Protein Family IF06019

Metagenome Isolate
174 Members
93 Samples
133 Scaffolds
303.53 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_007360|Ga0466713_007360_2936_3943
Length
335 aa
Sequence
LDYSISIKKSSVELMIVTKKLGEKMTENNRLSVKLPGLDLKNPIIPASGCFGFGEEYAKYYDLNKLGSIMVKATTLHPRFGNPTPRVAETASGMLNAIGLQNPGLEVIMAEKLPWLNENFPDLPIIANVAGSEEDDYVAVCAKIGDAPNVKAIELNISCPNVKHGGQAFGTDPDVAAALVKACKAVSKVPLYVKLSPNVTDIVPIAKAVEHACADGLTMINTLMGVRFDLKTRKPVLANITGGLSGPAIKPVALKLIHQVAQVVDIPIIGMGGVESAQDVLEMYMAGASAVAVGTANFADPFVCPKIIEKLPEVMDQYGIDSLENLIQEVKNSKK

📊 Sample Types

Isolate 23.6%
Metagenome 76.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 26.4%
Termitidae 20.7%
Kalotermitidae 12.6%
Drosophilidae 6.9%
Tenebrionidae 6.9%
Blattidae 5.7%
Rhinotermitidae 3.4%
Termopsidae 3.4%
Passalidae 2.3%
Formicidae 2.3%
Scarabaeidae 1.1%
Apidae 1.1%
Acrididae 1.1%
Elmidae 1.1%
Curculionidae 1.1%
Bombycidae 1.1%
Hodotermitidae 1.1%
Euphausiidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 164
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
2 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
3 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
4 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
5 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
6 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
7 2035265001 Acrididae gut microbial communities from Texas A and M University, USA - Sample 321 Metagenome Acrididae
8 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
9 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
10 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
19 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
20 2916858470 Heyndrickxia oleronia Isolate Unclassified
21 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
22 2820312173 Unclassified Firmicutes Nt197P4bin8 Isolate Unclassified
23 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
24 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
28 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
29 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
30 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
31 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
32 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
33 2820426531 Unclassified Firmicutes Lab288P3bin45 Isolate Unclassified
34 8064008355 Heyndrickxia oleronia Isolate Unclassified
35 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
36 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
37 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
38 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
39 2820549969 Unclassified Firmicutes Emb289P4bin66 Isolate Unclassified
40 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
41 8012112996 Staphylococcus muscae ATCC 49910 Isolate
42 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
43 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
44 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
45 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
46 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
47 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
48 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
49 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
50 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
51 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
52 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
53 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
54 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
55 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
56 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
57 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
58 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
59 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
60 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
61 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
