Protein Family IF06042
Metagenome
Isolate
205
Members
91
Samples
170
Scaffolds
338.9
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_026099|Ga0466713_026099_2545_3747
- Length
- 386 aa
- Sequence
- MKQIATKDAVGNVLCHDITQIVPGQFKGARFTKGHVVTEEDIPVLLSLGKEHLYVWEKDDRMYHENEAAGILYRICVGEDGGGCFAAGEPSEGKINITAAMDGLLKADAPLQDALNGMGELVIASRHGNTTVKKGDLICGTRVVPLVIEKAKMERAVAAAAGRPIFRLLPFKKKRVGLVTTGTEVFLGRIEDKFGPVLRAKVEEFGSEIMGQTITDDDPAHIEEAIRSFLEKGADMVLCSGGMSVDPDDRTPLAVRNSVSRVVSYGAPVLPGSMLMLGYVDPEGQDALGNDSQPTSAVGSVASGAMEFGLGVTNAAVSAAPRPPIPVVGLPGCVMYSGRTIFDLVLPRLLADDPVTHEDMARMGRGGLCLKCPTCTFPNCGFGKGA
Sample Types
Isolate
17.1%
Metagenome
82.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.6%
Blattidae
16.7%
Kalotermitidae
16.7%
Unclassified
15.5%
Tenebrionidae
7.1%
Termopsidae
3.6%
Rhinotermitidae
2.4%
Formicidae
2.4%
Passalidae
2.4%
Gomphidae
1.2%
Hodotermitidae
1.2%
Libellulidae
1.2%
Drosophilidae
1.2%
Taxonomy
Archaea
1
Bacteria
197
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 2 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 3 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 4 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 5 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 6 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 9 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 10 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 11 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 12 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 15 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 16 | 2820633305 | Unclassified Firmicutes Emb289P1bin118 | Isolate | Unclassified |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 21 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 26 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 27 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 28 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 29 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 34 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 35 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 36 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 42 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 45 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 46 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 47 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 48 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 49 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 50 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 51 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 52 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 53 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 54 | 2820729191 | Unclassified Chloroflexi Th196P4bin49 | Isolate | Unclassified |
| 55 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 56 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 57 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 58 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 59 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 60 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 61 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 62 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 63 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 64 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 65 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 66 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 67 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 68 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 69 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 70 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 