Protein Family IF06023

Metagenome Metatranscriptome Isolate
152 Members
64 Samples
127 Scaffolds
375.2 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_011190|Ga0466713_011190_83284_84621
Length
445 aa
Sequence
MTRQRSSSVIIDLIHRLWTRLEIEFACEYNSLNINDQYYDFCVRRNTRKTSEQPAGMPEANEVLFWKGAGNMKKFLLALCGVCLMAGAGFAADTIKIGVVATMTGQNAFGGQLELEGMQLANKLHPEALGKKIELIIVDNKSDKVESANAASRLIEGDKVNALIGPYGSSATMAAGELAETAGIPLMGTACTNPLVTEGKKFVFRACFIDPFQGEAAANYAFNNLGYKKAAVLTDVASDYAVGLANFFKSNFTKLGGKIVADLKYQSGDTDFTSQLTAIIAQEPDVLFIPAYFAEGAIIMKQGYEQGAKFRFMGGDAMDNPDIVTLGGEAVEGFLHTTFAYDPSMPEMNEEAKAFTAAWEKEYPGKAPNANAAMGYDAYVLLYQAIVRANSAEPGAIRDALETTKDVATVTGLTSFSPEKHDPVKDLGVVEIKDGKKSYIYTVKP

📊 Sample Types

Isolate 15.1%
Metagenome 84.2%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Apidae 28.1%
Termitidae 23.4%
Kalotermitidae 20.3%
Unclassified 14.1%
Termopsidae 6.2%
Rhinotermitidae 3.1%
Passalidae 3.1%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 144
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
2 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 8068946563 Bartonella apihabitans M0187 Isolate Apidae
6 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
7 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 2751185856 Bartonella apis BBC0244 Isolate Apidae
10 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
11 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
12 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
13 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 8073617375 Bartonella apis W8098 Isolate Apidae
18 8082291289 Bartonella apihabitans K-FP28 Isolate Apidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 2751185858 Bartonella apis BBC0122 Isolate Apidae
23 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
24 8068941587 Bartonella choladocola B10834H15 Isolate Apidae
25 8073619611 Bartonella apis B10834G6 Isolate Apidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
29 2900132049 Bartonella massiliensis OS09 Isolate Unclassified
30 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
31 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
32 8068950955 Bartonella apihabitans W8097 Isolate Apidae
33 8073621894 Bartonella apis W8099 Isolate Apidae
34 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
35 2751185853 Bartonella apis BBC0178 Isolate Apidae
36 2820068815 Unclassified Proteobacteria Nt197P3bin4 Isolate Unclassified
37 8068944069 Bartonella choladocola W8125 Isolate Apidae
38 8068955631 Bartonella apihabitans M0280 Isolate Apidae
39 8073628750 Bartonella sp. W8167 Isolate Apidae
40 2861449170 Desulfovibrio intestinalis DSM 11275 Isolate Unclassified
41 2820070515 Unclassified Proteobacteria Nt197P3bin137 Isolate Unclassified
42 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
43 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
44 8068953321 Bartonella apihabitans M0190 Isolate Apidae
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
48 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
49 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
50 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
51 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
