59 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 60 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 61 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 62 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 63 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 64 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 65 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 66 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 67 | 2758568505 | Lactobacillus bombicola ESL0225 | Isolate | Unclassified |
| 68 | 2758568514 | Lactobacillus kullabergensis ESL0261 | Isolate | Unclassified |
| 69 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 70 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 71 | 2821322763 | Unclassified Actinobacteria Cu122P5bin19 | Isolate | Unclassified |
| 72 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 73 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 74 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 75 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 76 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 77 | 2958255616 | Serratia marcescens TM | Isolate | |
| 78 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 79 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 80 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 81 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 82 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 83 | 8017536074 | Lactobacillus sp. ESL0261 | Isolate | Apidae |
| 84 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 85 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 86 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 87 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 88 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 89 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 90 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 91 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 92 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | |
| 93 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 94 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 95 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 96 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 97 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 98 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 99 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 100 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 101 | 2912324399 | Lactobacillus apis ESL0185 | Isolate | Apidae |
| 102 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 103 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 104 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 105 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 106 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 107 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 108 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 109 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 110 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 111 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 112 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 113 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 114 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 115 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 116 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 117 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 118 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 119 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 120 | 2758568504 | Lactobacillus bombicola ESL0245 | Isolate | Unclassified |
| 121 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 122 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 123 | 2820942695 | Unclassified Actinobacteria Cu122P5bin37 | Isolate | Unclassified |
| 124 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 125 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 126 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 127 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 128 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 129 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 130 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 131 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 132 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 133 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 134 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 135 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 136 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 137 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 138 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 139 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 140 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 141 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 142 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 143 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 144 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 145 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 146 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 147 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 148 | 2799112229 | Lactobacillus sp. ESL0413 | Isolate | Unclassified |
| 149 | 2799112230 | Lactobacillus sp. ESL0416 | Isolate | Unclassified |
| 150 | 2785510748 | Lactobacillus sp. ESL0409 | Isolate | Apidae |