71 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 72 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 73 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 74 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 75 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 76 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 77 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 78 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 79 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 80 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 81 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 82 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 83 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 84 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 85 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 86 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 87 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 88 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 89 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 90 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 91 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466703_065582 | 3300042636 | Bacteria | 3190 |
| 2 | Ga0466703_238067 | 3300042636 | Bacteria | 1174 |
| 3 | Ga0466704_429577 | 3300042643 | Bacteria | 2758 |
| 4 | Ga0466694_040614 | 3300042594 | Bacteria | 4945 |
| 5 | Ga0466694_171691 | 3300042594 | Bacteria | 2918 |
| 6 | 2227397487 | 2225789004 | Bacteria | 5797 |
| 7 | JGI24702J35022_10003187 | 3300002462 | Bacteria | 9928 |
| 8 | JGI24696J40584_12957797 | 3300002834 | Bacteria | 3695 |
| 9 | CVPL010L_1001224 | 3300002932 | Unclassified | 6568 |
| 10 | Ga0072941_1006576 | 3300005201 | Bacteria | 10343 |
| 11 | Ga0123355_10039159 | 3300009826 | Unclassified | 7710 |
| 12 | Ga0123356_10000389 | 3300010049 | Bacteria | 50169 |
| 13 | Ga0123356_10024421 | 3300010049 | Bacteria | 5689 |
| 14 | Ga0466722_175858 | 3300042609 | Bacteria | 3215 |
| 15 | Ga0466712_246625 | 3300042614 | Bacteria | 1164 |
| 16 | Ga0466711_017246 | 3300042615 | Bacteria | 24552 |
| 17 | Ga0466718_005218 | 3300042617 | Bacteria | 1784 |
| 18 | Ga0466723_369101 | 3300042618 | Bacteria | 5104 |
| 19 | Ga0466728_456972 | 3300042620 | Bacteria | 56351 |
| 20 | Ga0466705_184481 | 3300042612 | Unclassified | 23882 |
| 21 | Ga0530661_000322 | 3300056564 | Bacteria | 37126 |
| 22 | Ga0466703_107009 | 3300042636 | Bacteria | 17636 |
| 23 | Ga0466703_122793 | 3300042636 | Bacteria | 7330 |
| 24 | Ga0466704_061531 | 3300042643 | Bacteria | 5898 |
| 25 | Ga0466704_062714 | 3300042643 | Bacteria | 13764 |
| 26 | Ga0466704_063672 | 3300042643 | Bacteria | 4027 |
| 27 | Ga0466704_467128 | 3300042643 | Bacteria | 7485 |
| 28 | Ga0466709_360836 | 3300042648 | Bacteria | 116876 |
| 29 | Ga0466708_015307 | 3300042652 | Bacteria | 6558 |
| 30 | Ga0466691_049619 | 3300042593 | Bacteria | 15579 |
| 31 | Ga0466696_133182 | 3300042596 | Bacteria | 1507 |
| 32 | Ga0466696_492632 | 3300042596 | Bacteria | 3283 |
| 33 | Ga0466699_370083 | 3300042597 | Bacteria | 1668 |
| 34 | 2227416933 | 2225789004 | Unclassified | 5656 |
| 35 | Ga0123355_10160102 | 3300009826 | Bacteria | 3393 |
| 36 | Ga0123356_10014796 | 3300010049 | Bacteria | 7491 |
| 37 | Ga0123356_10114592 | 3300010049 | Bacteria | 2610 |
| 38 | Ga0123353_10340583 | 3300010167 | Bacteria | 2265 |
| 39 | Ga0466706_155789 | 3300042599 | Bacteria | 2094 |
| 40 | Ga0466707_405371 | 3300042601 | Bacteria | 2934 |
| 41 | Ga0466719_110529 | 3300042606 | Bacteria | 23182 |
| 42 | Ga0466719_211842 | 3300042606 | Bacteria | 16447 |
| 43 | Ga0466722_026700 | 3300042609 | Bacteria | 11792 |