52 8073624232 Bartonella sp. W8151 Isolate Apidae
53 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
54 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
55 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
56 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
57 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
58 2820005795 Unclassified Synergistetes Nt197P3bin106 Isolate Unclassified
59 2820008971 Unclassified Synergistetes Lab288P3bin103 Isolate Unclassified
60 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
61 8073626464 Bartonella apis W8152 Isolate Apidae
62 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
63 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
64 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0074278_145866 3300005721 Bacteria 8886
2 Ga0466711_002672 3300042615 Bacteria 1528
3 Ga0466711_013700 3300042615 Bacteria 7272
4 Ga0466711_054743 3300042615 Bacteria 26049
5 Ga0466715_095578 3300042616 Bacteria 6097
6 Ga0466715_221895 3300042616 Bacteria 5034
7 Ga0466715_637826 3300042616 Bacteria 19151
8 Ga0466723_080370 3300042618 Unclassified 2998
9 Ga0466726_282320 3300042619 Bacteria 3108
10 Ga0466729_215052 3300042621 Bacteria 2943
11 Ga0466729_254283 3300042621 Bacteria 1982
12 Ga0466704_055141 3300042643 Bacteria 13569
13 Ga0466704_267199 3300042643 Bacteria 5213
14 Ga0466695_076190 3300042595 Bacteria 4696
15 Ga0466696_027534 3300042596 Bacteria 1755
16 Ga0466707_046444 3300042601 Bacteria 2457
17 Ga0466707_172064 3300042601 Bacteria 1616
18 Ga0466733_014680 3300042659 Bacteria 114664
19 Ga0466733_168770 3300042659 Bacteria 6229
20 Ga0068302_10131016 3300005071 Bacteria 5390
21 Ga0466711_003108 3300042615 Bacteria 3446
22 Ga0466704_258288 3300042643 Bacteria 5884
23 Ga0466700_035902 3300042600 Bacteria 2003
24 Ga0466722_090339 3300042609 Bacteria 6682
25 Ga0466705_180227 3300042612 Bacteria 8558
26 Ga0466733_094789 3300042659 Bacteria 17142
27 Ga0466711_005843 3300042615 Bacteria 16443
28 Ga0466711_192192 3300042615 Unclassified 2826
29 Ga0466711_267578 3300042615 Bacteria 10397
30 Ga0466715_016537 3300042616 Bacteria 14222
31 Ga0466715_400863 3300042616 Bacteria 7696
32 Ga0466704_116765 3300042643 Bacteria 12043
33 Ga0255809_1021784 3300022820 Bacteria 1569
34 Ga0466714_074823 3300042603 Bacteria 4990
35 2227544365 2225789004 Bacteria 2944
36 HBC_ctgsDRAFT_1004739 3300000333 Bacteria 3163
37 Ga0068302_10156384 3300005071 Bacteria 1543
38 Ga0072940_1006156 3300005200 Bacteria 3690
39 Ga0466705_396553 3300042612 Bacteria 12904
40 Ga0466711_154349 3300042615 Bacteria 8908
41 Ga0466711_238265 3300042615 Bacteria 6972
42 Ga0466711_316967 3300042615 Bacteria 14171
43 Ga0466715_038024 3300042616 Bacteria 21629
44 Ga0466726_106223 3300042619 Bacteria 25972
45 Ga0466726_398770 3300042619 Bacteria 1972
46 Ga0466735_121112 3300042624 Bacteria 1942
47 Ga0466709_125270 3300042648 Bacteria 2073
48 Ga0466708_252247 3300042652 Bacteria 13096
49 Ga0466708_318765 3300042652 Bacteria 20247
50 Ga0466727_110756 3300042655 Bacteria 1360
51 Ga0123353_10318126 3300010167 Bacteria 2364
52 Ga0123353_10610369 3300010167 Bacteria 1556
53 Ga0466690_285216 3300042590 Bacteria 9418
