Protein Family IF06022
Metagenome
Isolate
113
Members
48
Samples
109
Scaffolds
252.87
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_010763|Ga0466713_010763_16321_17148
- Length
- 275 aa
- Sequence
- MEPEYDERGSQTGTWIPVKEKNMEQLRKNIYFASDAHLGNRYTADSAETERKLVRWLDSIKQDAIAIYFLGDMFDYWYEYKYVVPKGFVRFLGKLGELSDLGVEIHLLRGNHDIWMFDYLAKEIGAKIYQGPLTLNLLGKRFFLAHGDEVGKHSRTFRFLQAMFRNPVCQFLYSSIHPWWTFRFAQRWSLNSRLKGLDKETDVTDEDITAKPLIDFAETYYRTHPEINYFIFGHRHIIVNHALSETSRVIIAGDWMQYFSYIRWDGKELGISAFC
Sample Types
Isolate
3.5%
Metagenome
96.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.1%
Kalotermitidae
30.4%
Unclassified
10.9%
Termopsidae
6.5%
Rhinotermitidae
4.3%
Passalidae
4.3%
Hodotermitidae
2.2%
Blattidae
2.2%
Taxonomy
Archaea
0
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 2 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 15 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 21 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 31 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 38 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 41 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 42 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 43 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 44 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 45 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 47 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 48 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_030455 | 3300042659 | Bacteria | 39544 |
| 2 | Ga0068305_10083417 | 3300005083 | Bacteria | 20277 |
| 3 | Ga0466711_272630 | 3300042615 | Bacteria | 10448 |
| 4 | Ga0123353_11571786 | 3300010167 | Bacteria | 833 |
| 5 | Ga0466703_191297 | 3300042636 | Bacteria | 4580 |
| 6 | Ga0466703_292547 | 3300042636 | Bacteria | 4424 |
| 7 | Ga0466704_313895 | 3300042643 | Bacteria | 5444 |
| 8 | Ga0466704_589446 | 3300042643 | Bacteria | 8974 |
| 9 | Ga0466708_073194 | 3300042652 | Bacteria | 9348 |
| 10 | Ga0466701_022505 | 3300042598 | Bacteria | 2892 |
| 11 | Ga0466719_513073 | 3300042606 | Bacteria | 13858 |
| 12 | Ga0466722_044630 | 3300042609 | Bacteria | 6805 |
| 13 | Ga0265387_1011735 | 3300024582 | Bacteria | 1207 |
| 14 | Ga0466694_012107 | 3300042594 | Bacteria | 1215 |
| 15 | Ga0068305_10060265 | 3300005083 | Bacteria | 14583 |
| 16 | Ga0466723_062038 | 3300042618 | Bacteria | 10740 |
| 17 | Ga0123354_10000020 | 3300010882 | Bacteria | 127737 |
| 18 | Ga0466703_236739 | 3300042636 | Bacteria | 2667 |
| 19 | Ga0466725_432538 | 3300042654 | Bacteria | 27426 |
| 20 | Ga0466727_238759 | 3300042655 | Bacteria | 22004 |
| 21 | Ga0466707_222877 | 3300042601 | Bacteria | 2195 |
| 22 | Ga0466722_015712 | 3300042609 | Bacteria | 19629 |