| 44 | Ga0466698_036737 | 3300042610 | Bacteria | 4368 |
| 45 | Ga0466715_048882 | 3300042616 | Bacteria | 2840 |
| 46 | Ga0466715_271874 | 3300042616 | Bacteria | 9236 |
| 47 | Ga0466723_179504 | 3300042618 | Bacteria | 2783 |
| 48 | Ga0466726_424318 | 3300042619 | Bacteria | 9917 |
| 49 | Ga0466705_221402 | 3300042612 | Bacteria | 1672 |
| 50 | Ga0562379_0363 | 3300056790 | Bacteria | 104557 |
| 51 | Ga0562375_0096 | 3300056856 | Bacteria | 273717 |
| 52 | Ga0264413_103345 | 3300024493 | Bacteria | 15115 |
| 53 | Ga0466699_250685 | 3300042597 | Bacteria | 5050 |
| 54 | Ga0123354_10149406 | 3300010882 | Bacteria | 2840 |
| 55 | Ga0466717_261730 | 3300042604 | Bacteria | 14011 |
| 56 | Ga0466716_034650 | 3300042605 | Bacteria | 5944 |
| 57 | Ga0466705_525308 | 3300042612 | Unclassified | 4364 |
| 58 | Ga0466715_289277 | 3300042616 | Bacteria | 1367 |
| 59 | Ga0466723_049723 | 3300042618 | Bacteria | 2039 |
| 60 | Ga0466723_052397 | 3300042618 | Bacteria | 2341 |
| 61 | Ga0466732_283290 | 3300042656 | Bacteria | 2731 |
| 62 | Ga0562374_2226 | 3300057007 | Bacteria | 18017 |
| 63 | Ga0466704_263964 | 3300042643 | Bacteria | 3235 |
| 64 | Ga0466709_090056 | 3300042648 | Bacteria | 7774 |
| 65 | Ga0466708_108901 | 3300042652 | Bacteria | 52993 |
| 66 | Ga0466727_217544 | 3300042655 | Bacteria | 1420 |
| 67 | Ga0466727_334455 | 3300042655 | Bacteria | 5207 |
| 68 | Ga0264413_109440 | 3300024493 | Bacteria | 7698 |
| 69 | Ga0264413_112332 | 3300024493 | Bacteria | 2865 |
| 70 | Ga0466690_047124 | 3300042590 | Bacteria | 3773 |
| 71 | Ga0466696_226484 | 3300042596 | Bacteria | 17979 |
| 72 | IMNBL1DRAFT_c0000220 | 3300000062 | Bacteria | 49966 |
| 73 | JGI24702J35022_10008703 | 3300002462 | Bacteria | 5729 |
| 74 | JGI24702J35022_10018182 | 3300002462 | Bacteria | 3834 |
| 75 | Ga0123356_10201660 | 3300010049 | Bacteria | 2029 |
| 76 | Ga0123356_10234628 | 3300010049 | Bacteria | 1901 |
| 77 | Ga0123356_10459691 | 3300010049 | Bacteria | 1422 |
| 78 | Ga0123353_10445533 | 3300010167 | Bacteria | 1908 |
| 79 | Ga0466707_173413 | 3300042601 | Bacteria | 4570 |
| 80 | Ga0466720_017457 | 3300042607 | Bacteria | 20604 |
| 81 | Ga0466722_068601 | 3300042609 | Archaea | 8995 |
| 82 | Ga0466705_430813 | 3300042612 | Bacteria | 2014 |
| 83 | Ga0466728_038421 | 3300042620 | Bacteria | 3035 |
| 84 | Ga0562375_0015 | 3300056856 | Bacteria | 1028412 |
| 85 | Ga0562374_0232 | 3300057007 | Bacteria | 117733 |
| 86 | Ga0466734_089252 | 3300042623 | Bacteria | 1827 |
| 87 | Ga0466734_163042 | 3300042623 | Bacteria | 17910 |
| 88 | Ga0466703_069047 | 3300042636 | Bacteria | 18125 |
| 89 | Ga0466703_210075 | 3300042636 | Bacteria | 2933 |
| 90 | Ga0466703_350079 | 3300042636 | Bacteria | 5254 |
| 91 | Ga0466704_025917 | 3300042643 | Bacteria | 3010 |
| 92 | Ga0466704_137252 | 3300042643 | Bacteria | 11127 |
| 93 | Ga0466704_139452 | 3300042643 | Bacteria | 1999 |
| 94 | Ga0466727_299751 | 3300042655 | Bacteria | 1244 |
| 95 | Ga0466692_035205 | 3300042591 | Bacteria | 2079 |
| 96 | Ga0466693_229656 | 3300042592 | Unclassified | 3972 |
| 97 | Ga0466693_372397 | 3300042592 | Unclassified | 2545 |
| 98 | Ga0466696_004589 | 3300042596 | Bacteria | 3288 |
| 99 | Ga0466696_206987 | 3300042596 | Bacteria | 1774 |
| 100 | JGI24698J34947_10018519 | 3300002449 | Bacteria | 3761 |
| 101 | Ga0072940_1029056 | 3300005200 | Bacteria | 7886 |
| 102 | Ga0123355_10002537 | 3300009826 | Bacteria | 25869 |
| 103 | Ga0123356_10374963 | 3300010049 | Bacteria | 1554 |
| 104 | Ga0123353_10010899 | 3300010167 | Bacteria | 12736 |
| 105 | Ga0123354_10011021 | 3300010882 | Bacteria | 13947 |
| 106 | Ga0466713_026099 | 3300042602 | Bacteria | 12087 |
