Protein Family IF06042

Metagenome Isolate
205 Members
91 Samples
170 Scaffolds
338.9 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_026099|Ga0466713_026099_2545_3747
Length
386 aa
Sequence
MKQIATKDAVGNVLCHDITQIVPGQFKGARFTKGHVVTEEDIPVLLSLGKEHLYVWEKDDRMYHENEAAGILYRICVGEDGGGCFAAGEPSEGKINITAAMDGLLKADAPLQDALNGMGELVIASRHGNTTVKKGDLICGTRVVPLVIEKAKMERAVAAAAGRPIFRLLPFKKKRVGLVTTGTEVFLGRIEDKFGPVLRAKVEEFGSEIMGQTITDDDPAHIEEAIRSFLEKGADMVLCSGGMSVDPDDRTPLAVRNSVSRVVSYGAPVLPGSMLMLGYVDPEGQDALGNDSQPTSAVGSVASGAMEFGLGVTNAAVSAAPRPPIPVVGLPGCVMYSGRTIFDLVLPRLLADDPVTHEDMARMGRGGLCLKCPTCTFPNCGFGKGA

πŸ“Š Sample Types

Isolate 17.1%
Metagenome 82.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 28.6%
Blattidae 16.7%
Kalotermitidae 16.7%
Unclassified 15.5%
Tenebrionidae 7.1%
Termopsidae 3.6%
Rhinotermitidae 2.4%
Formicidae 2.4%
Passalidae 2.4%
Gomphidae 1.2%
Hodotermitidae 1.2%
Libellulidae 1.2%
Drosophilidae 1.2%

🌳 Taxonomy

Archaea 1
Bacteria 197
Eukaryota 0
Viruses 0
Unclassified 7

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
2 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
3 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
4 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
5 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
6 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
9 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
10 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
11 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
12 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
15 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
16 2820633305 Unclassified Firmicutes Emb289P1bin118 Isolate Unclassified
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
19 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
20 8007237282 Enterococcus sp. DIV0212c Isolate
21 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
22 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
23 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
24 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
25 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
26 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
27 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
28 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
29 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
30 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
31 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
32 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
33 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
34 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
35 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
36 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
37 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
38 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
39 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
40 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
41 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
42 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
44 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
45 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
46 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
47 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
48 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
49 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
50 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
51 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
52 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
53 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
54 2820729191 Unclassified Chloroflexi Th196P4bin49 Isolate Unclassified