54 Ga0466691_027465 3300042593 Bacteria 5505
55 Ga0466696_246082 3300042596 Bacteria 10175
56 Ga0466705_065028 3300042612 Bacteria 59479
57 Ga0466705_306469 3300042612 Bacteria 7706
58 Ga0466733_214740 3300042659 Bacteria 1966
59 Ga0466715_334947 3300042616 Bacteria 2375
60 Ga0466723_143698 3300042618 Bacteria 12983
61 Ga0466723_179257 3300042618 Bacteria 23089
62 Ga0466726_170858 3300042619 Bacteria 2859
63 Ga0466728_367452 3300042620 Bacteria 16793
64 Ga0466703_071589 3300042636 Bacteria 34836
65 Ga0466708_069298 3300042652 Bacteria 43214
66 Ga0466727_104770 3300042655 Bacteria 6139
67 Ga0466691_110053 3300042593 Bacteria 10258
68 Ga0466691_197825 3300042593 Bacteria 1912
69 Ga0466696_262354 3300042596 Bacteria 12032
70 Ga0466713_101428 3300042602 Bacteria 57232
71 Ga0466698_435059 3300042610 Bacteria 1337
72 HBC_ctgsDRAFT_1021878 3300000333 Unclassified 1563
73 JGI24702J35022_10096352 3300002462 Bacteria 1615
74 Ga0074278_119752 3300005721 Unclassified 12253
75 Ga0466705_432449 3300042612 Bacteria 14311
76 Ga0466705_505432 3300042612 Bacteria 3685
77 Ga0466710_208070 3300042613 Bacteria 1197
78 Ga0466711_433844 3300042615 Bacteria 5210
79 Ga0466715_039865 3300042616 Bacteria 13769
80 Ga0466723_310735 3300042618 Unclassified 3874
81 Ga0466726_457698 3300042619 Bacteria 20122
82 Ga0123353_10152555 3300010167 Bacteria 3687
83 Ga0466691_102157 3300042593 Bacteria 23256
84 Ga0466691_110751 3300042593 Bacteria 24397
85 Ga0466717_211749 3300042604 Bacteria 1686
86 Ga0466722_110984 3300042609 Bacteria 13357
87 Ga0466722_130308 3300042609 Bacteria 26514
88 Ga0466705_270203 3300042612 Bacteria 6690
89 Ga0466727_351869 3300042655 Bacteria 6844
90 2227108569 2225789004 Bacteria 39179
91 IMNBL1DRAFT_c0035947 3300000062 Bacteria 1738
92 Ga0074278_114727 3300005721 Unclassified 19922
93 Ga0466711_166223 3300042615 Bacteria 11678
94 Ga0466711_496515 3300042615 Bacteria 2715
95 Ga0466715_384655 3300042616 Bacteria 3694
96 Ga0466723_278144 3300042618 Bacteria 1717
97 Ga0466728_024846 3300042620 Bacteria 1876
98 Ga0466703_389995 3300042636 Bacteria 1690
99 Ga0466709_352248 3300042648 Bacteria 4811
100 Ga0466708_038735 3300042652 Bacteria 11450
101 Ga0466708_415087 3300042652 Bacteria 5807
102 Ga0466725_174884 3300042654 Bacteria 1768
103 Ga0123356_10165753 3300010049 Bacteria 2213
104 Ga0123353_10040951 3300010167 Bacteria 7313
105 Ga0415639_153446 3300038395 Bacteria 2087
106 Ga0466707_125939 3300042601 Bacteria 6291
107 Ga0466713_011190 3300042602 Bacteria 84941
108 Ga0466722_104466 3300042609 Bacteria 1767
109 Ga0466698_044961 3300042610 Bacteria 3350
110 Ga0466715_028516 3300042616 Bacteria 46466
111 Ga0466715_083420 3300042616 Bacteria 2967
112 Ga0466723_335802 3300042618 Bacteria 3139
113 Ga0466731_170179 3300042622 Bacteria 2987
114 Ga0466735_155383 3300042624 Bacteria 2479
115 Ga0466735_187003 3300042624 Bacteria 1302
116 Ga0466703_315948 3300042636 Bacteria 31854
117 Ga0466709_339020 3300042648 Bacteria 2255
118 Ga0466708_159451 3300042652 Bacteria 10680
119 Ga0466708_221580 3300042652 Bacteria 6724
120 Ga0466708_419719 3300042652 Unclassified 8334
121 Ga0466727_045354 3300042655 Bacteria 19099
122 Ga0466727_101670 3300042655 Bacteria 2034