| 23 | Ga0466656_358486 | 3300042550 | Bacteria | 6392 |
| 24 | Ga0466690_068142 | 3300042590 | Bacteria | 1109 |
| 25 | Ga0466733_046473 | 3300042659 | Bacteria | 56769 |
| 26 | JGI24699J35502_11134211 | 3300002509 | Bacteria | 60442 |
| 27 | JGI24696J40584_12960415 | 3300002834 | Bacteria | 7160 |
| 28 | Ga0466726_056099 | 3300042619 | Bacteria | 1233 |
| 29 | Ga0466726_161420 | 3300042619 | Bacteria | 5006 |
| 30 | Ga0466726_218966 | 3300042619 | Bacteria | 1496 |
| 31 | Ga0123353_10680345 | 3300010167 | Bacteria | 1449 |
| 32 | Ga0466704_197346 | 3300042643 | Bacteria | 3773 |
| 33 | Ga0466707_282317 | 3300042601 | Bacteria | 10877 |
| 34 | Ga0466690_029646 | 3300042590 | Bacteria | 5818 |
| 35 | Ga0466733_129455 | 3300042659 | Bacteria | 1504 |
| 36 | IMNBL1DRAFT_c0008887 | 3300000062 | Bacteria | 5052 |
| 37 | JGI24702J35022_10001981 | 3300002462 | Bacteria | 12632 |
| 38 | Ga0068305_10015278 | 3300005083 | Bacteria | 26404 |
| 39 | Ga0466715_099621 | 3300042616 | Bacteria | 18223 |
| 40 | Ga0466715_287431 | 3300042616 | Bacteria | 4441 |
| 41 | Ga0123353_11297109 | 3300010167 | Bacteria | 946 |
| 42 | Ga0466735_187814 | 3300042624 | Bacteria | 7364 |
| 43 | Ga0466704_053279 | 3300042643 | Bacteria | 19722 |
| 44 | Ga0466708_175500 | 3300042652 | Bacteria | 17846 |
| 45 | Ga0466727_140759 | 3300042655 | Bacteria | 3759 |
| 46 | Ga0466713_055725 | 3300042602 | Bacteria | 54491 |
| 47 | Ga0466716_209317 | 3300042605 | Bacteria | 10900 |
| 48 | Ga0466719_559522 | 3300042606 | Bacteria | 13326 |
| 49 | Ga0466722_168930 | 3300042609 | Bacteria | 2993 |
| 50 | Ga0466693_069577 | 3300042592 | Bacteria | 2244 |
| 51 | Ga0466691_124423 | 3300042593 | Bacteria | 23661 |
| 52 | Ga0466696_027471 | 3300042596 | Bacteria | 17440 |
| 53 | Ga0466701_002423 | 3300042598 | Bacteria | 10005 |
| 54 | JGI24702J35022_10183801 | 3300002462 | Bacteria | 1189 |
| 55 | Ga0068305_10039966 | 3300005083 | Bacteria | 22305 |
| 56 | Ga0466715_287155 | 3300042616 | Bacteria | 4474 |
| 57 | Ga0466726_024398 | 3300042619 | Bacteria | 3241 |
| 58 | Ga0466728_333875 | 3300042620 | Bacteria | 32046 |
| 59 | Ga0123356_10062168 | 3300010049 | Bacteria | 3488 |
| 60 | Ga0466703_158940 | 3300042636 | Bacteria | 9567 |
| 61 | Ga0466703_289947 | 3300042636 | Bacteria | 14348 |
| 62 | Ga0466703_386239 | 3300042636 | Bacteria | 5343 |
| 63 | Ga0466727_100812 | 3300042655 | Bacteria | 10125 |
| 64 | Ga0466700_249204 | 3300042600 | Bacteria | 41013 |
| 65 | Ga0466722_224742 | 3300042609 | Unclassified | 2611 |
| 66 | Ga0466705_069377 | 3300042612 | Bacteria | 6848 |
| 67 | JGI24705J35276_12238737 | 3300002504 | Bacteria | 48270 |
| 68 | Ga0466710_293839 | 3300042613 | Bacteria | 1206 |
| 69 | Ga0466711_219386 | 3300042615 | Bacteria | 10258 |
