Protein Family IF06033

Metagenome Isolate
186 Members
58 Samples
176 Scaffolds
412.72 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_022035|Ga0466713_022035_4247_5650
Length
444 aa
Sequence
MIDTFAEFKESKNIDRTTLISILEEAFRNVINKMFGTDENYDIIVNPDKGDFEIWRNRRVVPDGEKRNANLEISLSEARAIDPSYEVGEEITEGVDFAGFGRRAVLNLRQALASKILELQKDNVYNKYKNRIGQIVSAEVYQVWKKEVLLLDEEENELILPKLEQIPGDFFRKNESRRAVVVRVDNQNNNPKIILSRTSNLFMQRLFELEVPEINDGLITIRKIARIPGERAKVAVESYDERIDPVGACVGMKGARIHGIVRELCNENIDVVNFTTNTALFIQRALSPAKISSIKIHEAEKKAEVFLRPEEVSLAIGKNGLNIKLAGMLTEYTIDVFRDEDQDIDDIYLEEFSDEIEMWVIDVLKNIGCFTARNVLDMDRAELIEKSDLEESTIDEVLDVLRAEFQTDDEGDYYKGEPAVAPSAQPQTVEADETQQSQAKAEAE

πŸ“Š Sample Types

Isolate 5.4%
Metagenome 94.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 31.0%
Kalotermitidae 24.1%
Unclassified 15.5%
Rhinotermitidae 8.6%
Blattidae 5.2%
Drosophilidae 5.2%
Termopsidae 5.2%
Passalidae 3.4%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 163
Eukaryota 0
Viruses 0
Unclassified 23

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
2 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
3 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
4 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
5 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
6 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
7 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
8 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
9 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
10 2920168565 Paludibacter sp. 221 Isolate Blattidae
11 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
12 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
13 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
14 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
15 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
18 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
24 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
31 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
32 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
33 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
34 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
35 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
36 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
37 3004667792 Bacteroides sp. 519 Isolate Blattidae
38 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
39 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
40 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
41 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
42 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
43 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
44 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
45 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
46 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
47 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
48 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
49 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
50 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
51 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
52 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
53 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
54 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
55 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