| 151 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 152 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 153 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 154 | 2877513988 | Lactobacillus kullabergensis ESL0186 | Isolate | Apidae |
| 155 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 156 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 157 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 158 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 159 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 160 | 8017440191 | Lactobacillus bombicola L5-31 | Isolate | Apidae |
| 161 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 162 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 163 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 164 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 165 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 166 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 167 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 168 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 169 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 170 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 171 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 172 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 173 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 174 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 175 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 176 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 177 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 178 | 2758568509 | Lactobacillus bombicola ESL0234 | Isolate | Unclassified |
| 179 | 2758568510 | Lactobacillus bombicola ESL0233 | Isolate | Unclassified |
| 180 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 181 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 182 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 183 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 184 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 185 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 186 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 187 | 2882334426 | Lactobacillus sp. 2-3 | Isolate | Unclassified |
| 188 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 189 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 190 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 191 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 192 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 193 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 194 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 195 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 196 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 197 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 198 | 3300005306 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 1 gut | Metagenome | Drosophilidae |
| 199 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 200 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 201 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 202 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 203 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 204 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 205 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 206 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 207 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 208 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 209 | 2684622912 | Lactobacillus apis Lb_185 | Isolate | Unclassified |
| 210 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 211 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 212 | 2758568506 | Lactobacillus bombicola ESL0230 | Isolate | Unclassified |
| 213 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 214 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 215 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 216 | 2799112220 | Lactobacillus sp. ESL0411 | Isolate | Unclassified |
| 217 | 2814123166 | Lactobacillus apis LMG 26964 | Isolate | Apidae |
| 218 | 2820565217 | Unclassified Firmicutes Emb289P3bin51 | Isolate | Unclassified |
| 219 | 2820646798 | Unclassified Firmicutes Cu122P5bin36 | Isolate | Unclassified |
| 220 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 221 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 222 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 223 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 224 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 225 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 226 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 227 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 228 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 229 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 230 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 231 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 232 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 233 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 234 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_117458 | 3300042611 | Bacteria | 4951 |
| 2 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 3 | Ga0466717_261799 | 3300042604 | Unclassified | 4454 |
| 4 | Ga0466730_002938 | 3300042625 | Bacteria | 10903 |
| 5 | Ga0466730_049217 | 3300042625 | Unclassified | 8011 |
| 6 | Ga0123357_10034173 | 3300009784 | Bacteria | 6909 |
| 7 | Ga0123354_10510576 | 3300010882 | Bacteria | 930 |
| 8 | FGTW_contig30407 | 2065487013 | Bacteria | 95704 |