123 Ga0415639_002265 3300038395 Unclassified 5928
124 Ga0466696_064237 3300042596 Bacteria 1391
125 Ga0466706_142417 3300042599 Bacteria 6125
126 Ga0466716_480658 3300042605 Bacteria 6822
127 Ga0466716_484189 3300042605 Bacteria 2187

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042624 Ga0466735_187003 Ga0466735_187003_206_1201 331
2 3300042596 Ga0466696_027534 Ga0466696_027534_418_1470 350
3 3300042615 Ga0466711_154349 Ga0466711_154349_3758_4837 359
4 3300042593 Ga0466691_027465 Ga0466691_027465_2912_4036 360
5 3300038395 Ga0415639_153446 Ga0415639_153446_573_1658 361
6 3300042615 Ga0466711_003108 Ga0466711_003108_16_1101 361
7 3300038395 Ga0415639_002265 Ga0415639_002265_807_1895 362
8 3300042615 Ga0466711_496515 Ga0466711_496515_1616_2704 362
9 3300042619 Ga0466726_457698 Ga0466726_457698_15522_16610 362
10 3300042615 Ga0466711_013700 Ga0466711_013700_4309_5400 363
11 3300042596 Ga0466696_246082 Ga0466696_246082_8539_9633 364
12 3300042618 Ga0466723_179257 Ga0466723_179257_1084_2178 364
13 3300042615 Ga0466711_054743 Ga0466711_054743_15390_16487 365
14 3300042616 Ga0466715_038024 Ga0466715_038024_13632_14729 365
15 3300042655 Ga0466727_104770 Ga0466727_104770_1200_2297 365
16 3300042655 Ga0466727_110756 Ga0466727_110756_165_1262 365
17 3300042601 Ga0466707_046444 Ga0466707_046444_1205_2305 366
18 3300042616 Ga0466715_400863 Ga0466715_400863_1868_2968 366
19 3300042622 Ga0466731_170179 Ga0466731_170179_1256_2356 366
20 3300042652 Ga0466708_419719 Ga0466708_419719_3248_4384 366
21 3300022820 Ga0255809_1021784 Ga0255809_10217842 367
22 3300042618 Ga0466723_080370 Ga0466723_080370_1400_2536 367
23 3300042618 Ga0466723_143698 Ga0466723_143698_7296_8399 367
24 3300010167 Ga0123353_10152555 Ga0123353_101525552 368
25 3300042616 Ga0466715_039865 Ga0466715_039865_1382_2488 368
26 3300042596 Ga0466696_064237 Ga0466696_064237_120_1247 369
27 3300042616 Ga0466715_028516 Ga0466715_028516_43730_44839 369
28 3300042648 Ga0466709_339020 Ga0466709_339020_502_1632 369
29 3300042652 Ga0466708_221580 Ga0466708_221580_3056_4183 369
30 3300042618 Ga0466723_310735 Ga0466723_310735_1950_3062 370
31 3300042652 Ga0466708_038735 Ga0466708_038735_2515_3627 370
32 3300042659 Ga0466733_168770 Ga0466733_168770_3656_4771 371
33 3300042615 Ga0466711_002672 Ga0466711_002672_319_1437 372
34 iso_pr_bacteria 2820008971 2820010237 372
35 3300042590 Ga0466690_285216 Ga0466690_285216_7704_8825 373
36 3300042593 Ga0466691_110053 Ga0466691_110053_6417_7538 373
37 3300042601 Ga0466707_125939 Ga0466707_125939_1457_2578 373
38 3300042616 Ga0466715_637826 Ga0466715_637826_9541_10662 373
39 3300042620 Ga0466728_367452 Ga0466728_367452_11388_12509 373
40 3300042648 Ga0466709_352248 Ga0466709_352248_3399_4520 373
41 3300042652 Ga0466708_415087 Ga0466708_415087_2894_4015 373
42 3300042593 Ga0466691_197825 Ga0466691_197825_507_1631 374
43 3300042601 Ga0466707_172064 Ga0466707_172064_415_1539 374
44 3300042605 Ga0466716_484189 Ga0466716_484189_990_2114 374
45 3300042609 Ga0466722_130308 Ga0466722_130308_24870_25994 374
46 3300042612 Ga0466705_180227 Ga0466705_180227_5225_6349 374
47 3300042615 Ga0466711_005843 Ga0466711_005843_5416_6540 374