62 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
63 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
64 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
65 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
66 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
67 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
68 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
69 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
70 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
71 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
72 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
73 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
74 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
75 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
76 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
77 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
78 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
79 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
80 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
81 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
82 8112490586 Staphylococcus muscae CCM 4175 Isolate
83 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
84 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
85 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
86 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
87 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
88 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
89 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
90 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
91 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
92 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
93 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_037900 3300042616 Bacteria 143938
2 Ga0466715_620245 3300042616 Bacteria 30740
3 Ga0466726_191097 3300042619 Bacteria 6806
4 Ga0123355_10091507 3300009826 Bacteria 4822
5 Ga0123356_10039960 3300010049 Bacteria 4371
6 Ga0123353_10230193 3300010167 Bacteria 2890
7 Ga0123353_10297461 3300010167 Unclassified 2466
8 Ga0123353_10903535 3300010167 Bacteria 1202
9 Ga0466706_201404 3300042599 Unclassified 25454
10 Ga0466702_255010 3300042635 Bacteria 2272
11 JGI24703J35330_11748857 3300002501 Bacteria 56189
12 Ga0562378_0208 3300056814 Unclassified 139675
13 Ga0562378_0234 3300056814 Unclassified 130023
14 Ga0562375_0201 3300056856 Bacteria 169177
15 Ga0562376_1303 3300056857 Unclassified 35867
16 Ga0466718_064570 3300042617 Bacteria 17216
17 Ga0466718_097691 3300042617 Bacteria 1067
18 Ga0466728_123144 3300042620 Bacteria 23630
19 Ga0466729_187625 3300042621 Bacteria 4719
20 Ga0123355_10159935 3300009826 Bacteria 3396
21 Ga0123356_10007342 3300010049 Bacteria 10998
22 Ga0123356_10019519 3300010049 Bacteria 6425
23 Ga0123353_10131501 3300010167 Bacteria 4015
24 Ga0123353_10386598 3300010167 Bacteria 2090
25 Ga0123353_10738910 3300010167 Bacteria 1372
26 Ga0466721_242939 3300042608 Bacteria 1573
27 IMNBL1DRAFT_c0018037 3300000062 Bacteria 2947
28 Ga0105553_1039235 3300007767 Bacteria 6397
29 Ga0562379_0455 3300056790 Bacteria 85147
30 Ga0562377_0231 3300056842 Bacteria 134767
31 Ga0562377_2700 3300056842 Unclassified 12157
32 Ga0466705_506200 3300042612 Bacteria 14499
33 Ga0466726_221848 3300042619 Bacteria 5827
34 Ga0466729_114210 3300042621 Bacteria 7900
35 Ga0123355_10039016 3300009826 Bacteria 7724
36 Ga0123353_10003277 3300010167 Bacteria 20423
37 Ga0123353_10013338 3300010167 Bacteria 11766
38 Ga0123353_10415236 3300010167 Bacteria 1996
39 Ga0123354_10377579 3300010882 Bacteria 1228
40 Ga0466706_138852 3300042599 Bacteria 93255
41 Ga0466713_054851 3300042602 Bacteria 53082
42 Ga0466713_156894 3300042602 Bacteria 10364
43 Ga0466731_124534 3300042622 Bacteria 1864
44 Ga0466703_125596 3300042636 Bacteria 3557
45 Ga0466704_026770 3300042643 Bacteria 49720
46 JGI24702J35022_10021564 3300002462 Bacteria 3492