55 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
56 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
57 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
58 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
59 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
60 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
61 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
62 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
63 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
64 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
65 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
66 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
67 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
68 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
69 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
70 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
71 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
72 2820412446 Unclassified Firmicutes Lab288P4bin39 Isolate Unclassified
73 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
74 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
75 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
76 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
77 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
78 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
79 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
80 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
81 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
82 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
83 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
84 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
85 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
86 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
87 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
88 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
89 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
90 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
91 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466703_065582 3300042636 Bacteria 3190
2 Ga0466703_238067 3300042636 Bacteria 1174
3 Ga0466704_429577 3300042643 Bacteria 2758
4 Ga0466694_040614 3300042594 Bacteria 4945
5 Ga0466694_171691 3300042594 Bacteria 2918
6 2227397487 2225789004 Bacteria 5797
7 JGI24702J35022_10003187 3300002462 Bacteria 9928
8 JGI24696J40584_12957797 3300002834 Bacteria 3695
9 CVPL010L_1001224 3300002932 Unclassified 6568
10 Ga0072941_1006576 3300005201 Bacteria 10343
11 Ga0123355_10039159 3300009826 Unclassified 7710
12 Ga0123356_10000389 3300010049 Bacteria 50169
13 Ga0123356_10024421 3300010049 Bacteria 5689
14 Ga0466722_175858 3300042609 Bacteria 3215
15 Ga0466712_246625 3300042614 Bacteria 1164
16 Ga0466711_017246 3300042615 Bacteria 24552
17 Ga0466718_005218 3300042617 Bacteria 1784
18 Ga0466723_369101 3300042618 Bacteria 5104
19 Ga0466728_456972 3300042620 Bacteria 56351
20 Ga0466705_184481 3300042612 Unclassified 23882
21 Ga0530661_000322 3300056564 Bacteria 37126
22 Ga0466703_107009 3300042636 Bacteria 17636
23 Ga0466703_122793 3300042636 Bacteria 7330
24 Ga0466704_061531 3300042643 Bacteria 5898
25 Ga0466704_062714 3300042643 Bacteria 13764
26 Ga0466704_063672 3300042643 Bacteria 4027
27 Ga0466704_467128 3300042643 Bacteria 7485
28 Ga0466709_360836 3300042648 Bacteria 116876
29 Ga0466708_015307 3300042652 Bacteria 6558
30 Ga0466691_049619 3300042593 Bacteria 15579
31 Ga0466696_133182 3300042596 Bacteria 1507
32 Ga0466696_492632 3300042596 Bacteria 3283
33 Ga0466699_370083 3300042597 Bacteria 1668
34 2227416933 2225789004 Unclassified 5656