| 107 | Ga0466713_111278 | 3300042602 | Bacteria | 43297 |
| 108 | Ga0466719_216267 | 3300042606 | Bacteria | 3435 |
| 109 | Ga0466712_070917 | 3300042614 | Bacteria | 15304 |
| 110 | Ga0466711_092684 | 3300042615 | Bacteria | 40177 |
| 111 | Ga0466697_088510 | 3300042611 | Bacteria | 2286 |
| 112 | Ga0466705_167806 | 3300042612 | Bacteria | 5472 |
| 113 | Ga0466732_379669 | 3300042656 | Bacteria | 1549 |
| 114 | Ga0562377_0462 | 3300056842 | Bacteria | 67757 |
| 115 | Ga0466735_103632 | 3300042624 | Bacteria | 12116 |
| 116 | Ga0466703_088852 | 3300042636 | Bacteria | 17634 |
| 117 | Ga0466704_046043 | 3300042643 | Bacteria | 4275 |
| 118 | Ga0466704_072859 | 3300042643 | Bacteria | 3504 |
| 119 | Ga0466704_254224 | 3300042643 | Bacteria | 11788 |
| 120 | Ga0466704_392840 | 3300042643 | Bacteria | 1783 |
| 121 | Ga0466657_027211 | 3300042582 | Bacteria | 1463 |
| 122 | Ga0466691_172571 | 3300042593 | Bacteria | 5726 |
| 123 | Ga0466696_475774 | 3300042596 | Bacteria | 1918 |
| 124 | JGI24695J34938_10013336 | 3300002450 | Bacteria | 4321 |
| 125 | JGI24695J34938_10030302 | 3300002450 | Bacteria | 2521 |
| 126 | Ga0123356_10019394 | 3300010049 | Bacteria | 6446 |
| 127 | Ga0123356_10022380 | 3300010049 | Bacteria | 5970 |
| 128 | Ga0123353_10123505 | 3300010167 | Bacteria | 4161 |
| 129 | Ga0123354_10026191 | 3300010882 | Bacteria | 9196 |
| 130 | Ga0466707_348494 | 3300042601 | Bacteria | 14383 |
| 131 | Ga0466716_461640 | 3300042605 | Bacteria | 5303 |
| 132 | Ga0466719_549337 | 3300042606 | Bacteria | 6650 |
| 133 | Ga0466720_196514 | 3300042607 | Bacteria | 1330 |
| 134 | Ga0466722_249654 | 3300042609 | Bacteria | 2791 |
| 135 | Ga0466712_155403 | 3300042614 | Bacteria | 1260 |
| 136 | Ga0466726_360230 | 3300042619 | Bacteria | 33657 |
| 137 | Ga0466728_198217 | 3300042620 | Bacteria | 1219 |
| 138 | Ga0562375_0126 | 3300056856 | Bacteria | 230981 |
| 139 | Ga0562374_0133 | 3300057007 | Bacteria | 186554 |
| 140 | Ga0466703_089065 | 3300042636 | Bacteria | 4497 |
| 141 | Ga0466704_539096 | 3300042643 | Bacteria | 3414 |
| 142 | Ga0466727_025567 | 3300042655 | Bacteria | 1874 |
| 143 | Ga0466690_072217 | 3300042590 | Bacteria | 1401 |
| 144 | Ga0466690_251390 | 3300042590 | Bacteria | 2014 |
| 145 | Ga0123357_10258348 | 3300009784 | Bacteria | 1847 |
| 146 | Ga0466700_116120 | 3300042600 | Bacteria | 2235 |
| 147 | Ga0466707_335233 | 3300042601 | Bacteria | 21910 |
| 148 | Ga0466722_237897 | 3300042609 | Bacteria | 1416 |
| 149 | Ga0466712_178139 | 3300042614 | Bacteria | 3454 |
| 150 | Ga0466705_149033 | 3300042612 | Bacteria | 15839 |
| 151 | Ga0466705_311805 | 3300042612 | Bacteria | 4668 |
| 152 | Ga0466691_090059 | 3300042593 | Bacteria | 7595 |
| 153 | Ga0466696_230557 | 3300042596 | Bacteria | 4794 |
| 154 | Ga0466699_057819 | 3300042597 | Bacteria | 7557 |
| 155 | IMNBL1DRAFT_c0000009 | 3300000062 | Bacteria | 243341 |
| 156 | JGI24695J34938_10031696 | 3300002450 | Bacteria | 2449 |
| 157 | Ga0123355_10056676 | 3300009826 | Bacteria | 6341 |
| 158 | Ga0123356_10048160 | 3300010049 | Bacteria | 3966 |
| 159 | Ga0123353_10015983 | 3300010167 | Bacteria | 10944 |
| 160 | Ga0123353_10061641 | 3300010167 | Bacteria | 6015 |
| 161 | Ga0123353_10589268 | 3300010167 | Bacteria | 1593 |
| 162 | Ga0466714_067634 | 3300042603 | Bacteria | 1163 |
| 163 | Ga0466719_087573 | 3300042606 | Bacteria | 2788 |
| 164 | Ga0466719_554262 | 3300042606 | Bacteria | 2661 |
| 165 | Ga0466705_474292 | 3300042612 | Bacteria | 8803 |
| 166 | Ga0466711_177484 | 3300042615 | Bacteria | 18577 |
| 167 | Ga0466715_076343 | 3300042616 | Bacteria | 25139 |
| 168 | Ga0466715_312103 | 3300042616 | Bacteria | 52011 |
| 169 | Ga0466726_203949 | 3300042619 | Bacteria | 1691 |
