Protein Family IF06056

Metagenome Isolate
114 Members
49 Samples
100 Scaffolds
285.5 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_035579|Ga0466713_035579_13577_14434
Length
280 aa
Sequence
MENGYRRKPDWLKSSLGNNDTFAATGKIVRDHRLHTICQSGRCPNLGECWNSGVATFMIAGDICTRSCKFCNTKTGKPLPLNPDEPAEIAEAVSRLRLKHAVITSVDRDDLPDCGAHHWAETIERIKQRNPATTVETLIPDFNGNHALLDLVVHCAPDIISHNMETTRRLTPTVRSVARYDTSLAVLSYVASTSAIPVKSGFMLGLGETADEIMQLMDDLLAAGCRLLSIGQYLQPSRKSLPVQDRFKELKQTALEKGFSRVESAPFVRSSYHSQDFLQI

📊 Sample Types

Isolate 12.3%
Metagenome 87.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 24.5%
Termitidae 22.4%
Unclassified 16.3%
Blattidae 14.3%
Rhinotermitidae 10.2%
Termopsidae 8.2%
Passalidae 2.0%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 111
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
2 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
3 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
4 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
5 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
6 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
7 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
8 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
9 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
10 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
11 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
12 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
13 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
14 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
18 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
19 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
20 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
24 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
25 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
26 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
27 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
30 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
31 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
32 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
33 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
34 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
35 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
36 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
37 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
38 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 2922326829 Bacteroides sp. 224 Isolate Blattidae
43 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
44 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
48 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
49 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0068305_10227354 3300005083 Unclassified 4130
2 Ga0123357_10000746 3300009784 Bacteria 32751
3 Ga0466706_033929 3300042599 Bacteria 10115
4 Ga0466706_084708 3300042599 Bacteria 32098
5 Ga0466713_035579 3300042602 Bacteria 26757
6 Ga0466716_293406 3300042605 Bacteria 10589
7 Ga0466722_174386 3300042609 Bacteria 3774
8 Ga0466715_123298 3300042616 Bacteria 4350
9 Ga0466715_482629 3300042616 Bacteria 44538
10 Ga0123354_10051404 3300010882 Bacteria 6224
11 Ga0466690_254172 3300042590 Bacteria 86143
12 Ga0466733_003525 3300042659 Bacteria 1764
13 JGI24705J35276_12225380 3300002504 Bacteria 2714
14 Ga0466713_099183 3300042602 Bacteria 118109
15 Ga0466722_131094 3300042609 Bacteria 6410
16 Ga0466722_145522 3300042609 Unclassified 2188
17 Ga0123357_10081438 3300009784 Bacteria 4255
18 Ga0123354_10192039 3300010882 Bacteria 2282
19 Ga0466696_022855 3300042596 Bacteria 2161