35 Ga0123355_10160102 3300009826 Bacteria 3393
36 Ga0123356_10014796 3300010049 Bacteria 7491
37 Ga0123356_10114592 3300010049 Bacteria 2610
38 Ga0123353_10340583 3300010167 Bacteria 2265
39 Ga0466706_155789 3300042599 Bacteria 2094
40 Ga0466707_405371 3300042601 Bacteria 2934
41 Ga0466719_110529 3300042606 Bacteria 23182
42 Ga0466719_211842 3300042606 Bacteria 16447
43 Ga0466722_026700 3300042609 Bacteria 11792
44 Ga0466698_036737 3300042610 Bacteria 4368
45 Ga0466715_048882 3300042616 Bacteria 2840
46 Ga0466715_271874 3300042616 Bacteria 9236
47 Ga0466723_179504 3300042618 Bacteria 2783
48 Ga0466726_424318 3300042619 Bacteria 9917
49 Ga0466705_221402 3300042612 Bacteria 1672
50 Ga0562379_0363 3300056790 Bacteria 104557
51 Ga0562375_0096 3300056856 Bacteria 273717
52 Ga0264413_103345 3300024493 Bacteria 15115
53 Ga0466699_250685 3300042597 Bacteria 5050
54 Ga0123354_10149406 3300010882 Bacteria 2840
55 Ga0466717_261730 3300042604 Bacteria 14011
56 Ga0466716_034650 3300042605 Bacteria 5944
57 Ga0466705_525308 3300042612 Unclassified 4364
58 Ga0466715_289277 3300042616 Bacteria 1367
59 Ga0466723_049723 3300042618 Bacteria 2039
60 Ga0466723_052397 3300042618 Bacteria 2341
61 Ga0466732_283290 3300042656 Bacteria 2731
62 Ga0562374_2226 3300057007 Bacteria 18017
63 Ga0466704_263964 3300042643 Bacteria 3235
64 Ga0466709_090056 3300042648 Bacteria 7774
65 Ga0466708_108901 3300042652 Bacteria 52993
66 Ga0466727_217544 3300042655 Bacteria 1420
67 Ga0466727_334455 3300042655 Bacteria 5207
68 Ga0264413_109440 3300024493 Bacteria 7698
69 Ga0264413_112332 3300024493 Bacteria 2865
70 Ga0466690_047124 3300042590 Bacteria 3773
71 Ga0466696_226484 3300042596 Bacteria 17979
72 IMNBL1DRAFT_c0000220 3300000062 Bacteria 49966
73 JGI24702J35022_10008703 3300002462 Bacteria 5729
74 JGI24702J35022_10018182 3300002462 Bacteria 3834
75 Ga0123356_10201660 3300010049 Bacteria 2029
76 Ga0123356_10234628 3300010049 Bacteria 1901
77 Ga0123356_10459691 3300010049 Bacteria 1422
78 Ga0123353_10445533 3300010167 Bacteria 1908
79 Ga0466707_173413 3300042601 Bacteria 4570
80 Ga0466720_017457 3300042607 Bacteria 20604
81 Ga0466722_068601 3300042609 Archaea 8995
82 Ga0466705_430813 3300042612 Bacteria 2014
83 Ga0466728_038421 3300042620 Bacteria 3035
84 Ga0562375_0015 3300056856 Bacteria 1028412
85 Ga0562374_0232 3300057007 Bacteria 117733
86 Ga0466734_089252 3300042623 Bacteria 1827
87 Ga0466734_163042 3300042623 Bacteria 17910
88 Ga0466703_069047 3300042636 Bacteria 18125
89 Ga0466703_210075 3300042636 Bacteria 2933
90 Ga0466703_350079 3300042636 Bacteria 5254
91 Ga0466704_025917 3300042643 Bacteria 3010
92 Ga0466704_137252 3300042643 Bacteria 11127
93 Ga0466704_139452 3300042643 Bacteria 1999
94 Ga0466727_299751 3300042655 Bacteria 1244
95 Ga0466692_035205 3300042591 Bacteria 2079
96 Ga0466693_229656 3300042592 Unclassified 3972
97 Ga0466693_372397 3300042592 Unclassified 2545
98 Ga0466696_004589 3300042596 Bacteria 3288
99 Ga0466696_206987 3300042596 Bacteria 1774
100 JGI24698J34947_10018519 3300002449 Bacteria 3761
101 Ga0072940_1029056 3300005200 Bacteria 7886
102 Ga0123355_10002537 3300009826 Bacteria 25869
103 Ga0123356_10374963 3300010049 Bacteria 1554
104 Ga0123353_10010899 3300010167 Bacteria 12736
105 Ga0123354_10011021 3300010882 Bacteria 13947
106 Ga0466713_026099 3300042602 Bacteria 12087
107 Ga0466713_111278 3300042602 Bacteria 43297
108 Ga0466719_216267 3300042606 Bacteria 3435
109 Ga0466712_070917 3300042614 Bacteria 15304
110 Ga0466711_092684 3300042615 Bacteria 40177
111 Ga0466697_088510 3300042611 Bacteria 2286
112 Ga0466705_167806 3300042612 Bacteria 5472
113 Ga0466732_379669 3300042656 Bacteria 1549
114 Ga0562377_0462 3300056842 Bacteria 67757