| 170 | Ga0466728_258466 | 3300042620 | Bacteria | 7285 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042597 | Ga0466699_250685 | Ga0466699_250685_22_879 | 285 |
| 2 | 3300005200 | Ga0072940_1029056 | Ga0072940_10290562 | 295 |
| 3 | 3300010167 | Ga0123353_10445533 | Ga0123353_104455333 | 295 |
| 4 | 3300042609 | Ga0466722_175858 | Ga0466722_175858_1360_2259 | 299 |
| 5 | 3300042606 | Ga0466719_554262 | Ga0466719_554262_1305_2225 | 306 |
| 6 | 3300042616 | Ga0466715_048882 | Ga0466715_048882_24_956 | 310 |
| 7 | 3300042655 | Ga0466727_217544 | Ga0466727_217544_157_1095 | 312 |
| 8 | 3300009784 | Ga0123357_10258348 | Ga0123357_102583482 | 313 |
| 9 | 3300042612 | Ga0466705_525308 | Ga0466705_525308_2189_3235 | 313 |
| 10 | 3300042594 | Ga0466694_171691 | Ga0466694_171691_1121_2125 | 314 |
| 11 | 3300042606 | Ga0466719_216267 | Ga0466719_216267_188_1210 | 320 |
| 12 | 3300042636 | Ga0466703_069047 | Ga0466703_069047_9746_10735 | 321 |
| 13 | 3300042590 | Ga0466690_072217 | Ga0466690_072217_48_1031 | 322 |
| 14 | 3300042652 | Ga0466708_108901 | Ga0466708_108901_43554_44585 | 323 |
| 15 | 3300056790 | Ga0562379_0363 | Ga0562379_0363_31711_32682 | 323 |
| 16 | 3300056856 | Ga0562375_0096 | Ga0562375_0096_36975_37946 | 323 |
| 17 | iso_pr_bacteria | 2740892556 | 2743947500 | 323 |
| 18 | iso_pr_bacteria | 647533136 | 647748169 | 323 |
| 19 | iso_pr_bacteria | 8077780672 | 8077781943 | 323 |
| 20 | 3300002932 | CVPL010L_1001224 | CVPL010L_10012249 | 324 |
| 21 | 3300056564 | Ga0530661_000322 | Ga0530661_000322_23065_24039 | 324 |
| 22 | 3300056842 | Ga0562377_0462 | Ga0562377_0462_54343_55317 | 324 |
| 23 | 3300056856 | Ga0562375_0015 | Ga0562375_0015_651154_652128 | 324 |
| 24 | 3300056856 | Ga0562375_0126 | Ga0562375_0126_27466_28440 | 324 |
| 25 | 3300057007 | Ga0562374_0133 | Ga0562374_0133_76072_77046 | 324 |
| 26 | 3300057007 | Ga0562374_0232 | Ga0562374_0232_77377_78351 | 324 |
| 27 | 3300057007 | Ga0562374_2226 | Ga0562374_2226_10178_11152 | 324 |
| 28 | iso_pr_bacteria | 8007237282 | 8007239594 | 324 |
| 29 | iso_pr_bacteria | 8012939035 | 8012940308 | 324 |
| 30 | iso_pr_bacteria | 8018798118 | 8018800926 | 324 |
| 31 | iso_pr_bacteria | 8018802046 | 8018802295 | 324 |
| 32 | iso_pr_bacteria | 8108576847 | 8108579957 | 324 |
| 33 | iso_pr_bacteria | 8114537524 | 8114540872 | 324 |
| 34 | iso_pr_bacteria | 8114541043 | 8114542360 | 324 |
| 35 | iso_pr_bacteria | 8114549044 | 8114552154 | 324 |
| 36 | 3300042652 | Ga0466708_015307 | Ga0466708_015307_2802_3842 | 326 |
| 37 | 3300042591 | Ga0466692_035205 | Ga0466692_035205_323_1306 | 327 |
| 38 | 3300042612 | Ga0466705_474292 | Ga0466705_474292_7383_8369 | 328 |
| 39 | 3300042636 | Ga0466703_210075 | Ga0466703_210075_169_1155 | 328 |
| 40 | 3300042643 | Ga0466704_062714 | Ga0466704_062714_7333_8319 | 328 |
| 41 | 3300042655 | Ga0466727_299751 | Ga0466727_299751_97_1083 | 328 |
| 42 | 3300042593 | Ga0466691_049619 | Ga0466691_049619_5805_6794 | 329 |
| 43 | 3300042605 | Ga0466716_034650 | Ga0466716_034650_4561_5550 | 329 |
| 44 | 3300042609 | Ga0466722_237897 | Ga0466722_237897_318_1307 | 329 |
| 45 | 3300042616 | Ga0466715_271874 | Ga0466715_271874_7477_8466 | 329 |
| 46 | 3300042619 | Ga0466726_203949 | Ga0466726_203949_234_1223 | 329 |
| 47 | 3300042620 | Ga0466728_258466 | Ga0466728_258466_3805_4794 | 329 |
| 48 | 3300042655 | Ga0466727_025567 | Ga0466727_025567_105_1094 | 329 |
| 49 | 3300042590 | Ga0466690_047124 | Ga0466690_047124_1390_2382 | 330 |
| 50 | 3300042596 | Ga0466696_230557 | Ga0466696_230557_1819_2811 | 330 |
| 51 | 3300042609 | Ga0466722_026700 | Ga0466722_026700_10290_11282 | 330 |
| 52 | 3300010167 | Ga0123353_10589268 | Ga0123353_105892681 | 333 |