56 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
57 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
58 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0456237_0000012 3300041968 Bacteria 42362
2 Ga0466692_178028 3300042591 Bacteria 52823
3 Ga0466696_001065 3300042596 Bacteria 27233
4 Ga0466696_045491 3300042596 Bacteria 16251
5 Ga0466696_283248 3300042596 Bacteria 2001
6 Ga0466700_486430 3300042600 Bacteria 19114
7 Ga0466707_270832 3300042601 Bacteria 16847
8 Ga0466722_007433 3300042609 Bacteria 9152
9 Ga0466722_062829 3300042609 Bacteria 60409
10 Ga0466705_393232 3300042612 Bacteria 8108
11 Ga0466715_347127 3300042616 Bacteria 29283
12 Ga0466728_061829 3300042620 Unclassified 6207
13 Ga0466729_222748 3300042621 Bacteria 1684
14 Ga0466729_291077 3300042621 Bacteria 6599
15 Ga0466735_034318 3300042624 Bacteria 32071
16 Ga0466703_242416 3300042636 Bacteria 29100
17 Ga0466703_337195 3300042636 Unclassified 1962
18 Ga0466709_175756 3300042648 Unclassified 6204
19 Ga0123357_10046728 3300009784 Unclassified 5870
20 Ga0123357_10163486 3300009784 Unclassified 2660
21 Ga0123356_10199376 3300010049 Unclassified 2040
22 Ga0123354_10013687 3300010882 Bacteria 12601
23 2227463562 2225789004 Bacteria 5303
24 JGI24702J35022_10005654 3300002462 Bacteria 7290
25 JGI24705J35276_12223674 3300002504 Bacteria 2532
26 JGI24699J35502_11133905 3300002509 Bacteria 18660
27 Ga0123357_10000608 3300009784 Bacteria 35490
28 Ga0466691_054659 3300042593 Bacteria 12286
29 Ga0466701_075478 3300042598 Bacteria 63169
30 Ga0466700_370187 3300042600 Bacteria 13155
31 Ga0466713_101041 3300042602 Bacteria 22676
32 Ga0466734_012705 3300042623 Unclassified 1191
33 Ga0466735_108345 3300042624 Unclassified 3860
34 Ga0466703_044218 3300042636 Unclassified 2905
35 Ga0466704_115337 3300042643 Unclassified 5712
36 Ga0466704_194880 3300042643 Bacteria 28437
37 Ga0466709_160542 3300042648 Bacteria 33247
38 Ga0466727_184423 3300042655 Bacteria 96228
39 Ga0123357_10010646 3300009784 Bacteria 11718
40 Ga0123353_10078591 3300010167 Bacteria 5302
41 Ga0123354_10001957 3300010882 Bacteria 26332
42 2227194702 2225789004 Bacteria 7846
43 JGI24699J35502_11134171 3300002509 Bacteria 43800
44 Ga0466692_011323 3300042591 Bacteria 4785
45 Ga0466692_117229 3300042591 Bacteria 56912
46 Ga0466701_017652 3300042598 Bacteria 77230
47 Ga0466700_354582 3300042600 Bacteria 6573
48 Ga0466707_086860 3300042601 Bacteria 15465
49 Ga0466707_109399 3300042601 Bacteria 38291
50 Ga0466707_221207 3300042601 Bacteria 5596
51 Ga0466707_397590 3300042601 Bacteria 24173
52 Ga0466713_076063 3300042602 Bacteria 37576
53 Ga0466719_226361 3300042606 Bacteria 7607
54 Ga0466705_489022 3300042612 Bacteria 4490
55 Ga0466715_039553 3300042616 Bacteria 11622
56 Ga0466726_367016 3300042619 Bacteria 2931
57 Ga0466735_136106 3300042624 Bacteria 20578
58 Ga0466735_145486 3300042624 Bacteria 2749
59 Ga0466703_022704 3300042636 Bacteria 2988
60 Ga0466703_204432 3300042636 Unclassified 6478
61 Ga0466704_109385 3300042643 Bacteria 13575
62 Ga0466724_28891 3300042649 Bacteria 455231
63 Ga0466708_085155 3300042652 Bacteria 8423
64 Ga0466727_223266 3300042655 Unclassified 2809
65 Ga0466727_279703 3300042655 Bacteria 9453
66 Ga0123354_10000731 3300010882 Bacteria 35333
67 Ga0123354_10155886 3300010882 Unclassified 2740
68 IMNBL1DRAFT_c0004863 3300000062 Bacteria 7901
69 Ga0466705_106099 3300042612 Bacteria 11134