115 Ga0466735_103632 3300042624 Bacteria 12116
116 Ga0466703_088852 3300042636 Bacteria 17634
117 Ga0466704_046043 3300042643 Bacteria 4275
118 Ga0466704_072859 3300042643 Bacteria 3504
119 Ga0466704_254224 3300042643 Bacteria 11788
120 Ga0466704_392840 3300042643 Bacteria 1783
121 Ga0466657_027211 3300042582 Bacteria 1463
122 Ga0466691_172571 3300042593 Bacteria 5726
123 Ga0466696_475774 3300042596 Bacteria 1918
124 JGI24695J34938_10013336 3300002450 Bacteria 4321
125 JGI24695J34938_10030302 3300002450 Bacteria 2521
126 Ga0123356_10019394 3300010049 Bacteria 6446
127 Ga0123356_10022380 3300010049 Bacteria 5970
128 Ga0123353_10123505 3300010167 Bacteria 4161
129 Ga0123354_10026191 3300010882 Bacteria 9196
130 Ga0466707_348494 3300042601 Bacteria 14383
131 Ga0466716_461640 3300042605 Bacteria 5303
132 Ga0466719_549337 3300042606 Bacteria 6650
133 Ga0466720_196514 3300042607 Bacteria 1330
134 Ga0466722_249654 3300042609 Bacteria 2791
135 Ga0466712_155403 3300042614 Bacteria 1260
136 Ga0466726_360230 3300042619 Bacteria 33657
137 Ga0466728_198217 3300042620 Bacteria 1219
138 Ga0562375_0126 3300056856 Bacteria 230981
139 Ga0562374_0133 3300057007 Bacteria 186554
140 Ga0466703_089065 3300042636 Bacteria 4497
141 Ga0466704_539096 3300042643 Bacteria 3414
142 Ga0466727_025567 3300042655 Bacteria 1874
143 Ga0466690_072217 3300042590 Bacteria 1401
144 Ga0466690_251390 3300042590 Bacteria 2014
145 Ga0123357_10258348 3300009784 Bacteria 1847
146 Ga0466700_116120 3300042600 Bacteria 2235
147 Ga0466707_335233 3300042601 Bacteria 21910
148 Ga0466722_237897 3300042609 Bacteria 1416
149 Ga0466712_178139 3300042614 Bacteria 3454
150 Ga0466705_149033 3300042612 Bacteria 15839
151 Ga0466705_311805 3300042612 Bacteria 4668
152 Ga0466691_090059 3300042593 Bacteria 7595
153 Ga0466696_230557 3300042596 Bacteria 4794
154 Ga0466699_057819 3300042597 Bacteria 7557
155 IMNBL1DRAFT_c0000009 3300000062 Bacteria 243341
156 JGI24695J34938_10031696 3300002450 Bacteria 2449
157 Ga0123355_10056676 3300009826 Bacteria 6341
158 Ga0123356_10048160 3300010049 Bacteria 3966
159 Ga0123353_10015983 3300010167 Bacteria 10944
160 Ga0123353_10061641 3300010167 Bacteria 6015
161 Ga0123353_10589268 3300010167 Bacteria 1593
162 Ga0466714_067634 3300042603 Bacteria 1163
163 Ga0466719_087573 3300042606 Bacteria 2788
164 Ga0466719_554262 3300042606 Bacteria 2661
165 Ga0466705_474292 3300042612 Bacteria 8803
166 Ga0466711_177484 3300042615 Bacteria 18577
167 Ga0466715_076343 3300042616 Bacteria 25139
168 Ga0466715_312103 3300042616 Bacteria 52011
169 Ga0466726_203949 3300042619 Bacteria 1691
170 Ga0466728_258466 3300042620 Bacteria 7285

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042597 Ga0466699_250685 Ga0466699_250685_22_879 285
2 3300005200 Ga0072940_1029056 Ga0072940_10290562 295
3 3300010167 Ga0123353_10445533 Ga0123353_104455333 295
4 3300042609 Ga0466722_175858 Ga0466722_175858_1360_2259 299
5 3300042606 Ga0466719_554262 Ga0466719_554262_1305_2225 306
6 3300042616 Ga0466715_048882 Ga0466715_048882_24_956 310
7 3300042655 Ga0466727_217544 Ga0466727_217544_157_1095 312
8 3300009784 Ga0123357_10258348 Ga0123357_102583482 313
9 3300042612 Ga0466705_525308 Ga0466705_525308_2189_3235 313
10 3300042594 Ga0466694_171691 Ga0466694_171691_1121_2125 314
11 3300042606 Ga0466719_216267 Ga0466719_216267_188_1210 320
12 3300042636 Ga0466703_069047 Ga0466703_069047_9746_10735 321
13 3300042590 Ga0466690_072217 Ga0466690_072217_48_1031 322
14 3300042652 Ga0466708_108901 Ga0466708_108901_43554_44585 323
15 3300056790 Ga0562379_0363 Ga0562379_0363_31711_32682 323
16 3300056856 Ga0562375_0096 Ga0562375_0096_36975_37946 323
17 iso_pr_bacteria 2740892556 2743947500 323
18 iso_pr_bacteria 647533136 647748169 323