20 Ga0466703_358940 3300042636 Bacteria 5652
21 Ga0466704_106722 3300042643 Bacteria 2524
22 Ga0123357_10001423 3300009784 Bacteria 25372
23 Ga0466707_064209 3300042601 Bacteria 1668
24 Ga0466713_139940 3300042602 Bacteria 12471
25 Ga0466722_140734 3300042609 Bacteria 6297
26 Ga0466722_252686 3300042609 Bacteria 23171
27 Ga0466711_145261 3300042615 Bacteria 19745
28 Ga0466711_320609 3300042615 Bacteria 3466
29 Ga0466726_106548 3300042619 Bacteria 18359
30 Ga0123357_10019688 3300009784 Bacteria 9002
31 Ga0123353_10608629 3300010167 Bacteria 1559
32 Ga0466696_261654 3300042596 Bacteria 13040
33 Ga0466735_223306 3300042624 Bacteria 1550
34 Ga0466703_090204 3300042636 Bacteria 1730
35 Ga0466704_480748 3300042643 Bacteria 9356
36 IMNBL1DRAFT_c0000737 3300000062 Bacteria 25953
37 JGI24699J35502_11133903 3300002509 Bacteria 18625
38 Ga0466701_059539 3300042598 Bacteria 71898
39 Ga0466706_038890 3300042599 Bacteria 41377
40 Ga0466707_227644 3300042601 Bacteria 8399
41 Ga0466707_383253 3300042601 Bacteria 12746
42 Ga0466719_497203 3300042606 Bacteria 34034
43 Ga0466711_057059 3300042615 Bacteria 9676
44 Ga0466723_096161 3300042618 Bacteria 8180
45 Ga0123357_10158783 3300009784 Bacteria 2718
46 Ga0466690_005786 3300042590 Bacteria 23363
47 Ga0466690_013833 3300042590 Bacteria 20392
48 Ga0466690_070488 3300042590 Bacteria 7824
49 Ga0466692_164273 3300042591 Bacteria 1656
50 Ga0466729_239996 3300042621 Bacteria 15530
51 Ga0466735_182526 3300042624 Bacteria 2747
52 Ga0466735_191639 3300042624 Bacteria 6352
53 Ga0466704_318988 3300042643 Bacteria 22403
54 Ga0466705_062108 3300042612 Bacteria 15101
55 JGI24699J35502_11133420 3300002509 Bacteria 10458
56 Ga0068302_10151783 3300005071 Unclassified 1692
57 Ga0466700_332075 3300042600 Bacteria 5489
58 Ga0466700_390206 3300042600 Bacteria 53046
59 Ga0466719_381344 3300042606 Bacteria 5156
60 Ga0466705_441323 3300042612 Bacteria 2807
61 Ga0466729_129708 3300042621 Bacteria 17731
62 Ga0466729_154897 3300042621 Bacteria 5792
63 Ga0123356_10015890 3300010049 Bacteria 7201
64 Ga0123356_10312801 3300010049 Bacteria 1680
65 Ga0123354_10004276 3300010882 Bacteria 20176
66 Ga0123354_10009034 3300010882 Bacteria 15214
67 Ga0466708_150942 3300042652 Bacteria 4581
68 Ga0466727_000785 3300042655 Bacteria 3554
69 Ga0466727_081296 3300042655 Bacteria 4959
70 Ga0466705_283274 3300042612 Bacteria 2399
71 JGI24696J40584_12893826 3300002834 Bacteria 1145
72 Ga0123357_10000525 3300009784 Bacteria 37542
73 Ga0466719_026199 3300042606 Bacteria 1613
74 Ga0466691_093754 3300042593 Bacteria 19910
75 Ga0466696_255321 3300042596 Bacteria 4972
76 Ga0466727_156594 3300042655 Bacteria 16414
77 IMNBL1DRAFT_c0004337 3300000062 Bacteria 8571
78 JGI24702J35022_10008722 3300002462 Bacteria 5724
79 Ga0466707_026565 3300042601 Bacteria 22320
80 Ga0466711_163843 3300042615 Bacteria 21486
81 Ga0123354_10005536 3300010882 Bacteria 18409
82 Ga0466691_013387 3300042593 Bacteria 6459
83 Ga0466729_275874 3300042621 Bacteria 3334
84 Ga0466735_153946 3300042624 Bacteria 2201
85 Ga0466703_114473 3300042636 Bacteria 1693
86 Ga0466733_062604 3300042659 Bacteria 25271
87 JGI24699J35502_11041552 3300002509 Bacteria 1580
88 Ga0068305_10014241 3300005083 Bacteria 6861
89 Ga0466707_086436 3300042601 Bacteria 1512
90 Ga0466707_407745 3300042601 Bacteria 18219
91 Ga0466713_060620 3300042602 Bacteria 398690
92 Ga0466719_456313 3300042606 Bacteria 1242
93 Ga0466715_053218 3300042616 Bacteria 58360
94 Ga0123354_10006925 3300010882 Bacteria 16939
95 Ga0123354_10095888 3300010882 Bacteria 4057
96 Ga0466690_108459 3300042590 Bacteria 16679