47 JGI24696J40584_12955805 3300002834 Bacteria 2930
48 Ga0466697_122719 3300042611 Bacteria 1496
49 Ga0562379_0078 3300056790 Bacteria 360595
50 Ga0466715_559916 3300042616 Unclassified 11129
51 Ga0123357_10339027 3300009784 Bacteria 1456
52 Ga0123355_10006048 3300009826 Bacteria 17839
53 Ga0123356_10279749 3300010049 Bacteria 1763
54 Ga0123353_10714272 3300010167 Bacteria 1403
55 Ga0466722_149034 3300042609 Bacteria 10550
56 Ga0466727_294305 3300042655 Bacteria 29904
57 JGI24702J35022_10008652 3300002462 Bacteria 5752
58 JGI24705J35276_12238076 3300002504 Bacteria 15638
59 Ga0562377_1957 3300056842 Bacteria 17840
60 Ga0562375_0063 3300056856 Bacteria 420368
61 Ga0466692_116957 3300042591 Bacteria 13651
62 Ga0466692_169156 3300042591 Bacteria 59346
63 Ga0466710_102939 3300042613 Bacteria 1351
64 Ga0466711_494909 3300042615 Bacteria 6784
65 Ga0466715_200707 3300042616 Bacteria 8411
66 Ga0466715_231009 3300042616 Bacteria 5488
67 Ga0466723_123543 3300042618 Bacteria 7786
68 Ga0123356_10123803 3300010049 Bacteria 2521
69 Ga0123353_10152771 3300010167 Bacteria 3684
70 Ga0123353_10727670 3300010167 Bacteria 1386
71 Ga0466707_419478 3300042601 Bacteria 9061
72 Ga0466722_239809 3300042609 Bacteria 4245
73 Ga0466735_183521 3300042624 Bacteria 19245
74 Ga0466702_310712 3300042635 Bacteria 149509
75 Ga0466703_039914 3300042636 Bacteria 11018
76 Ga0466704_521846 3300042643 Bacteria 4789
77 Ga0068305_10256038 3300005083 Bacteria 8964
78 Ga0072941_1003221 3300005201 Bacteria 59208
79 Ga0562379_0401 3300056790 Bacteria 96535
80 Ga0562377_0742 3300056842 Unclassified 45400
81 Ga0466696_278891 3300042596 Bacteria 171866
82 Ga0123355_10006806 3300009826 Bacteria 17003
83 Ga0123353_10000364 3300010167 Bacteria 55292
84 Ga0123353_10002335 3300010167 Bacteria 23556
85 Ga0123353_10077696 3300010167 Bacteria 5334
86 Ga0123353_10157597 3300010167 Bacteria 3617
87 Ga0123353_10636038 3300010167 Bacteria 1514
88 Ga0123353_10772166 3300010167 Bacteria 1333
89 Ga0466709_147127 3300042648 Bacteria 80266
90 Ga0072940_1317600 3300005200 Bacteria 6505
91 Ga0466733_151608 3300042659 Bacteria 7096
92 Ga0466710_258608 3300042613 Bacteria 1432
93 Ga0466723_022700 3300042618 Bacteria 21847
94 Ga0123357_10041458 3300009784 Unclassified 6259
95 Ga0123355_10136326 3300009826 Bacteria 3769
96 Ga0123356_10113368 3300010049 Bacteria 2623
97 Ga0123353_10000996 3300010167 Bacteria 34737
98 Ga0123353_10005512 3300010167 Bacteria 16631
99 Ga0123353_10373271 3300010167 Bacteria 2137
100 Ga0466706_193899 3300042599 Bacteria 1558
101 Ga0466707_278592 3300042601 Bacteria 154108
102 Ga0466713_007360 3300042602 Bacteria 27298
103 Ga0466714_064391 3300042603 Bacteria 1451
104 Ga0466716_005763 3300042605 Bacteria 8127
105 Ga0466716_216128 3300042605 Bacteria 23427
106 Ga0466722_016215 3300042609 Bacteria 10692
107 Ga0466703_403284 3300042636 Bacteria 2479
108 Ga0466709_041255 3300042648 Bacteria 64383
109 GhopperDRAF_NODE_354648_len_3032_cov_7_404354 2035265001 Bacteria 3062
110 2227480168 2225789004 Bacteria 98623
111 IMNBL1DRAFT_c0002631 3300000062 Bacteria 12299
112 JGI24702J35022_10044613 3300002462 Bacteria 2363
113 JGI24703J35330_11747475 3300002501 Bacteria 7010
114 CVPL010L_1001223 3300002932 Bacteria 8500
115 Ga0072940_1356567 3300005200 Bacteria 1337
116 Ga0562379_0005 3300056790 Bacteria 2649770
117 Ga0562377_0010 3300056842 Bacteria 1401665
118 Ga0562375_0009 3300056856 Bacteria 1746158
119 Ga0562374_0006 3300057007 Bacteria 2178283
120 Ga0466690_140482 3300042590 Bacteria 2355
121 Ga0466705_392085 3300042612 Bacteria 1643
122 Ga0466711_159981 3300042615 Bacteria 2368
123 Ga0466718_091324 3300042617 Bacteria 2117
124 Ga0466726_189882 3300042619 Bacteria 4433
125 Ga0466728_017755 3300042620 Bacteria 55878
126 Ga0123356_10301957 3300010049 Bacteria 1706
127 Ga0123353_10000366 3300010167 Bacteria 55268
128 Ga0123353_10003759 3300010167 Bacteria 19319
129 Ga0466713_032560 3300042602 Bacteria 5019