19 iso_pr_bacteria 8077780672 8077781943 323
20 3300002932 CVPL010L_1001224 CVPL010L_10012249 324
21 3300056564 Ga0530661_000322 Ga0530661_000322_23065_24039 324
22 3300056842 Ga0562377_0462 Ga0562377_0462_54343_55317 324
23 3300056856 Ga0562375_0015 Ga0562375_0015_651154_652128 324
24 3300056856 Ga0562375_0126 Ga0562375_0126_27466_28440 324
25 3300057007 Ga0562374_0133 Ga0562374_0133_76072_77046 324
26 3300057007 Ga0562374_0232 Ga0562374_0232_77377_78351 324
27 3300057007 Ga0562374_2226 Ga0562374_2226_10178_11152 324
28 iso_pr_bacteria 8007237282 8007239594 324
29 iso_pr_bacteria 8012939035 8012940308 324
30 iso_pr_bacteria 8018798118 8018800926 324
31 iso_pr_bacteria 8018802046 8018802295 324
32 iso_pr_bacteria 8108576847 8108579957 324
33 iso_pr_bacteria 8114537524 8114540872 324
34 iso_pr_bacteria 8114541043 8114542360 324
35 iso_pr_bacteria 8114549044 8114552154 324
36 3300042652 Ga0466708_015307 Ga0466708_015307_2802_3842 326
37 3300042591 Ga0466692_035205 Ga0466692_035205_323_1306 327
38 3300042612 Ga0466705_474292 Ga0466705_474292_7383_8369 328
39 3300042636 Ga0466703_210075 Ga0466703_210075_169_1155 328
40 3300042643 Ga0466704_062714 Ga0466704_062714_7333_8319 328
41 3300042655 Ga0466727_299751 Ga0466727_299751_97_1083 328
42 3300042593 Ga0466691_049619 Ga0466691_049619_5805_6794 329
43 3300042605 Ga0466716_034650 Ga0466716_034650_4561_5550 329
44 3300042609 Ga0466722_237897 Ga0466722_237897_318_1307 329
45 3300042616 Ga0466715_271874 Ga0466715_271874_7477_8466 329
46 3300042619 Ga0466726_203949 Ga0466726_203949_234_1223 329
47 3300042620 Ga0466728_258466 Ga0466728_258466_3805_4794 329
48 3300042655 Ga0466727_025567 Ga0466727_025567_105_1094 329
49 3300042590 Ga0466690_047124 Ga0466690_047124_1390_2382 330
50 3300042596 Ga0466696_230557 Ga0466696_230557_1819_2811 330
51 3300042609 Ga0466722_026700 Ga0466722_026700_10290_11282 330
52 3300010167 Ga0123353_10589268 Ga0123353_105892681 333
53 3300042596 Ga0466696_004589 Ga0466696_004589_179_1180 333
54 3300042648 Ga0466709_090056 Ga0466709_090056_5467_6471 334
55 3300042592 Ga0466693_372397 Ga0466693_372397_828_1844 338
56 3300042602 Ga0466713_111278 Ga0466713_111278_2945_3961 338
57 3300042614 Ga0466712_155403 Ga0466712_155403_73_1089 338
58 iso_pr_bacteria 2636416028 2638993421 338
59 2225789004 2227397487 2227841302 339
60 2225789004 2227416933 2227858715 339
61 3300042599 Ga0466706_155789 Ga0466706_155789_177_1196 339
62 3300042601 Ga0466707_348494 Ga0466707_348494_6035_7054 339
63 3300042611 Ga0466697_088510 Ga0466697_088510_682_1701 339
64 3300042619 Ga0466726_360230 Ga0466726_360230_5163_6182 339
65 iso_pr_bacteria 2820234266 2820234786 339
66 3300000062 IMNBL1DRAFT_c0000009 IMNBL1DRAFT_0000009214 340
67 3300000062 IMNBL1DRAFT_c0000220 IMNBL1DRAFT_000022026 340
68 3300010049 Ga0123356_10019394 Ga0123356_100193944 340
69 3300010882 Ga0123354_10149406 Ga0123354_101494062 340
70 3300042594 Ga0466694_040614 Ga0466694_040614_2417_3439 340
71 3300042612 Ga0466705_221402 Ga0466705_221402_457_1479 340
72 3300042616 Ga0466715_289277 Ga0466715_289277_248_1270 340
73 3300042620 Ga0466728_038421 Ga0466728_038421_1422_2444 340
74 3300042624 Ga0466735_103632 Ga0466735_103632_1734_2756 340
75 3300042636 Ga0466703_350079 Ga0466703_350079_319_1341 340
76 3300042643 Ga0466704_139452 Ga0466704_139452_69_1091 340
77 3300042643 Ga0466704_467128 Ga0466704_467128_4148_5170 340
78 3300042655 Ga0466727_334455 Ga0466727_334455_543_1565 340
79 iso_pr_bacteria 2820633305 2820633944 340
80 3300002450 JGI24695J34938_10030302 JGI24695J34938_100303023 341
81 3300009826 Ga0123355_10002537 Ga0123355_100025373 341
82 3300009826 Ga0123355_10039159 Ga0123355_100391595 341
83 3300009826 Ga0123355_10160102 Ga0123355_101601023 341