| 70 | Ga0466709_265690 | 3300042648 | Bacteria | 3289 |
| 71 | Ga0466708_016107 | 3300042652 | Bacteria | 19240 |
| 72 | Ga0466727_020499 | 3300042655 | Bacteria | 6403 |
| 73 | Ga0466713_098925 | 3300042602 | Bacteria | 3704 |
| 74 | Ga0466657_173840 | 3300042582 | Bacteria | 1624 |
| 75 | Ga0466705_245960 | 3300042612 | Bacteria | 3325 |
| 76 | Ga0466705_498503 | 3300042612 | Bacteria | 7737 |
| 77 | Ga0466728_189559 | 3300042620 | Bacteria | 90681 |
| 78 | Ga0123354_10266457 | 3300010882 | Bacteria | 1697 |
| 79 | Ga0466731_120494 | 3300042622 | Bacteria | 5288 |
| 80 | Ga0466703_059585 | 3300042636 | Bacteria | 6373 |
| 81 | Ga0466704_218499 | 3300042643 | Bacteria | 3163 |
| 82 | Ga0466704_247905 | 3300042643 | Bacteria | 30308 |
| 83 | Ga0466704_463474 | 3300042643 | Bacteria | 19410 |
| 84 | Ga0466727_163352 | 3300042655 | Bacteria | 6809 |
| 85 | Ga0466727_223715 | 3300042655 | Bacteria | 5413 |
| 86 | Ga0466701_060123 | 3300042598 | Bacteria | 11228 |
| 87 | Ga0466706_025174 | 3300042599 | Bacteria | 118676 |
| 88 | Ga0466713_118123 | 3300042602 | Bacteria | 66356 |
| 89 | Ga0466716_267932 | 3300042605 | Bacteria | 5668 |
| 90 | Ga0466716_305187 | 3300042605 | Bacteria | 3706 |
| 91 | Ga0466722_159681 | 3300042609 | Bacteria | 66135 |
| 92 | Ga0466692_100322 | 3300042591 | Bacteria | 97018 |
| 93 | Ga0466691_034147 | 3300042593 | Bacteria | 12600 |
| 94 | Ga0466705_094386 | 3300042612 | Bacteria | 20567 |
| 95 | 2227491304 | 2225789004 | Bacteria | 20472 |
| 96 | Ga0466705_399072 | 3300042612 | Bacteria | 3513 |
| 97 | Ga0466715_570483 | 3300042616 | Bacteria | 1166 |
| 98 | Ga0466726_041726 | 3300042619 | Bacteria | 3076 |
| 99 | Ga0123356_10016232 | 3300010049 | Bacteria | 7111 |
| 100 | Ga0466727_064353 | 3300042655 | Bacteria | 10913 |
| 101 | Ga0466727_259133 | 3300042655 | Bacteria | 14513 |
| 102 | Ga0466707_023328 | 3300042601 | Bacteria | 2785 |
| 103 | Ga0466707_182961 | 3300042601 | Bacteria | 13282 |
| 104 | Ga0466713_010763 | 3300042602 | Bacteria | 24879 |
| 105 | Ga0466714_015825 | 3300042603 | Bacteria | 102725 |
| 106 | Ga0466722_009947 | 3300042609 | Bacteria | 58351 |
| 107 | Ga0466692_025817 | 3300042591 | Bacteria | 2762 |
| 108 | Ga0466692_119633 | 3300042591 | Bacteria | 108688 |
| 109 | Ga0466691_162555 | 3300042593 | Bacteria | 4437 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042655 | Ga0466727_238759 | Ga0466727_238759_15311_16078 | 222 |
| 2 | 3300042659 | Ga0466733_030455 | Ga0466733_030455_25164_25943 | 229 |
| 3 | 3300042636 | Ga0466703_289947 | Ga0466703_289947_1958_2719 | 231 |
| 4 | 3300042619 | Ga0466726_041726 | Ga0466726_041726_1097_1813 | 238 |
| 5 | 3300042636 | Ga0466703_292547 | Ga0466703_292547_2507_3271 | 239 |