70 Ga0466690_179175 3300042590 Bacteria 10302
71 Ga0466696_150760 3300042596 Bacteria 3412
72 Ga0466701_032684 3300042598 Unclassified 5003
73 Ga0466701_039977 3300042598 Bacteria 63641
74 Ga0466706_207776 3300042599 Bacteria 9302
75 Ga0466713_002896 3300042602 Bacteria 13006
76 Ga0466713_022035 3300042602 Bacteria 8797
77 Ga0466713_091292 3300042602 Bacteria 5447
78 Ga0466714_041819 3300042603 Bacteria 104465
79 Ga0466722_178165 3300042609 Bacteria 29947
80 Ga0466715_046774 3300042616 Bacteria 9371
81 Ga0466726_060177 3300042619 Bacteria 18658
82 Ga0466735_015288 3300042624 Bacteria 4299
83 Ga0466735_201878 3300042624 Bacteria 1926
84 Ga0466704_058411 3300042643 Bacteria 4332
85 Ga0466727_172949 3300042655 Bacteria 2929
86 Ga0123357_10076524 3300009784 Bacteria 4418
87 Ga0123357_10143780 3300009784 Bacteria 2922
88 Ga0123356_10171946 3300010049 Bacteria 2178
89 IMNBL1DRAFT_c0003235 3300000062 Bacteria 10646
90 Ga0104050_1003906 3300007153 Unclassified 2523
91 Ga0123357_10001424 3300009784 Bacteria 25370
92 Ga0123357_10002273 3300009784 Bacteria 21284
93 Ga0466690_000900 3300042590 Bacteria 25440
94 Ga0466696_022762 3300042596 Bacteria 2870
95 Ga0466700_444780 3300042600 Bacteria 8343
96 Ga0466707_174178 3300042601 Bacteria 4433
97 Ga0466716_327539 3300042605 Bacteria 3413
98 Ga0466719_055936 3300042606 Unclassified 1424
99 Ga0466722_009345 3300042609 Bacteria 15631
100 Ga0466710_173868 3300042613 Bacteria 3880
101 Ga0466715_308255 3300042616 Bacteria 13742
102 Ga0466715_329842 3300042616 Bacteria 6657
103 Ga0466723_088640 3300042618 Bacteria 27215
104 Ga0466723_096407 3300042618 Bacteria 9683
105 Ga0466726_249468 3300042619 Bacteria 3518
106 Ga0466729_167121 3300042621 Bacteria 12010
107 Ga0466729_247545 3300042621 Bacteria 6761
108 Ga0466735_022385 3300042624 Bacteria 2613
109 Ga0466735_031351 3300042624 Bacteria 11211
110 Ga0466735_089659 3300042624 Bacteria 3321
111 Ga0466703_012871 3300042636 Bacteria 30811
112 Ga0123357_10063274 3300009784 Bacteria 4949
113 Ga0123357_10093591 3300009784 Bacteria 3905
114 Ga0123357_10137065 3300009784 Bacteria 3022
115 Ga0123356_10010461 3300010049 Bacteria 9106
116 Ga0123354_10002491 3300010882 Bacteria 24409
117 Ga0123354_10002936 3300010882 Bacteria 23138
118 Ga0123354_10067518 3300010882 Bacteria 5207
119 IMNBL1DRAFT_c0000089 3300000062 Bacteria 79556
120 JGI24699J35502_11134222 3300002509 Bacteria 70815
121 JGI24696J40584_12957540 3300002834 Bacteria 3566
122 JGI24696J40584_12961212 3300002834 Bacteria 12052
123 Ga0104045_1004545 3300007085 Unclassified 4565
124 Ga0104048_1003377 3300007143 Bacteria 6098
125 Ga0104048_1023164 3300007143 Bacteria 2029
126 Ga0123357_10000044 3300009784 Bacteria 100721
127 Ga0466705_284102 3300042612 Bacteria 6710
128 Ga0466690_018709 3300042590 Bacteria 16629
129 Ga0466692_054871 3300042591 Bacteria 17236
130 Ga0466707_182821 3300042601 Bacteria 20554
131 Ga0466707_348055 3300042601 Bacteria 31580
132 Ga0466713_103712 3300042602 Bacteria 27039
133 Ga0466719_207793 3300042606 Bacteria 5961
134 Ga0466719_364015 3300042606 Unclassified 5408
135 Ga0466711_067084 3300042615 Bacteria 3253
136 Ga0466715_606553 3300042616 Unclassified 4938
137 Ga0466726_391203 3300042619 Unclassified 2554
138 Ga0466729_226767 3300042621 Bacteria 2972
139 Ga0466703_071559 3300042636 Bacteria 7052
140 Ga0466725_323542 3300042654 Bacteria 20429