| 53 | 3300042596 | Ga0466696_004589 | Ga0466696_004589_179_1180 | 333 |
| 54 | 3300042648 | Ga0466709_090056 | Ga0466709_090056_5467_6471 | 334 |
| 55 | 3300042592 | Ga0466693_372397 | Ga0466693_372397_828_1844 | 338 |
| 56 | 3300042602 | Ga0466713_111278 | Ga0466713_111278_2945_3961 | 338 |
| 57 | 3300042614 | Ga0466712_155403 | Ga0466712_155403_73_1089 | 338 |
| 58 | iso_pr_bacteria | 2636416028 | 2638993421 | 338 |
| 59 | 2225789004 | 2227397487 | 2227841302 | 339 |
| 60 | 2225789004 | 2227416933 | 2227858715 | 339 |
| 61 | 3300042599 | Ga0466706_155789 | Ga0466706_155789_177_1196 | 339 |
| 62 | 3300042601 | Ga0466707_348494 | Ga0466707_348494_6035_7054 | 339 |
| 63 | 3300042611 | Ga0466697_088510 | Ga0466697_088510_682_1701 | 339 |
| 64 | 3300042619 | Ga0466726_360230 | Ga0466726_360230_5163_6182 | 339 |
| 65 | iso_pr_bacteria | 2820234266 | 2820234786 | 339 |
| 66 | 3300000062 | IMNBL1DRAFT_c0000009 | IMNBL1DRAFT_0000009214 | 340 |
| 67 | 3300000062 | IMNBL1DRAFT_c0000220 | IMNBL1DRAFT_000022026 | 340 |
| 68 | 3300010049 | Ga0123356_10019394 | Ga0123356_100193944 | 340 |
| 69 | 3300010882 | Ga0123354_10149406 | Ga0123354_101494062 | 340 |
| 70 | 3300042594 | Ga0466694_040614 | Ga0466694_040614_2417_3439 | 340 |
| 71 | 3300042612 | Ga0466705_221402 | Ga0466705_221402_457_1479 | 340 |
| 72 | 3300042616 | Ga0466715_289277 | Ga0466715_289277_248_1270 | 340 |
| 73 | 3300042620 | Ga0466728_038421 | Ga0466728_038421_1422_2444 | 340 |
| 74 | 3300042624 | Ga0466735_103632 | Ga0466735_103632_1734_2756 | 340 |
| 75 | 3300042636 | Ga0466703_350079 | Ga0466703_350079_319_1341 | 340 |
| 76 | 3300042643 | Ga0466704_139452 | Ga0466704_139452_69_1091 | 340 |
| 77 | 3300042643 | Ga0466704_467128 | Ga0466704_467128_4148_5170 | 340 |
| 78 | 3300042655 | Ga0466727_334455 | Ga0466727_334455_543_1565 | 340 |
| 79 | iso_pr_bacteria | 2820633305 | 2820633944 | 340 |
| 80 | 3300002450 | JGI24695J34938_10030302 | JGI24695J34938_100303023 | 341 |
| 81 | 3300009826 | Ga0123355_10002537 | Ga0123355_100025373 | 341 |
| 82 | 3300009826 | Ga0123355_10039159 | Ga0123355_100391595 | 341 |
| 83 | 3300009826 | Ga0123355_10160102 | Ga0123355_101601023 | 341 |
| 84 | 3300010049 | Ga0123356_10114592 | Ga0123356_101145923 | 341 |
| 85 | 3300024493 | Ga0264413_103345 | Ga0264413_1033454 | 341 |
| 86 | 3300024493 | Ga0264413_109440 | Ga0264413_1094405 | 341 |
| 87 | 3300024493 | Ga0264413_112332 | Ga0264413_1123322 | 341 |
| 88 | 3300042593 | Ga0466691_090059 | Ga0466691_090059_1296_2321 | 341 |
| 89 | 3300042603 | Ga0466714_067634 | Ga0466714_067634_119_1144 | 341 |
| 90 | 3300042605 | Ga0466716_461640 | Ga0466716_461640_2524_3549 | 341 |
| 91 | 3300042606 | Ga0466719_110529 | Ga0466719_110529_9691_10716 | 341 |
| 92 | 3300042606 | Ga0466719_211842 | Ga0466719_211842_13834_14859 | 341 |
| 93 | 3300042606 | Ga0466719_549337 | Ga0466719_549337_3743_4768 | 341 |
| 94 | 3300042607 | Ga0466720_196514 | Ga0466720_196514_276_1301 | 341 |
| 95 | 3300042610 | Ga0466698_036737 | Ga0466698_036737_387_1412 | 341 |
| 96 | 3300042612 | Ga0466705_311805 | Ga0466705_311805_3514_4539 | 341 |
| 97 | 3300042614 | Ga0466712_178139 | Ga0466712_178139_2343_3368 | 341 |
| 98 | 3300042614 | Ga0466712_246625 | Ga0466712_246625_46_1071 | 341 |
| 99 | 3300042616 | Ga0466715_312103 | Ga0466715_312103_21204_22229 | 341 |
| 100 | 3300042618 | Ga0466723_049723 | Ga0466723_049723_1004_2029 | 341 |
| 101 | 3300042618 | Ga0466723_369101 | Ga0466723_369101_2922_3947 | 341 |
| 102 | 3300042636 | Ga0466703_122793 | Ga0466703_122793_2291_3316 | 341 |
| 103 | 3300042643 | Ga0466704_061531 | Ga0466704_061531_2913_3938 | 341 |
| 104 | 3300042643 | Ga0466704_254224 | Ga0466704_254224_1421_2446 | 341 |