| 6 | 3300042652 | Ga0466708_073194 | Ga0466708_073194_4305_5027 | 240 |
| 7 | 3300042620 | Ga0466728_189559 | Ga0466728_189559_62157_62882 | 241 |
| 8 | 3300042620 | Ga0466728_333875 | Ga0466728_333875_6302_7030 | 242 |
| 9 | 3300042605 | Ga0466716_267932 | Ga0466716_267932_4284_5018 | 244 |
| 10 | 3300042582 | Ga0466657_173840 | Ga0466657_173840_42_788 | 248 |
| 11 | 3300042602 | Ga0466713_055725 | Ga0466713_055725_38365_39111 | 248 |
| 12 | 3300042612 | Ga0466705_399072 | Ga0466705_399072_1021_1767 | 248 |
| 13 | 3300042622 | Ga0466731_120494 | Ga0466731_120494_2371_3117 | 248 |
| 14 | 3300005083 | Ga0068305_10039966 | Ga0068305_100399667 | 249 |
| 15 | 3300042591 | Ga0466692_100322 | Ga0466692_100322_76383_77132 | 249 |
| 16 | 3300042602 | Ga0466713_098925 | Ga0466713_098925_1975_2724 | 249 |
| 17 | 3300042550 | Ga0466656_358486 | Ga0466656_358486_3153_3905 | 250 |
| 18 | 3300042601 | Ga0466707_222877 | Ga0466707_222877_37_789 | 250 |
| 19 | 3300042609 | Ga0466722_224742 | Ga0466722_224742_490_1242 | 250 |
| 20 | 3300042643 | Ga0466704_463474 | Ga0466704_463474_1664_2416 | 250 |
| 21 | 3300042593 | Ga0466691_034147 | Ga0466691_034147_8312_9067 | 251 |
| 22 | 3300042594 | Ga0466694_012107 | Ga0466694_012107_387_1142 | 251 |
| 23 | 3300042602 | Ga0466713_118123 | Ga0466713_118123_60595_61350 | 251 |
| 24 | 3300042605 | Ga0466716_305187 | Ga0466716_305187_1073_1828 | 251 |
| 25 | 3300042606 | Ga0466719_513073 | Ga0466719_513073_3723_4478 | 251 |
| 26 | 3300042612 | Ga0466705_498503 | Ga0466705_498503_6220_6996 | 251 |
| 27 | 3300042615 | Ga0466711_219386 | Ga0466711_219386_485_1240 | 251 |
| 28 | 3300042615 | Ga0466711_272630 | Ga0466711_272630_8093_8848 | 251 |
| 29 | 3300042643 | Ga0466704_053279 | Ga0466704_053279_879_1634 | 251 |
| 30 | 3300042643 | Ga0466704_218499 | Ga0466704_218499_1751_2506 | 251 |
| 31 | iso_pr_bacteria | 2820762746 | 2820764969 | 251 |
| 32 | 3300002509 | JGI24699J35502_11134211 | JGI24699J35502_1113421125 | 252 |
| 33 | 3300005083 | Ga0068305_10060265 | Ga0068305_1006026512 | 252 |
| 34 | 3300010167 | Ga0123353_10680345 | Ga0123353_106803452 | 252 |
| 35 | 3300042591 | Ga0466692_119633 | Ga0466692_119633_78199_78957 | 252 |
| 36 | 3300042598 | Ga0466701_022505 | Ga0466701_022505_646_1404 | 252 |
| 37 | 3300042598 | Ga0466701_060123 | Ga0466701_060123_2112_2870 | 252 |
| 38 | 3300042601 | Ga0466707_282317 | Ga0466707_282317_8475_9233 | 252 |
| 39 | 3300042609 | Ga0466722_015712 | Ga0466722_015712_3232_3990 | 252 |
| 40 | 3300042612 | Ga0466705_069377 | Ga0466705_069377_276_1034 | 252 |
| 41 | 3300042613 | Ga0466710_293839 | Ga0466710_293839_67_825 | 252 |
| 42 | 3300042619 | Ga0466726_161420 | Ga0466726_161420_1742_2500 | 252 |