141 Ga0123357_10004948 3300009784 Bacteria 15815
142 Ga0123357_10006546 3300009784 Bacteria 14242
143 Ga0123357_10084103 3300009784 Unclassified 4172
144 Ga0123356_10245217 3300010049 Bacteria 1865
145 IMNBL1DRAFT_c0000232 3300000062 Bacteria 48886
146 Ga0466691_207492 3300042593 Bacteria 23046
147 Ga0466701_036771 3300042598 Bacteria 249987
148 Ga0466707_306666 3300042601 Bacteria 33300
149 Ga0466719_004777 3300042606 Bacteria 29050
150 Ga0466719_025131 3300042606 Bacteria 3570
151 Ga0466715_050259 3300042616 Bacteria 17796
152 Ga0466735_065965 3300042624 Unclassified 2032
153 Ga0466704_208476 3300042643 Bacteria 27718
154 Ga0466704_530737 3300042643 Bacteria 62264
155 Ga0466705_146921 3300042612 Bacteria 2594
156 Ga0466733_089411 3300042659 Bacteria 24735
157 Ga0466690_198941 3300042590 Bacteria 36398
158 Ga0466693_449509 3300042592 Bacteria 1380
159 Ga0466691_179139 3300042593 Bacteria 6647
160 Ga0466701_032389 3300042598 Bacteria 3676
161 Ga0466706_007154 3300042599 Bacteria 5781
162 Ga0466707_183664 3300042601 Bacteria 9147
163 Ga0466713_003716 3300042602 Bacteria 9024
164 Ga0466713_058794 3300042602 Bacteria 46658
165 Ga0466713_109303 3300042602 Bacteria 4573
166 Ga0466716_368592 3300042605 Bacteria 13085
167 Ga0466697_055968 3300042611 Bacteria 6961
168 Ga0466711_043128 3300042615 Bacteria 56831
169 Ga0466711_170854 3300042615 Bacteria 3248
170 Ga0466729_284308 3300042621 Bacteria 6333
171 Ga0466735_127120 3300042624 Bacteria 1516
172 Ga0466735_137448 3300042624 Bacteria 2434
173 Ga0466704_234435 3300042643 Bacteria 4362
174 Ga0466704_518725 3300042643 Bacteria 6019
175 JGI24702J35022_10009197 3300002462 Unclassified 5557
176 Ga0068305_10092271 3300005083 Bacteria 5232

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042602 Ga0466713_101041 Ga0466713_101041_3860_5098 370
2 3300042592 Ga0466693_449509 Ga0466693_449509_19_1146 375
3 3300042616 Ga0466715_606553 Ga0466715_606553_79_1206 375
4 3300042618 Ga0466723_096407 Ga0466723_096407_2348_3574 375
5 3300042621 Ga0466729_222748 Ga0466729_222748_93_1334 375
6 3300042623 Ga0466734_012705 Ga0466734_012705_54_1181 375
7 3300042643 Ga0466704_530737 Ga0466704_530737_10348_11601 375
8 3300042602 Ga0466713_103712 Ga0466713_103712_3483_4721 376
9 3300042606 Ga0466719_055936 Ga0466719_055936_19_1149 376
10 3300005083 Ga0068305_10092271 Ga0068305_100922713 382
11 3300010049 Ga0123356_10171946 Ga0123356_101719462 389
12 3300042601 Ga0466707_086860 Ga0466707_086860_3097_4356 392
13 3300042590 Ga0466690_018709 Ga0466690_018709_5344_6597 395
14 3300042619 Ga0466726_391203 Ga0466726_391203_573_1826 396
15 3300042601 Ga0466707_397590 Ga0466707_397590_12946_14187 397
16 3300042616 Ga0466715_329842 Ga0466715_329842_1623_2876 398
17 3300009784 Ga0123357_10004948 Ga0123357_1000494811 400
18 3300042621 Ga0466729_167121 Ga0466729_167121_2272_3534 403
19 3300042599 Ga0466706_007154 Ga0466706_007154_1361_2617 404
20 3300000062 IMNBL1DRAFT_c0004863 IMNBL1DRAFT_00048634 406
21 3300002834 JGI24696J40584_12961212 JGI24696J40584_129612125 407
22 3300042624 Ga0466735_022385 Ga0466735_022385_598_1857 407
23 3300010049 Ga0123356_10199376 Ga0123356_101993762 408
24 3300042590 Ga0466690_179175 Ga0466690_179175_5705_6931 408
25 3300042591 Ga0466692_117229 Ga0466692_117229_43056_44282 408
26 3300042593 Ga0466691_054659 Ga0466691_054659_5093_6319 408