48 3300042615 Ga0466711_166223 Ga0466711_166223_9921_11045 374
49 3300042615 Ga0466711_433844 Ga0466711_433844_290_1414 374
50 3300042618 Ga0466723_278144 Ga0466723_278144_495_1619 374
51 3300042619 Ga0466726_106223 Ga0466726_106223_20574_21698 374
52 3300042636 Ga0466703_071589 Ga0466703_071589_10295_11419 374
53 3300042643 Ga0466704_267199 Ga0466704_267199_3978_5102 374
54 3300042652 Ga0466708_159451 Ga0466708_159451_5325_6449 374
55 3300042652 Ga0466708_252247 Ga0466708_252247_7876_9000 374
56 iso_pr_bacteria 2820005795 2820006475 374
57 3300002462 JGI24702J35022_10096352 JGI24702J35022_100963521 375
58 3300042593 Ga0466691_102157 Ga0466691_102157_16637_17764 375
59 3300042593 Ga0466691_110751 Ga0466691_110751_18497_19624 375
60 3300042609 Ga0466722_104466 Ga0466722_104466_371_1498 375
61 3300042612 Ga0466705_065028 Ga0466705_065028_42159_43286 375
62 3300042612 Ga0466705_306469 Ga0466705_306469_1250_2377 375
63 3300042612 Ga0466705_396553 Ga0466705_396553_507_1634 375
64 3300042612 Ga0466705_505432 Ga0466705_505432_311_1438 375
65 3300042615 Ga0466711_192192 Ga0466711_192192_783_1910 375
66 3300042615 Ga0466711_238265 Ga0466711_238265_3689_4816 375
67 3300042616 Ga0466715_016537 Ga0466715_016537_10623_11750 375
68 3300042616 Ga0466715_083420 Ga0466715_083420_924_2051 375
69 3300042618 Ga0466723_335802 Ga0466723_335802_983_2110 375
70 3300042619 Ga0466726_170858 Ga0466726_170858_25_1152 375
71 3300042619 Ga0466726_398770 Ga0466726_398770_255_1382 375
72 3300042621 Ga0466729_215052 Ga0466729_215052_267_1394 375
73 3300042624 Ga0466735_121112 Ga0466735_121112_798_1925 375
74 3300042636 Ga0466703_389995 Ga0466703_389995_516_1643 375
75 3300042643 Ga0466704_055141 Ga0466704_055141_11164_12291 375
76 3300042643 Ga0466704_258288 Ga0466704_258288_1037_2164 375
77 3300042652 Ga0466708_069298 Ga0466708_069298_5798_6925 375
78 3300042652 Ga0466708_318765 Ga0466708_318765_15098_16225 375
79 3300042655 Ga0466727_101670 Ga0466727_101670_405_1532 375
80 3300042655 Ga0466727_351869 Ga0466727_351869_2236_3363 375
81 2225789004 2227108569 2227495463 376
82 3300005071 Ga0068302_10156384 Ga0068302_101563841 376
83 3300010167 Ga0123353_10318126 Ga0123353_103181262 376
84 3300042596 Ga0466696_262354 Ga0466696_262354_375_1505 376
85 3300042602 Ga0466713_011190 Ga0466713_011190_72003_73133 376
86 3300042609 Ga0466722_110984 Ga0466722_110984_8033_9163 376
87 3300042610 Ga0466698_044961 Ga0466698_044961_2097_3227 376
88 3300042613 Ga0466710_208070 Ga0466710_208070_25_1155 376
89 3300042615 Ga0466711_267578 Ga0466711_267578_2928_4058 376
90 3300042615 Ga0466711_316967 Ga0466711_316967_7061_8191 376
91 3300042616 Ga0466715_095578 Ga0466715_095578_3579_4709 376
92 3300042616 Ga0466715_221895 Ga0466715_221895_1848_2978 376
93 3300042620 Ga0466728_024846 Ga0466728_024846_425_1555 376
94 3300042624 Ga0466735_155383 Ga0466735_155383_931_2061 376
95 3300042643 Ga0466704_116765 Ga0466704_116765_9068_10198 376
96 3300042654 Ga0466725_174884 Ga0466725_174884_567_1697 376
97 3300042655 Ga0466727_045354 Ga0466727_045354_14530_15660 376
98 3300042659 Ga0466733_094789 Ga0466733_094789_9100_10230 376
99 iso_pr_bacteria 2820001644 2820003737 376
100 iso_pr_bacteria 2820068815 2820070162 376