| 43 | 3300042636 | Ga0466703_191297 | Ga0466703_191297_3669_4427 | 252 |
| 44 | 3300042643 | Ga0466704_247905 | Ga0466704_247905_20454_21212 | 252 |
| 45 | 3300042643 | Ga0466704_313895 | Ga0466704_313895_3892_4650 | 252 |
| 46 | 3300042648 | Ga0466709_265690 | Ga0466709_265690_1765_2523 | 252 |
| 47 | 3300042654 | Ga0466725_432538 | Ga0466725_432538_16756_17514 | 252 |
| 48 | 3300042655 | Ga0466727_020499 | Ga0466727_020499_1492_2250 | 252 |
| 49 | 3300042655 | Ga0466727_259133 | Ga0466727_259133_12954_13712 | 252 |
| 50 | 3300000062 | IMNBL1DRAFT_c0008887 | IMNBL1DRAFT_00088874 | 253 |
| 51 | 3300002462 | JGI24702J35022_10183801 | JGI24702J35022_101838011 | 253 |
| 52 | 3300002504 | JGI24705J35276_12238737 | JGI24705J35276_1223873752 | 253 |
| 53 | 3300010167 | Ga0123353_11297109 | Ga0123353_112971093 | 253 |
| 54 | 3300010167 | Ga0123353_11571786 | Ga0123353_115717861 | 253 |
| 55 | 3300042590 | Ga0466690_068142 | Ga0466690_068142_242_1003 | 253 |
| 56 | 3300042592 | Ga0466693_069577 | Ga0466693_069577_379_1140 | 253 |
| 57 | 3300042601 | Ga0466707_023328 | Ga0466707_023328_195_956 | 253 |
| 58 | 3300042605 | Ga0466716_209317 | Ga0466716_209317_1519_2280 | 253 |
| 59 | 3300042612 | Ga0466705_245960 | Ga0466705_245960_256_1017 | 253 |
| 60 | 3300042616 | Ga0466715_287431 | Ga0466715_287431_609_1370 | 253 |
| 61 | 3300042636 | Ga0466703_158940 | Ga0466703_158940_5672_6433 | 253 |
| 62 | 3300042643 | Ga0466704_589446 | Ga0466704_589446_7513_8274 | 253 |
| 63 | 3300042652 | Ga0466708_016107 | Ga0466708_016107_5758_6519 | 253 |
| 64 | 3300042655 | Ga0466727_140759 | Ga0466727_140759_2716_3477 | 253 |
| 65 | 3300042655 | Ga0466727_163352 | Ga0466727_163352_234_995 | 253 |
| 66 | 3300005083 | Ga0068305_10015278 | Ga0068305_1001527822 | 254 |
| 67 | 3300005083 | Ga0068305_10083417 | Ga0068305_100834174 | 254 |
| 68 | 3300010882 | Ga0123354_10266457 | Ga0123354_102664572 | 254 |
| 69 | 3300042599 | Ga0466706_025174 | Ga0466706_025174_31851_32615 | 254 |
| 70 | 3300042600 | Ga0466700_249204 | Ga0466700_249204_10220_10984 | 254 |
| 71 | 3300042601 | Ga0466707_182961 | Ga0466707_182961_11711_12475 | 254 |
| 72 | 3300042609 | Ga0466722_159681 | Ga0466722_159681_45853_46617 | 254 |
| 73 | 3300042609 | Ga0466722_168930 | Ga0466722_168930_1187_1951 | 254 |
| 74 | 3300042624 | Ga0466735_187814 | Ga0466735_187814_247_1011 | 254 |
| 75 | 3300042636 | Ga0466703_386239 | Ga0466703_386239_364_1128 | 254 |
| 76 | 3300042655 | Ga0466727_100812 | Ga0466727_100812_363_1127 | 254 |
| 77 | iso_pr_bacteria | 3004667792 | 3004670789 | 254 |
| 78 | 3300042590 | Ga0466690_029646 | Ga0466690_029646_2967_3734 | 255 |
| 79 | 3300042596 | Ga0466696_027471 | Ga0466696_027471_346_1113 | 255 |