27 3300042596 Ga0466696_022762 Ga0466696_022762_292_1518 408
28 3300042596 Ga0466696_150760 Ga0466696_150760_906_2132 408
29 3300042600 Ga0466700_444780 Ga0466700_444780_2425_3651 408
30 3300042601 Ga0466707_306666 Ga0466707_306666_26788_28014 408
31 3300042602 Ga0466713_109303 Ga0466713_109303_1950_3200 408
32 3300042606 Ga0466719_364015 Ga0466719_364015_3262_4488 408
33 3300042611 Ga0466697_055968 Ga0466697_055968_4044_5270 408
34 3300042612 Ga0466705_284102 Ga0466705_284102_1105_2331 408
35 3300042612 Ga0466705_393232 Ga0466705_393232_5983_7209 408
36 3300042612 Ga0466705_489022 Ga0466705_489022_3153_4409 408
37 3300042616 Ga0466715_050259 Ga0466715_050259_4427_5653 408
38 3300042621 Ga0466729_226767 Ga0466729_226767_244_1470 408
39 3300042621 Ga0466729_291077 Ga0466729_291077_2202_3428 408
40 3300042624 Ga0466735_108345 Ga0466735_108345_12_1238 408
41 3300042624 Ga0466735_127120 Ga0466735_127120_263_1489 408
42 3300042624 Ga0466735_201878 Ga0466735_201878_651_1907 408
43 3300042636 Ga0466703_022704 Ga0466703_022704_1563_2789 408
44 3300042636 Ga0466703_204432 Ga0466703_204432_4781_6007 408
45 3300042643 Ga0466704_115337 Ga0466704_115337_3006_4232 408
46 3300042643 Ga0466704_518725 Ga0466704_518725_3018_4244 408
47 3300010167 Ga0123353_10078591 Ga0123353_100785914 409
48 3300009784 Ga0123357_10006546 Ga0123357_100065469 410
49 3300009784 Ga0123357_10010646 Ga0123357_100106464 410
50 3300042593 Ga0466691_179139 Ga0466691_179139_1486_2718 410
51 3300042602 Ga0466713_076063 Ga0466713_076063_4742_5995 410
52 3300042605 Ga0466716_327539 Ga0466716_327539_20_1252 410
53 3300042606 Ga0466719_226361 Ga0466719_226361_4197_5450 410
54 3300042613 Ga0466710_173868 Ga0466710_173868_1637_2872 411
55 3300042598 Ga0466701_032389 Ga0466701_032389_1814_3052 412
56 3300042598 Ga0466701_032684 Ga0466701_032684_3139_4377 412
57 3300042598 Ga0466701_036771 Ga0466701_036771_36150_37388 412
58 3300042598 Ga0466701_075478 Ga0466701_075478_50071_51309 412
59 3300042649 Ga0466724_28891 Ga0466724_28891_54362_55600 412
60 3300042655 Ga0466727_223266 Ga0466727_223266_1386_2639 412
61 3300007085 Ga0104045_1004545 Ga0104045_10045452 413
62 3300007143 Ga0104048_1003377 Ga0104048_10033773 413
63 3300007143 Ga0104048_1023164 Ga0104048_10231642 413
64 3300007153 Ga0104050_1003906 Ga0104050_10039062 413
65 3300010049 Ga0123356_10245217 Ga0123356_102452171 415
66 3300002462 JGI24702J35022_10009197 JGI24702J35022_100091972 416
67 3300002509 JGI24699J35502_11134171 JGI24699J35502_111341714 416
68 3300010882 Ga0123354_10067518 Ga0123354_100675182 416
69 3300042590 Ga0466690_000900 Ga0466690_000900_8686_9936 416
70 3300042591 Ga0466692_178028 Ga0466692_178028_17173_18423 416
71 3300042596 Ga0466696_001065 Ga0466696_001065_25251_26501 416
72 3300042599 Ga0466706_207776 Ga0466706_207776_146_1396 416
73 3300042600 Ga0466700_354582 Ga0466700_354582_1700_2950 416
74 3300042600 Ga0466700_370187 Ga0466700_370187_4006_5256 416
75 3300042600 Ga0466700_486430 Ga0466700_486430_9798_11048 416
76 3300042601 Ga0466707_174178 Ga0466707_174178_2286_3536 416
77 3300042601 Ga0466707_348055 Ga0466707_348055_18028_19278 416
78 3300042605 Ga0466716_368592 Ga0466716_368592_10379_11629 416
79 3300042606 Ga0466719_004777 Ga0466719_004777_6089_7339 416
80 3300042606 Ga0466719_025131 Ga0466719_025131_826_2076 416
81 3300042609 Ga0466722_007433 Ga0466722_007433_7428_8678 416