101 2225789004 2227544365 2228068829 377
102 3300000062 IMNBL1DRAFT_c0035947 IMNBL1DRAFT_00359471 377
103 3300005071 Ga0068302_10131016 Ga0068302_101310163 377
104 3300010167 Ga0123353_10610369 Ga0123353_106103692 377
105 3300042599 Ga0466706_142417 Ga0466706_142417_429_1562 377
106 3300042600 Ga0466700_035902 Ga0466700_035902_208_1341 377
107 3300042603 Ga0466714_074823 Ga0466714_074823_63_1196 377
108 3300042612 Ga0466705_270203 Ga0466705_270203_3419_4552 377
109 3300042659 Ga0466733_214740 Ga0466733_214740_67_1200 377
110 iso_pr_bacteria 2751185853 2753586704 377
111 iso_pr_bacteria 2751185856 2753592029 377
112 iso_pr_bacteria 2751185858 2753595827 377
113 iso_pr_bacteria 2820070515 2820071535 377
114 iso_pr_bacteria 2900132049 2900133380 377
115 iso_pr_bacteria 8068941587 8068943202 377
116 iso_pr_bacteria 8068944069 8068945663 377
117 iso_pr_bacteria 8068946563 8068946860 377
118 iso_pr_bacteria 8068950955 8068952988 377
119 iso_pr_bacteria 8068953321 8068953934 377
120 iso_pr_bacteria 8068955631 8068956221 377
121 iso_pr_bacteria 8073617375 8073619351 377
122 iso_pr_bacteria 8073619611 8073621175 377
123 iso_pr_bacteria 8073621894 8073623896 377
124 iso_pr_bacteria 8073624232 8073626206 377
125 iso_pr_bacteria 8073626464 8073627315 377
126 iso_pr_bacteria 8073628750 8073629396 377
127 iso_pr_bacteria 8082291289 8082292439 377
128 3300000333 HBC_ctgsDRAFT_1004739 HBC_ctgsDRAFT_10047392 378
129 3300000333 HBC_ctgsDRAFT_1021878 HBC_ctgsDRAFT_10218782 378
130 3300005721 Ga0074278_114727 Ga0074278_1147275 378
131 3300005721 Ga0074278_119752 Ga0074278_1197528 378
132 3300005721 Ga0074278_145866 Ga0074278_1458668 378
133 3300010167 Ga0123353_10040951 Ga0123353_100409513 378
134 3300042604 Ga0466717_211749 Ga0466717_211749_195_1331 378
135 3300042605 Ga0466716_480658 Ga0466716_480658_4090_5226 378
136 3300042621 Ga0466729_254283 Ga0466729_254283_83_1219 378
137 3300042659 Ga0466733_014680 Ga0466733_014680_8248_9384 378
138 3300005200 Ga0072940_1006156 Ga0072940_10061562 379
139 3300042616 Ga0466715_384655 Ga0466715_384655_1936_3081 381
140 iso_pr_bacteria 2861449170 2861450081 381
141 3300042595 Ga0466695_076190 Ga0466695_076190_712_1866 384
142 3300042609 Ga0466722_090339 Ga0466722_090339_4232_5389 385
143 3300042602 Ga0466713_101428 Ga0466713_101428_24853_26019 388
144 3300042636 Ga0466703_315948 Ga0466703_315948_17526_18692 388
145 3300042610 Ga0466698_435059 Ga0466698_435059_117_1289 390
146 3300042619 Ga0466726_282320 Ga0466726_282320_75_1253 392
147 3300042612 Ga0466705_432449 Ga0466705_432449_11008_12195 395
148 3300042612 Ga0466705_180227 Ga0466705_180227_2723_3916 397
149 3300042616 Ga0466715_334947 Ga0466715_334947_809_2014 401
150 3300042648 Ga0466709_125270 Ga0466709_125270_383_1759 411
151 3300010049 Ga0123356_10165753 Ga0123356_101657532 423
152 3300042602 Ga0466713_011190 Ga0466713_011190_83284_84621 445

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13458 Peripla_BP_6 Periplasmic binding protein 94 436 0.94
PF01094 ANF_receptor Receptor family ligand binding region 126 405 0.86
PF13433 Peripla_BP_5 Periplasmic binding protein domain 95 433 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.