| 80 | 3300042603 | Ga0466714_015825 | Ga0466714_015825_84061_84828 | 255 |
| 81 | 3300042606 | Ga0466719_559522 | Ga0466719_559522_6707_7474 | 255 |
| 82 | 3300042609 | Ga0466722_009947 | Ga0466722_009947_57372_58139 | 255 |
| 83 | 3300042609 | Ga0466722_044630 | Ga0466722_044630_5845_6612 | 255 |
| 84 | 3300042612 | Ga0466705_094386 | Ga0466705_094386_9588_10355 | 255 |
| 85 | 3300042616 | Ga0466715_287155 | Ga0466715_287155_3005_3772 | 255 |
| 86 | 3300042619 | Ga0466726_056099 | Ga0466726_056099_163_930 | 255 |
| 87 | 3300042643 | Ga0466704_197346 | Ga0466704_197346_1217_1984 | 255 |
| 88 | 3300042655 | Ga0466727_223715 | Ga0466727_223715_2533_3300 | 255 |
| 89 | 3300042659 | Ga0466733_129455 | Ga0466733_129455_223_990 | 255 |
| 90 | 3300010882 | Ga0123354_10000020 | Ga0123354_1000002057 | 256 |
| 91 | 3300024582 | Ga0265387_1011735 | Ga0265387_10117352 | 256 |
| 92 | 3300042616 | Ga0466715_570483 | Ga0466715_570483_154_924 | 256 |
| 93 | 3300042619 | Ga0466726_218966 | Ga0466726_218966_353_1123 | 256 |
| 94 | 3300042636 | Ga0466703_236739 | Ga0466703_236739_1256_2026 | 256 |
| 95 | 3300042659 | Ga0466733_046473 | Ga0466733_046473_5981_6751 | 256 |
| 96 | 3300042616 | Ga0466715_099621 | Ga0466715_099621_9160_9933 | 257 |
| 97 | 3300042652 | Ga0466708_175500 | Ga0466708_175500_3841_4614 | 257 |
| 98 | 2225789004 | 2227491304 | 2227963571 | 258 |
| 99 | 3300002834 | JGI24696J40584_12960415 | JGI24696J40584_129604155 | 258 |
| 100 | 3300042591 | Ga0466692_025817 | Ga0466692_025817_289_1065 | 258 |
| 101 | 3300002462 | JGI24702J35022_10001981 | JGI24702J35022_100019812 | 259 |
| 102 | 3300042619 | Ga0466726_024398 | Ga0466726_024398_1000_1779 | 259 |
| 103 | 3300042598 | Ga0466701_002423 | Ga0466701_002423_2318_3103 | 261 |
| 104 | 3300010049 | Ga0123356_10062168 | Ga0123356_100621683 | 262 |
| 105 | 3300042593 | Ga0466691_162555 | Ga0466691_162555_1169_1957 | 262 |
| 106 | iso_pr_bacteria | 2967483437 | 2967483902 | 262 |
| 107 | 3300042593 | Ga0466691_124423 | Ga0466691_124423_8942_9736 | 264 |
| 108 | 3300042655 | Ga0466727_064353 | Ga0466727_064353_419_1213 | 264 |
| 109 | 3300010049 | Ga0123356_10016232 | Ga0123356_100162323 | 265 |
| 110 | iso_pr_bacteria | 2509276035 | 2509458092 | 265 |
| 111 | 3300042636 | Ga0466703_059585 | Ga0466703_059585_187_987 | 266 |
| 112 | 3300042618 | Ga0466723_062038 | Ga0466723_062038_348_1154 | 268 |
| 113 | 3300042602 | Ga0466713_010763 | Ga0466713_010763_16321_17148 | 275 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00149 | Metallophos | Calcineurin-like phosphoesterase | 29 | 236 | 0.65 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00149 | GO:0016787 | hydrolase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.