84 3300010049 Ga0123356_10114592 Ga0123356_101145923 341
85 3300024493 Ga0264413_103345 Ga0264413_1033454 341
86 3300024493 Ga0264413_109440 Ga0264413_1094405 341
87 3300024493 Ga0264413_112332 Ga0264413_1123322 341
88 3300042593 Ga0466691_090059 Ga0466691_090059_1296_2321 341
89 3300042603 Ga0466714_067634 Ga0466714_067634_119_1144 341
90 3300042605 Ga0466716_461640 Ga0466716_461640_2524_3549 341
91 3300042606 Ga0466719_110529 Ga0466719_110529_9691_10716 341
92 3300042606 Ga0466719_211842 Ga0466719_211842_13834_14859 341
93 3300042606 Ga0466719_549337 Ga0466719_549337_3743_4768 341
94 3300042607 Ga0466720_196514 Ga0466720_196514_276_1301 341
95 3300042610 Ga0466698_036737 Ga0466698_036737_387_1412 341
96 3300042612 Ga0466705_311805 Ga0466705_311805_3514_4539 341
97 3300042614 Ga0466712_178139 Ga0466712_178139_2343_3368 341
98 3300042614 Ga0466712_246625 Ga0466712_246625_46_1071 341
99 3300042616 Ga0466715_312103 Ga0466715_312103_21204_22229 341
100 3300042618 Ga0466723_049723 Ga0466723_049723_1004_2029 341
101 3300042618 Ga0466723_369101 Ga0466723_369101_2922_3947 341
102 3300042636 Ga0466703_122793 Ga0466703_122793_2291_3316 341
103 3300042643 Ga0466704_061531 Ga0466704_061531_2913_3938 341
104 3300042643 Ga0466704_254224 Ga0466704_254224_1421_2446 341
105 3300042656 Ga0466732_283290 Ga0466732_283290_1337_2362 341
106 3300042656 Ga0466732_379669 Ga0466732_379669_301_1326 341
107 iso_pr_bacteria 2772190978 2773730525 341
108 iso_pr_bacteria 2820353569 2820353876 341
109 iso_pr_bacteria 2820693137 2820695249 341
110 iso_pr_bacteria 2820729191 2820730376 341
111 iso_pr_bacteria 2940230426 2940232029 341
112 iso_pr_bacteria 2940233634 2940235207 341
113 iso_pr_bacteria 2940264388 2940266071 341
114 iso_pr_bacteria 2940267548 2940269315 341
115 iso_pr_bacteria 2940270707 2940272474 341
116 iso_pr_bacteria 2940273867 2940275555 341
117 iso_pr_bacteria 2940277027 2940279291 341
118 iso_pr_bacteria 2940280053 2940282338 341
119 iso_pr_bacteria 2940283334 2940285113 341
120 iso_pr_bacteria 2940286528 2940289127 341
121 iso_pr_bacteria 2940289514 2940291036 341
122 iso_pr_bacteria 2940292506 2940294180 341
123 iso_pr_bacteria 2940295490 2940297045 341
124 iso_pr_bacteria 2944625312 2944627439 341
125 iso_pr_bacteria 2989309576 2989310607 341
126 3300002449 JGI24698J34947_10018519 JGI24698J34947_100185195 342
127 3300002450 JGI24695J34938_10013336 JGI24695J34938_100133364 342
128 3300002450 JGI24695J34938_10031696 JGI24695J34938_100316962 342
129 3300002462 JGI24702J35022_10003187 JGI24702J35022_1000318710 342
130 3300002462 JGI24702J35022_10018182 JGI24702J35022_100181822 342
131 3300002834 JGI24696J40584_12957797 JGI24696J40584_129577972 342
132 3300005201 Ga0072941_1006576 Ga0072941_10065762 342
133 3300010049 Ga0123356_10000389 Ga0123356_1000038910 342
134 3300010049 Ga0123356_10014796 Ga0123356_100147965 342
135 3300010049 Ga0123356_10024421 Ga0123356_100244214 342
136 3300010049 Ga0123356_10048160 Ga0123356_100481603 342
137 3300010049 Ga0123356_10201660 Ga0123356_102016602 342
138 3300010049 Ga0123356_10374963 Ga0123356_103749631 342
139 3300010049 Ga0123356_10459691 Ga0123356_104596912 342
140 3300010167 Ga0123353_10340583 Ga0123353_103405832 342
141 3300042590 Ga0466690_251390 Ga0466690_251390_269_1297 342
142 3300042620 Ga0466728_456972 Ga0466728_456972_36194_37222 342
143 3300042623 Ga0466734_089252 Ga0466734_089252_215_1243 342
144 3300042643 Ga0466704_063672 Ga0466704_063672_1248_2276 342
145 3300042643 Ga0466704_263964 Ga0466704_263964_1140_2168 342
146 3300042648 Ga0466709_360836 Ga0466709_360836_92906_93934 342
147 3300042582 Ga0466657_027211 Ga0466657_027211_343_1374 343
148 3300042592 Ga0466693_229656 Ga0466693_229656_627_1658 343