97 Ga0466692_030135 3300042591 Bacteria 3655
98 Ga0466696_433035 3300042596 Bacteria 2296
99 Ga0466704_204908 3300042643 Bacteria 43948
100 Ga0466727_093466 3300042655 Bacteria 3657

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042652 Ga0466708_150942 Ga0466708_150942_2527_3387 266
2 3300042612 Ga0466705_062108 Ga0466705_062108_13397_14242 272
3 3300042609 Ga0466722_140734 Ga0466722_140734_4950_5780 276
4 3300042591 Ga0466692_164273 Ga0466692_164273_813_1646 277
5 3300042593 Ga0466691_093754 Ga0466691_093754_14331_15167 278
6 3300042606 Ga0466719_381344 Ga0466719_381344_413_1249 278
7 3300042606 Ga0466719_497203 Ga0466719_497203_32404_33240 278
8 iso_pr_bacteria 2820778767 2820779864 278
9 3300009784 Ga0123357_10001423 Ga0123357_1000142313 279
10 3300042598 Ga0466701_059539 Ga0466701_059539_39584_40423 279
11 3300010167 Ga0123353_10608629 Ga0123353_106086292 280
12 3300042601 Ga0466707_086436 Ga0466707_086436_168_1010 280
13 3300042602 Ga0466713_035579 Ga0466713_035579_13577_14434 280
14 3300042602 Ga0466713_099183 Ga0466713_099183_26402_27244 280
15 3300042612 Ga0466705_441323 Ga0466705_441323_1582_2424 280
16 3300042615 Ga0466711_145261 Ga0466711_145261_16867_17709 280
17 3300042616 Ga0466715_123298 Ga0466715_123298_3202_4044 280
18 3300042621 Ga0466729_154897 Ga0466729_154897_1566_2408 280
19 3300042659 Ga0466733_003525 Ga0466733_003525_30_872 280
20 3300042659 Ga0466733_062604 Ga0466733_062604_18365_19207 280
21 iso_pr_bacteria 2910926975 2910927465 280
22 iso_pr_bacteria 2940244548 2940246708 280
23 iso_pr_bacteria 2940248789 2940250716 280
24 iso_pr_bacteria 2940253009 2940254791 280
25 iso_pr_bacteria 8100166142 8100170246 280
26 3300042600 Ga0466700_390206 Ga0466700_390206_40508_41353 281
27 3300042624 Ga0466735_223306 Ga0466735_223306_245_1090 281
28 iso_pr_bacteria 2609459943 2610740368 281
29 iso_pr_bacteria 2830041218 2830043677 281
30 3300042591 Ga0466692_030135 Ga0466692_030135_2783_3631 282
31 3300042599 Ga0466706_084708 Ga0466706_084708_20250_21098 282
32 3300042601 Ga0466707_064209 Ga0466707_064209_82_930 282
33 3300042602 Ga0466713_060620 Ga0466713_060620_366142_366990 282
34 3300042609 Ga0466722_131094 Ga0466722_131094_4041_4889 282
35 3300042615 Ga0466711_057059 Ga0466711_057059_3315_4163 282
36 3300042616 Ga0466715_482629 Ga0466715_482629_2498_3346 282
37 3300042636 Ga0466703_090204 Ga0466703_090204_693_1541 282
38 3300042655 Ga0466727_081296 Ga0466727_081296_2805_3653 282
39 3300002509 JGI24699J35502_11133420 JGI24699J35502_111334204 283
40 3300042590 Ga0466690_013833 Ga0466690_013833_4455_5306 283
41 3300042590 Ga0466690_254172 Ga0466690_254172_4333_5184 283
42 3300042601 Ga0466707_407745 Ga0466707_407745_14586_15437 283
43 3300042606 Ga0466719_456313 Ga0466719_456313_198_1049 283
44 3300042621 Ga0466729_239996 Ga0466729_239996_12982_13833 283
45 3300042596 Ga0466696_022855 Ga0466696_022855_592_1446 284
46 3300042596 Ga0466696_261654 Ga0466696_261654_3219_4073 284
47 3300042596 Ga0466696_433035 Ga0466696_433035_1136_1990 284
48 3300042615 Ga0466711_163843 Ga0466711_163843_13256_14110 284
49 3300042621 Ga0466729_129708 Ga0466729_129708_1317_2171 284
50 3300042624 Ga0466735_153946 Ga0466735_153946_980_1834 284
51 3300042643 Ga0466704_480748 Ga0466704_480748_7079_7933 284
52 iso_pr_bacteria 2910930387 2910932935 284
53 iso_pr_bacteria 2922326829 2922329692 284
54 3300005071 Ga0068302_10151783 Ga0068302_101517832 285
55 3300009784 Ga0123357_10000525 Ga0123357_1000052521 285
56 3300010882 Ga0123354_10095888 Ga0123354_100958883 285
57 3300042596 Ga0466696_255321 Ga0466696_255321_3514_4371 285