82 3300042609 Ga0466722_009345 Ga0466722_009345_10002_11252 416
83 3300042609 Ga0466722_062829 Ga0466722_062829_49566_50816 416
84 3300042616 Ga0466715_039553 Ga0466715_039553_7132_8382 416
85 3300042616 Ga0466715_046774 Ga0466715_046774_704_1954 416
86 3300042618 Ga0466723_088640 Ga0466723_088640_17670_18920 416
87 3300042619 Ga0466726_367016 Ga0466726_367016_254_1504 416
88 3300042620 Ga0466728_061829 Ga0466728_061829_4922_6172 416
89 3300042621 Ga0466729_247545 Ga0466729_247545_587_1837 416
90 3300042624 Ga0466735_031351 Ga0466735_031351_8699_9949 416
91 3300042624 Ga0466735_089659 Ga0466735_089659_1818_3068 416
92 3300042624 Ga0466735_137448 Ga0466735_137448_524_1774 416
93 3300042636 Ga0466703_071559 Ga0466703_071559_807_2057 416
94 3300042643 Ga0466704_058411 Ga0466704_058411_608_1858 416
95 3300042643 Ga0466704_208476 Ga0466704_208476_13887_15137 416
96 3300042655 Ga0466727_172949 Ga0466727_172949_1255_2505 416
97 iso_pr_bacteria 2820759988 2820762452 416
98 2225789004 2227194702 2227618102 417
99 2225789004 2227463562 2227899422 417
100 3300002462 JGI24702J35022_10005654 JGI24702J35022_100056542 417
101 3300002504 JGI24705J35276_12223674 JGI24705J35276_122236742 417
102 3300002509 JGI24699J35502_11134222 JGI24699J35502_1113422216 417
103 3300009784 Ga0123357_10000608 Ga0123357_1000060824 417
104 3300009784 Ga0123357_10001424 Ga0123357_1000142410 417
105 3300009784 Ga0123357_10046728 Ga0123357_100467283 417
106 3300009784 Ga0123357_10093591 Ga0123357_100935914 417
107 3300009784 Ga0123357_10137065 Ga0123357_101370652 417
108 3300010049 Ga0123356_10010461 Ga0123356_100104617 417
109 3300010882 Ga0123354_10000731 Ga0123354_1000073116 417
110 3300010882 Ga0123354_10002936 Ga0123354_100029367 417
111 3300041968 Ga0456237_0000012 Ga0456237_0000012_36410_37663 417
112 3300042591 Ga0466692_011323 Ga0466692_011323_670_1923 417
113 3300042591 Ga0466692_054871 Ga0466692_054871_11763_13016 417
114 3300042596 Ga0466696_045491 Ga0466696_045491_8549_9802 417
115 3300042598 Ga0466701_039977 Ga0466701_039977_29282_30535 417
116 3300042601 Ga0466707_109399 Ga0466707_109399_7881_9134 417
117 3300042601 Ga0466707_182821 Ga0466707_182821_5848_7101 417
118 3300042601 Ga0466707_183664 Ga0466707_183664_1571_2824 417
119 3300042601 Ga0466707_221207 Ga0466707_221207_3719_4972 417
120 3300042601 Ga0466707_270832 Ga0466707_270832_2518_3771 417
121 3300042602 Ga0466713_003716 Ga0466713_003716_1891_3144 417
122 3300042602 Ga0466713_058794 Ga0466713_058794_24697_25950 417
123 3300042612 Ga0466705_106099 Ga0466705_106099_4297_5550 417
124 3300042612 Ga0466705_146921 Ga0466705_146921_169_1422 417
125 3300042615 Ga0466711_043128 Ga0466711_043128_47716_48969 417
126 3300042615 Ga0466711_170854 Ga0466711_170854_1402_2655 417
127 3300042619 Ga0466726_060177 Ga0466726_060177_7205_8458 417
128 3300042619 Ga0466726_249468 Ga0466726_249468_1822_3075 417
129 3300042621 Ga0466729_284308 Ga0466729_284308_2859_4112 417
130 3300042624 Ga0466735_015288 Ga0466735_015288_946_2199 417
131 3300042624 Ga0466735_065965 Ga0466735_065965_373_1626 417
132 3300042624 Ga0466735_136106 Ga0466735_136106_441_1694 417
133 3300042624 Ga0466735_145486 Ga0466735_145486_984_2237 417
134 3300042636 Ga0466703_012871 Ga0466703_012871_25474_26727 417
135 3300042636 Ga0466703_044218 Ga0466703_044218_1054_2307 417
136 3300042636 Ga0466703_242416 Ga0466703_242416_15611_16864 417