149 3300042601 Ga0466707_335233 Ga0466707_335233_8248_9279 343
150 3300042619 Ga0466726_424318 Ga0466726_424318_2289_3320 343
151 3300010167 Ga0123353_10015983 Ga0123353_100159838 344
152 3300010167 Ga0123353_10061641 Ga0123353_100616415 344
153 3300042597 Ga0466699_370083 Ga0466699_370083_48_1082 344
154 iso_pr_bacteria 2820412446 2820412972 344
155 3300009826 Ga0123355_10056676 Ga0123355_100566765 345
156 3300010882 Ga0123354_10011021 Ga0123354_100110217 345
157 3300042593 Ga0466691_172571 Ga0466691_172571_3908_4945 345
158 3300042596 Ga0466696_133182 Ga0466696_133182_341_1378 345
159 3300042600 Ga0466700_116120 Ga0466700_116120_618_1655 345
160 3300042604 Ga0466717_261730 Ga0466717_261730_640_1677 345
161 3300042606 Ga0466719_087573 Ga0466719_087573_1033_2070 345
162 3300042612 Ga0466705_184481 Ga0466705_184481_9300_10337 345
163 3300042617 Ga0466718_005218 Ga0466718_005218_382_1419 345
164 3300042620 Ga0466728_198217 Ga0466728_198217_82_1119 345
165 3300042636 Ga0466703_088852 Ga0466703_088852_4114_5151 345
166 3300042636 Ga0466703_107009 Ga0466703_107009_8527_9564 345
167 3300042636 Ga0466703_238067 Ga0466703_238067_111_1148 345
168 3300042643 Ga0466704_025917 Ga0466704_025917_1191_2228 345
169 3300042643 Ga0466704_539096 Ga0466704_539096_2202_3239 345
170 3300010882 Ga0123354_10026191 Ga0123354_1002619112 346
171 3300042597 Ga0466699_057819 Ga0466699_057819_1991_3031 346
172 3300042636 Ga0466703_089065 Ga0466703_089065_2705_3745 346
173 3300042643 Ga0466704_429577 Ga0466704_429577_1364_2404 346
174 3300042596 Ga0466696_206987 Ga0466696_206987_314_1357 347
175 3300042612 Ga0466705_430813 Ga0466705_430813_351_1394 347
176 3300042615 Ga0466711_177484 Ga0466711_177484_17340_18383 347
177 3300010049 Ga0123356_10234628 Ga0123356_102346282 348
178 3300042596 Ga0466696_226484 Ga0466696_226484_1020_2066 348
179 3300042601 Ga0466707_173413 Ga0466707_173413_3154_4200 348
180 3300042601 Ga0466707_405371 Ga0466707_405371_1323_2369 348
181 3300042609 Ga0466722_068601 Ga0466722_068601_124_1170 348
182 3300042612 Ga0466705_167806 Ga0466705_167806_2809_3855 348
183 3300042618 Ga0466723_052397 Ga0466723_052397_453_1499 348
184 3300042643 Ga0466704_072859 Ga0466704_072859_1434_2483 349
185 3300010167 Ga0123353_10123505 Ga0123353_101235054 350
186 3300010167 Ga0123353_10010899 Ga0123353_100108992 351
187 3300042596 Ga0466696_492632 Ga0466696_492632_252_1307 351
188 3300042615 Ga0466711_092684 Ga0466711_092684_35247_36302 351
189 3300010049 Ga0123356_10022380 Ga0123356_100223804 353
190 3300042636 Ga0466703_065582 Ga0466703_065582_1547_2608 353
191 3300042618 Ga0466723_179504 Ga0466723_179504_1139_2203 354
192 iso_pr_bacteria 2820223845 2820226509 354
193 3300042612 Ga0466705_149033 Ga0466705_149033_13041_14114 357
194 3300042616 Ga0466715_076343 Ga0466715_076343_3151_4227 358
195 3300042614 Ga0466712_070917 Ga0466712_070917_13106_14188 360
196 3300042607 Ga0466720_017457 Ga0466720_017457_13380_14468 362
197 3300042609 Ga0466722_249654 Ga0466722_249654_834_1928 364
198 3300042623 Ga0466734_163042 Ga0466734_163042_1614_2708 364
199 3300042643 Ga0466704_137252 Ga0466704_137252_370_1512 364
200 3300042643 Ga0466704_046043 Ga0466704_046043_255_1352 365
201 3300042596 Ga0466696_475774 Ga0466696_475774_179_1294 371
202 3300002462 JGI24702J35022_10008703 JGI24702J35022_100087034 372
203 3300042643 Ga0466704_392840 Ga0466704_392840_399_1520 373
204 3300042602 Ga0466713_026099 Ga0466713_026099_2545_3747 386
205 3300042615 Ga0466711_017246 Ga0466711_017246_12293_13468 391

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00994 MoCF_biosynth Probable molybdopterin binding domain 178 349 0.88

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.