58 3300042599 Ga0466706_033929 Ga0466706_033929_5232_6089 285
59 3300042621 Ga0466729_275874 Ga0466729_275874_332_1189 285
60 3300042643 Ga0466704_106722 Ga0466704_106722_1082_1939 285
61 3300000062 IMNBL1DRAFT_c0000737 IMNBL1DRAFT_000073721 286
62 3300002834 JGI24696J40584_12893826 JGI24696J40584_128938262 286
63 3300005083 Ga0068305_10227354 Ga0068305_102273542 286
64 3300010882 Ga0123354_10005536 Ga0123354_100055369 286
65 3300042590 Ga0466690_005786 Ga0466690_005786_13266_14126 286
66 3300042599 Ga0466706_038890 Ga0466706_038890_19997_20857 286
67 3300042601 Ga0466707_383253 Ga0466707_383253_7628_8488 286
68 3300042605 Ga0466716_293406 Ga0466716_293406_3878_4738 286
69 3300042609 Ga0466722_145522 Ga0466722_145522_257_1117 286
70 3300042612 Ga0466705_283274 Ga0466705_283274_606_1466 286
71 3300042615 Ga0466711_320609 Ga0466711_320609_165_1025 286
72 3300042618 Ga0466723_096161 Ga0466723_096161_1253_2113 286
73 3300042619 Ga0466726_106548 Ga0466726_106548_6983_7843 286
74 3300042655 Ga0466727_000785 Ga0466727_000785_1921_2781 286
75 3300042655 Ga0466727_093466 Ga0466727_093466_785_1645 286
76 3300042655 Ga0466727_156594 Ga0466727_156594_8233_9093 286
77 iso_pr_bacteria 2940216256 2940216776 286
78 3300002504 JGI24705J35276_12225380 JGI24705J35276_122253802 287
79 3300010882 Ga0123354_10004276 Ga0123354_100042763 287
80 3300010882 Ga0123354_10051404 Ga0123354_100514047 287
81 iso_pr_bacteria 2820762746 2820763461 287
82 3300002509 JGI24699J35502_11133903 JGI24699J35502_111339036 288
83 3300009784 Ga0123357_10081438 Ga0123357_100814383 288
84 3300042593 Ga0466691_013387 Ga0466691_013387_1185_2051 288
85 3300042601 Ga0466707_227644 Ga0466707_227644_6267_7133 288
86 3300042624 Ga0466735_182526 Ga0466735_182526_195_1061 288
87 3300042636 Ga0466703_358940 Ga0466703_358940_2481_3374 288
88 3300002509 JGI24699J35502_11041552 JGI24699J35502_110415521 289
89 3300009784 Ga0123357_10000746 Ga0123357_1000074623 289
90 3300010882 Ga0123354_10006925 Ga0123354_100069252 289
91 3300010882 Ga0123354_10009034 Ga0123354_1000903411 289
92 3300042590 Ga0466690_108459 Ga0466690_108459_9549_10418 289
93 3300000062 IMNBL1DRAFT_c0004337 IMNBL1DRAFT_00043373 290
94 3300002462 JGI24702J35022_10008722 JGI24702J35022_100087224 290
95 3300010049 Ga0123356_10312801 Ga0123356_103128012 290
96 3300042590 Ga0466690_070488 Ga0466690_070488_672_1544 290
97 3300042600 Ga0466700_332075 Ga0466700_332075_4032_4904 290
98 3300042606 Ga0466719_026199 Ga0466719_026199_454_1326 290
99 3300042624 Ga0466735_191639 Ga0466735_191639_3237_4109 290
100 iso_pr_bacteria 2967483437 2967486406 290
101 3300009784 Ga0123357_10019688 Ga0123357_100196887 291
102 3300010882 Ga0123354_10192039 Ga0123354_101920392 291
103 3300042636 Ga0466703_114473 Ga0466703_114473_447_1322 291
104 3300009784 Ga0123357_10158783 Ga0123357_101587834 292
105 3300042609 Ga0466722_174386 Ga0466722_174386_2143_3024 293
106 3300042616 Ga0466715_053218 Ga0466715_053218_52394_53275 293
107 3300010049 Ga0123356_10015890 Ga0123356_100158903 294
108 3300042643 Ga0466704_204908 Ga0466704_204908_16967_17854 295
109 3300042643 Ga0466704_318988 Ga0466704_318988_16287_17177 296
110 iso_pr_bacteria 2820759988 2820760588 297
111 3300042602 Ga0466713_139940 Ga0466713_139940_2877_3773 298
112 3300005083 Ga0068305_10014241 Ga0068305_100142413 299
113 3300042609 Ga0466722_252686 Ga0466722_252686_6763_7680 305
114 3300042601 Ga0466707_026565 Ga0466707_026565_2747_3760 337

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04055 Radical_SAM Radical SAM superfamily 59 220 0.9

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.