137 3300042636 Ga0466703_337195 Ga0466703_337195_290_1543 417
138 3300042643 Ga0466704_194880 Ga0466704_194880_16548_17801 417
139 3300042643 Ga0466704_234435 Ga0466704_234435_997_2250 417
140 3300042648 Ga0466709_160542 Ga0466709_160542_17072_18325 417
141 3300042648 Ga0466709_175756 Ga0466709_175756_2227_3480 417
142 3300042652 Ga0466708_085155 Ga0466708_085155_1755_3008 417
143 3300042655 Ga0466727_184423 Ga0466727_184423_10097_11350 417
144 3300042655 Ga0466727_279703 Ga0466727_279703_7016_8269 417
145 iso_pr_bacteria 2820762746 2820763480 417
146 iso_pr_bacteria 2940216256 2940216905 417
147 iso_pr_bacteria 2967483437 2967483586 417
148 iso_pr_bacteria 643348524 643422692 417
149 3300000062 IMNBL1DRAFT_c0000089 IMNBL1DRAFT_000008952 418
150 3300000062 IMNBL1DRAFT_c0000232 IMNBL1DRAFT_000023234 418
151 3300000062 IMNBL1DRAFT_c0003235 IMNBL1DRAFT_00032353 418
152 3300002509 JGI24699J35502_11133905 JGI24699J35502_1113390510 418
153 3300009784 Ga0123357_10002273 Ga0123357_100022736 418
154 3300009784 Ga0123357_10063274 Ga0123357_100632741 418
155 3300009784 Ga0123357_10076524 Ga0123357_100765242 418
156 3300009784 Ga0123357_10084103 Ga0123357_100841032 418
157 3300009784 Ga0123357_10143780 Ga0123357_101437803 418
158 3300009784 Ga0123357_10163486 Ga0123357_101634862 418
159 3300010882 Ga0123354_10001957 Ga0123354_100019573 418
160 3300010882 Ga0123354_10002491 Ga0123354_100024914 418
161 3300010882 Ga0123354_10013687 Ga0123354_100136879 418
162 3300010882 Ga0123354_10155886 Ga0123354_101558861 418
163 3300042590 Ga0466690_198941 Ga0466690_198941_28534_29790 418
164 3300042593 Ga0466691_207492 Ga0466691_207492_18071_19327 418
165 3300042598 Ga0466701_017652 Ga0466701_017652_59505_60761 418
166 3300042603 Ga0466714_041819 Ga0466714_041819_66466_67722 418
167 3300042609 Ga0466722_178165 Ga0466722_178165_921_2177 418
168 3300042643 Ga0466704_109385 Ga0466704_109385_3759_5015 418
169 iso_pr_bacteria 2820778767 2820778857 418
170 3300009784 Ga0123357_10000044 Ga0123357_1000004489 419
171 3300042602 Ga0466713_091292 Ga0466713_091292_2728_3987 419
172 3300042659 Ga0466733_089411 Ga0466733_089411_11317_12576 419
173 3300042616 Ga0466715_308255 Ga0466715_308255_7160_8422 420
174 iso_pr_bacteria 2920168565 2920171076 420
175 iso_pr_bacteria 3004667792 3004670941 420
176 iso_pr_bacteria 2609459943 2610740666 422
177 iso_pr_bacteria 2830041218 2830043027 422
178 3300042606 Ga0466719_207793 Ga0466719_207793_4498_5769 423
179 3300002834 JGI24696J40584_12957540 JGI24696J40584_129575403 424
180 3300042615 Ga0466711_067084 Ga0466711_067084_416_1690 424
181 3300042624 Ga0466735_034318 Ga0466735_034318_18644_19918 424
182 3300042616 Ga0466715_347127 Ga0466715_347127_19354_20652 432
183 3300042602 Ga0466713_002896 Ga0466713_002896_9776_11161 435
184 3300042654 Ga0466725_323542 Ga0466725_323542_6637_7944 435
185 3300042602 Ga0466713_022035 Ga0466713_022035_4247_5650 444
186 3300042596 Ga0466696_283248 Ga0466696_283248_477_1823 448

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13184 KH_5 NusA-like KH domain 228 296 0.99
PF08529 NusA_N NusA N-terminal domain 1 122 0.95
PF23095 305 336 0.9
PF07650 KH_2 KH domain 281 341 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF13184 GO:0003723 RNA binding MF

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.67 0.71 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.