| 105 | 3300042656 | Ga0466732_283290 | Ga0466732_283290_1337_2362 | 341 |
| 106 | 3300042656 | Ga0466732_379669 | Ga0466732_379669_301_1326 | 341 |
| 107 | iso_pr_bacteria | 2772190978 | 2773730525 | 341 |
| 108 | iso_pr_bacteria | 2820353569 | 2820353876 | 341 |
| 109 | iso_pr_bacteria | 2820693137 | 2820695249 | 341 |
| 110 | iso_pr_bacteria | 2820729191 | 2820730376 | 341 |
| 111 | iso_pr_bacteria | 2940230426 | 2940232029 | 341 |
| 112 | iso_pr_bacteria | 2940233634 | 2940235207 | 341 |
| 113 | iso_pr_bacteria | 2940264388 | 2940266071 | 341 |
| 114 | iso_pr_bacteria | 2940267548 | 2940269315 | 341 |
| 115 | iso_pr_bacteria | 2940270707 | 2940272474 | 341 |
| 116 | iso_pr_bacteria | 2940273867 | 2940275555 | 341 |
| 117 | iso_pr_bacteria | 2940277027 | 2940279291 | 341 |
| 118 | iso_pr_bacteria | 2940280053 | 2940282338 | 341 |
| 119 | iso_pr_bacteria | 2940283334 | 2940285113 | 341 |
| 120 | iso_pr_bacteria | 2940286528 | 2940289127 | 341 |
| 121 | iso_pr_bacteria | 2940289514 | 2940291036 | 341 |
| 122 | iso_pr_bacteria | 2940292506 | 2940294180 | 341 |
| 123 | iso_pr_bacteria | 2940295490 | 2940297045 | 341 |
| 124 | iso_pr_bacteria | 2944625312 | 2944627439 | 341 |
| 125 | iso_pr_bacteria | 2989309576 | 2989310607 | 341 |
| 126 | 3300002449 | JGI24698J34947_10018519 | JGI24698J34947_100185195 | 342 |
| 127 | 3300002450 | JGI24695J34938_10013336 | JGI24695J34938_100133364 | 342 |
| 128 | 3300002450 | JGI24695J34938_10031696 | JGI24695J34938_100316962 | 342 |
| 129 | 3300002462 | JGI24702J35022_10003187 | JGI24702J35022_1000318710 | 342 |
| 130 | 3300002462 | JGI24702J35022_10018182 | JGI24702J35022_100181822 | 342 |
| 131 | 3300002834 | JGI24696J40584_12957797 | JGI24696J40584_129577972 | 342 |
| 132 | 3300005201 | Ga0072941_1006576 | Ga0072941_10065762 | 342 |
| 133 | 3300010049 | Ga0123356_10000389 | Ga0123356_1000038910 | 342 |
| 134 | 3300010049 | Ga0123356_10014796 | Ga0123356_100147965 | 342 |
| 135 | 3300010049 | Ga0123356_10024421 | Ga0123356_100244214 | 342 |
| 136 | 3300010049 | Ga0123356_10048160 | Ga0123356_100481603 | 342 |
| 137 | 3300010049 | Ga0123356_10201660 | Ga0123356_102016602 | 342 |
| 138 | 3300010049 | Ga0123356_10374963 | Ga0123356_103749631 | 342 |
| 139 | 3300010049 | Ga0123356_10459691 | Ga0123356_104596912 | 342 |
| 140 | 3300010167 | Ga0123353_10340583 | Ga0123353_103405832 | 342 |
| 141 | 3300042590 | Ga0466690_251390 | Ga0466690_251390_269_1297 | 342 |
| 142 | 3300042620 | Ga0466728_456972 | Ga0466728_456972_36194_37222 | 342 |
| 143 | 3300042623 | Ga0466734_089252 | Ga0466734_089252_215_1243 | 342 |
| 144 | 3300042643 | Ga0466704_063672 | Ga0466704_063672_1248_2276 | 342 |
| 145 | 3300042643 | Ga0466704_263964 | Ga0466704_263964_1140_2168 | 342 |
| 146 | 3300042648 | Ga0466709_360836 | Ga0466709_360836_92906_93934 | 342 |
| 147 | 3300042582 | Ga0466657_027211 | Ga0466657_027211_343_1374 | 343 |
| 148 | 3300042592 | Ga0466693_229656 | Ga0466693_229656_627_1658 | 343 |
| 149 | 3300042601 | Ga0466707_335233 | Ga0466707_335233_8248_9279 | 343 |
| 150 | 3300042619 | Ga0466726_424318 | Ga0466726_424318_2289_3320 | 343 |
| 151 | 3300010167 | Ga0123353_10015983 | Ga0123353_100159838 | 344 |
| 152 | 3300010167 | Ga0123353_10061641 | Ga0123353_100616415 | 344 |
| 153 | 3300042597 | Ga0466699_370083 | Ga0466699_370083_48_1082 | 344 |
| 154 | iso_pr_bacteria | 2820412446 | 2820412972 | 344 |
| 155 | 3300009826 | Ga0123355_10056676 | Ga0123355_100566765 | 345 |
| 156 | 3300010882 | Ga0123354_10011021 | Ga0123354_100110217 | 345 |
| 157 | 3300042593 | Ga0466691_172571 | Ga0466691_172571_3908_4945 | 345 |
| 158 | 3300042596 | Ga0466696_133182 | Ga0466696_133182_341_1378 | 345 |
| 159 | 3300042600 | Ga0466700_116120 | Ga0466700_116120_618_1655 | 345 |