| 9 | 2227080778 | 2225789004 | Bacteria | 173705 |
| 10 | HBC_ctgsDRAFT_1001964 | 3300000333 | Bacteria | 4590 |
| 11 | JGI24699J35502_11132980 | 3300002509 | Bacteria | 8214 |
| 12 | Ga0074278_128743 | 3300005721 | Unclassified | 7732 |
| 13 | Ga0074278_141820 | 3300005721 | Unclassified | 1058 |
| 14 | Ga0123357_10000549 | 3300009784 | Bacteria | 36961 |
| 15 | Ga0160446_101677 | 3300012835 | Bacteria | 4437 |
| 16 | Ga0160455_100106 | 3300012837 | Bacteria | 123068 |
| 17 | Ga0265387_1000027 | 3300024582 | Bacteria | 58359 |
| 18 | Ga0466733_119867 | 3300042659 | Bacteria | 1043 |
| 19 | FGTW_contig10750 | 2065487013 | Unclassified | 2114 |
| 20 | Ga0063521_1000229 | 3300003973 | Bacteria | 38732 |
| 21 | Ga0068305_10002746 | 3300005083 | Bacteria | 66156 |
| 22 | Ga0072941_1433588 | 3300005201 | Bacteria | 1267 |
| 23 | Ga0127645_101857 | 3300009461 | Bacteria | 11206 |
| 24 | Ga0127524_145208 | 3300009478 | Unclassified | 2503 |
| 25 | Ga0247290_03994 | 3300035364 | Unclassified | 1088 |
| 26 | Ga0466706_127995 | 3300042599 | Bacteria | 4829 |
| 27 | Ga0466713_047188 | 3300042602 | Bacteria | 129907 |
| 28 | Ga0466713_140012 | 3300042602 | Bacteria | 490520 |
| 29 | Ga0466703_304012 | 3300042636 | Bacteria | 8782 |
| 30 | Ga0123353_10436729 | 3300010167 | Bacteria | 1933 |
| 31 | Ga0123354_10000074 | 3300010882 | Bacteria | 76467 |
| 32 | DPOL_contig12646 | 2035918003 | Bacteria | 137161 |
| 33 | HBC_ctgsDRAFT_1013408 | 3300000333 | Bacteria | 1973 |
| 34 | Meta3P_1003438 | 3300002464 | Unclassified | 1441 |
| 35 | Ga0063521_1000641 | 3300003973 | Bacteria | 13976 |
| 36 | Ga0127656_100968 | 3300009453 | Bacteria | 23282 |
| 37 | Ga0562379_0520 | 3300056790 | Bacteria | 76275 |
| 38 | Ga0562378_0378 | 3300056814 | Bacteria | 84059 |
| 39 | Ga0466706_211628 | 3300042599 | Bacteria | 1888 |
| 40 | Ga0466706_277869 | 3300042599 | Bacteria | 5071 |
| 41 | Ga0466730_101923 | 3300042625 | Unclassified | 2949 |
| 42 | Ga0466712_162752 | 3300042614 | Unclassified | 2388 |
| 43 | SWWA_contig02621__length_6605___numreads_117 | 2100351016 | Bacteria | 6605 |
| 44 | HBC_ctgsDRAFT_1000658 | 3300000333 | Bacteria | 7678 |
| 45 | CVPL010L_1000111 | 3300002932 | Bacteria | 91591 |
| 46 | Ga0063521_1000204 | 3300003973 | Bacteria | 42441 |
| 47 | Ga0068305_10053829 | 3300005083 | Bacteria | 2110 |
| 48 | Ga0074302_1144538 | 3300005316 | Unclassified | 944 |
| 49 | Ga0160460_100023 | 3300012845 | Bacteria | 338828 |
| 50 | Ga0562377_0035 | 3300056842 | Bacteria | 679350 |
| 51 | Ga0466713_001258 | 3300042602 | Unclassified | 4336 |
| 52 | Ga0466724_00966 | 3300042649 | Bacteria | 1859 |
| 53 | HBC_ctgsDRAFT_1004439 | 3300000333 | Bacteria | 3252 |
| 54 | Ga0074278_124462 | 3300005721 | Unclassified | 2363 |
| 55 | Ga0104041_1121461 | 3300007106 | Unclassified | 997 |
| 56 | Ga0466730_018844 | 3300042625 | Unclassified | 10732 |
| 57 | Ga0466730_039554 | 3300042625 | Unclassified | 2380 |
| 58 | Ga0466724_66289 | 3300042649 | Bacteria | 14060 |
| 59 | Ga0466705_388666 | 3300042612 | Bacteria | 2445 |
| 60 | Meta3P_1000129 | 3300002464 | Bacteria | 14244 |
| 61 | CVPL010L_1011934 | 3300002932 | Unclassified | 809 |
| 62 | Ga0074303_1076819 | 3300005306 | Bacteria | 992 |
| 63 | Ga0074278_105191 | 3300005721 | Unclassified | 1558 |
| 64 | Ga0104049_1142916 | 3300007103 | Unclassified | 769 |
| 65 | Ga0105005_1092146 | 3300007505 | Unclassified | 2715 |
| 66 | Ga0160443_100414 | 3300012848 | Bacteria | 33668 |
| 67 | Ga0316159_10270 | 3300030930 | Bacteria | 8581 |
| 68 | Ga0466707_130167 | 3300042601 | Bacteria | 1373 |
| 69 | Ga0466707_294519 | 3300042601 | Bacteria | 8629 |
| 70 | Ga0466713_098270 | 3300042602 | Bacteria | 331235 |
| 71 | Ga0466730_091231 | 3300042625 | Unclassified | 6715 |
| 72 | Ga0466724_60342 | 3300042649 | Unclassified | 1477 |
| 73 | Ga0123357_10521575 | 3300009784 | Bacteria | 970 |
| 74 | Ga0123356_10031537 | 3300010049 | Bacteria | 4959 |
| 75 | Ga0123354_10118394 | 3300010882 | Bacteria | 3439 |
| 76 | Ga0123354_10138358 | 3300010882 | Bacteria | 3029 |
| 77 | Ga0466715_415024 | 3300042616 | Bacteria | 28507 |
| 78 | Ga0063521_1000026 | 3300003973 | Bacteria | 128736 |
| 79 | Ga0063521_1000647 | 3300003973 | Unclassified | 13809 |
| 80 | Ga0104040_1036654 | 3300007149 | Bacteria | 5999 |
| 81 | Ga0105553_1035914 | 3300007767 | Unclassified | 23714 |
| 82 | Ga0247290_01532 | 3300035364 | Unclassified | 2552 |
| 83 | Ga0466698_096028 | 3300042610 | Bacteria | 7374 |
| 84 | Ga0466724_21305 | 3300042649 | Bacteria | 11335 |
| 85 | Ga0466724_23023 | 3300042649 | Bacteria | 116535 |
| 86 | Ga0123357_10064256 | 3300009784 | Bacteria | 4905 |
| 87 | Ga0123354_10084625 | 3300010882 | Unclassified | 4452 |
| 88 | DPOL_contig17022 | 2035918003 | Bacteria | 14858 |
| 89 | FGTW_contig32283 | 2065487013 | Unclassified | 2782 |
| 90 | Meta3P_1000074 | 3300002464 | Bacteria | 143082 |
| 91 | Ga0074188_1000313 | 3300005318 | Bacteria | 52641 |
| 92 | Ga0074278_141356 | 3300005721 | Unclassified | 1360 |
| 93 | Ga0104049_1027789 | 3300007103 | Bacteria | 3849 |
| 94 | Ga0104019_1198736 | 3300007150 | Unclassified | 1005 |
| 95 | Ga0104147_1075893 | 3300007224 | Bacteria | 3184 |
| 96 | Ga0105008_1091337 | 3300007507 | Bacteria | 3583 |
| 97 | Ga0316159_13796 | 3300030930 | Bacteria | 1315 |
Family Sequences
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF09335 | VTT_dom | VTT domain | 53 | 177 | 0.96 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.7 | 0.79 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.