| 160 | 3300042604 | Ga0466717_261730 | Ga0466717_261730_640_1677 | 345 |
| 161 | 3300042606 | Ga0466719_087573 | Ga0466719_087573_1033_2070 | 345 |
| 162 | 3300042612 | Ga0466705_184481 | Ga0466705_184481_9300_10337 | 345 |
| 163 | 3300042617 | Ga0466718_005218 | Ga0466718_005218_382_1419 | 345 |
| 164 | 3300042620 | Ga0466728_198217 | Ga0466728_198217_82_1119 | 345 |
| 165 | 3300042636 | Ga0466703_088852 | Ga0466703_088852_4114_5151 | 345 |
| 166 | 3300042636 | Ga0466703_107009 | Ga0466703_107009_8527_9564 | 345 |
| 167 | 3300042636 | Ga0466703_238067 | Ga0466703_238067_111_1148 | 345 |
| 168 | 3300042643 | Ga0466704_025917 | Ga0466704_025917_1191_2228 | 345 |
| 169 | 3300042643 | Ga0466704_539096 | Ga0466704_539096_2202_3239 | 345 |
| 170 | 3300010882 | Ga0123354_10026191 | Ga0123354_1002619112 | 346 |
| 171 | 3300042597 | Ga0466699_057819 | Ga0466699_057819_1991_3031 | 346 |
| 172 | 3300042636 | Ga0466703_089065 | Ga0466703_089065_2705_3745 | 346 |
| 173 | 3300042643 | Ga0466704_429577 | Ga0466704_429577_1364_2404 | 346 |
| 174 | 3300042596 | Ga0466696_206987 | Ga0466696_206987_314_1357 | 347 |
| 175 | 3300042612 | Ga0466705_430813 | Ga0466705_430813_351_1394 | 347 |
| 176 | 3300042615 | Ga0466711_177484 | Ga0466711_177484_17340_18383 | 347 |
| 177 | 3300010049 | Ga0123356_10234628 | Ga0123356_102346282 | 348 |
| 178 | 3300042596 | Ga0466696_226484 | Ga0466696_226484_1020_2066 | 348 |
| 179 | 3300042601 | Ga0466707_173413 | Ga0466707_173413_3154_4200 | 348 |
| 180 | 3300042601 | Ga0466707_405371 | Ga0466707_405371_1323_2369 | 348 |
| 181 | 3300042609 | Ga0466722_068601 | Ga0466722_068601_124_1170 | 348 |
| 182 | 3300042612 | Ga0466705_167806 | Ga0466705_167806_2809_3855 | 348 |
| 183 | 3300042618 | Ga0466723_052397 | Ga0466723_052397_453_1499 | 348 |
| 184 | 3300042643 | Ga0466704_072859 | Ga0466704_072859_1434_2483 | 349 |
| 185 | 3300010167 | Ga0123353_10123505 | Ga0123353_101235054 | 350 |
| 186 | 3300010167 | Ga0123353_10010899 | Ga0123353_100108992 | 351 |
| 187 | 3300042596 | Ga0466696_492632 | Ga0466696_492632_252_1307 | 351 |
| 188 | 3300042615 | Ga0466711_092684 | Ga0466711_092684_35247_36302 | 351 |
| 189 | 3300010049 | Ga0123356_10022380 | Ga0123356_100223804 | 353 |
| 190 | 3300042636 | Ga0466703_065582 | Ga0466703_065582_1547_2608 | 353 |
| 191 | 3300042618 | Ga0466723_179504 | Ga0466723_179504_1139_2203 | 354 |
| 192 | iso_pr_bacteria | 2820223845 | 2820226509 | 354 |
| 193 | 3300042612 | Ga0466705_149033 | Ga0466705_149033_13041_14114 | 357 |
| 194 | 3300042616 | Ga0466715_076343 | Ga0466715_076343_3151_4227 | 358 |
| 195 | 3300042614 | Ga0466712_070917 | Ga0466712_070917_13106_14188 | 360 |
| 196 | 3300042607 | Ga0466720_017457 | Ga0466720_017457_13380_14468 | 362 |
| 197 | 3300042609 | Ga0466722_249654 | Ga0466722_249654_834_1928 | 364 |
| 198 | 3300042623 | Ga0466734_163042 | Ga0466734_163042_1614_2708 | 364 |
| 199 | 3300042643 | Ga0466704_137252 | Ga0466704_137252_370_1512 | 364 |
| 200 | 3300042643 | Ga0466704_046043 | Ga0466704_046043_255_1352 | 365 |
| 201 | 3300042596 | Ga0466696_475774 | Ga0466696_475774_179_1294 | 371 |
| 202 | 3300002462 | JGI24702J35022_10008703 | JGI24702J35022_100087034 | 372 |
| 203 | 3300042643 | Ga0466704_392840 | Ga0466704_392840_399_1520 | 373 |
| 204 | 3300042602 | Ga0466713_026099 | Ga0466713_026099_2545_3747 | 386 |
| 205 | 3300042615 | Ga0466711_017246 | Ga0466711_017246_12293_13468 | 391 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00994 | MoCF_biosynth | Probable molybdopterin binding domain | 178 | 349 | 0.88 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.79 | 0.84 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.