130 Ga0466716_504370 3300042605 Bacteria 6237
131 Ga0466722_062168 3300042609 Bacteria 3243
132 Ga0466702_183068 3300042635 Bacteria 2376
133 Ga0063521_1001778 3300003973 Unclassified 5546

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_392085 Ga0466705_392085_876_1607 243
2 3300042648 Ga0466709_041255 Ga0466709_041255_62710_63501 263
3 3300042590 Ga0466690_140482 Ga0466690_140482_944_1819 277
4 3300010167 Ga0123353_10000364 Ga0123353_1000036438 280
5 3300010167 Ga0123353_10002335 Ga0123353_1000233516 280
6 3300042622 Ga0466731_124534 Ga0466731_124534_473_1519 280
7 3300042618 Ga0466723_123543 Ga0466723_123543_5451_6296 281
8 3300042620 Ga0466728_123144 Ga0466728_123144_17860_18711 283
9 3300042615 Ga0466711_159981 Ga0466711_159981_339_1250 286
10 3300010049 Ga0123356_10019519 Ga0123356_100195193 287
11 3300010049 Ga0123356_10113368 Ga0123356_101133682 287
12 3300010049 Ga0123356_10301957 Ga0123356_103019572 287
13 3300010167 Ga0123353_10152771 Ga0123353_101527715 287
14 3300010167 Ga0123353_10157597 Ga0123353_101575971 287
15 3300010167 Ga0123353_10297461 Ga0123353_102974612 287
16 3300010167 Ga0123353_10373271 Ga0123353_103732712 287
17 3300010167 Ga0123353_10714272 Ga0123353_107142721 287
18 3300010167 Ga0123353_10903535 Ga0123353_109035352 287
19 3300042619 Ga0466726_189882 Ga0466726_189882_3223_4131 287
20 3300042635 Ga0466702_183068 Ga0466702_183068_846_1748 287
21 3300010167 Ga0123353_10386598 Ga0123353_103865983 288
22 3300010167 Ga0123353_10772166 Ga0123353_107721661 288
23 3300010882 Ga0123354_10377579 Ga0123354_103775791 288
24 3300042616 Ga0466715_231009 Ga0466715_231009_3165_4082 290
25 iso_pr_bacteria 2820357977 2820358357 290
26 3300042616 Ga0466715_620245 Ga0466715_620245_8326_9267 291
27 3300042602 Ga0466713_054851 Ga0466713_054851_23777_24700 292
28 3300010167 Ga0123353_10415236 Ga0123353_104152363 293
29 3300042611 Ga0466697_122719 Ga0466697_122719_532_1419 295
30 3300010167 Ga0123353_10131501 Ga0123353_101315015 298
31 3300042591 Ga0466692_116957 Ga0466692_116957_62_958 298
32 3300009826 Ga0123355_10136326 Ga0123355_101363266 299
33 3300042635 Ga0466702_255010 Ga0466702_255010_591_1493 300
34 3300010049 Ga0123356_10123803 Ga0123356_101238033 301
35 3300010167 Ga0123353_10738910 Ga0123353_107389102 301
36 3300042602 Ga0466713_156894 Ga0466713_156894_3387_4292 301
37 3300042609 Ga0466722_149034 Ga0466722_149034_2749_3654 301
38 3300042616 Ga0466715_200707 Ga0466715_200707_2721_3626 301
39 3300042601 Ga0466707_419478 Ga0466707_419478_4605_5513 302
40 3300042602 Ga0466713_032560 Ga0466713_032560_3539_4447 302
41 3300042605 Ga0466716_005763 Ga0466716_005763_1482_2390 302
42 3300042605 Ga0466716_216128 Ga0466716_216128_6639_7547 302
43 3300000062 IMNBL1DRAFT_c0002631 IMNBL1DRAFT_000263111 303
44 3300000062 IMNBL1DRAFT_c0018037 IMNBL1DRAFT_00180372 303
45 3300005200 Ga0072940_1356567 Ga0072940_13565672 303
46 3300009784 Ga0123357_10339027 Ga0123357_103390271 303
47 3300010167 Ga0123353_10727670 Ga0123353_107276702 303
48 3300042605 Ga0466716_504370 Ga0466716_504370_3677_4588 303
49 3300042609 Ga0466722_239809 Ga0466722_239809_372_1319 303
50 3300042615 Ga0466711_494909 Ga0466711_494909_3743_4654 303
51 3300042616 Ga0466715_559916 Ga0466715_559916_6716_7627 303
52 3300042617 Ga0466718_064570 Ga0466718_064570_13988_14899 303
53 3300042618 Ga0466723_022700 Ga0466723_022700_14448_15359 303
54 3300042621 Ga0466729_114210 Ga0466729_114210_2253_3164 303
55 3300042636 Ga0466703_039914 Ga0466703_039914_8475_9386 303
56 3300042643 Ga0466704_521846 Ga0466704_521846_2470_3381 303
57 iso_pr_bacteria 2524614537 2524833560 303
58 iso_pr_bacteria 2751185832 2753509737 303
59 iso_pr_bacteria 2820429680 2820430684 303
60 iso_pr_bacteria 2820474468 2820476058 303
61 iso_pr_bacteria 2820705605 2820706052 303
62 iso_pr_bacteria 2843246524 2843250330 303
63 iso_pr_bacteria 2852123468 2852128236 303
64 iso_pr_bacteria 2855361764 2855362459 303
65 iso_pr_bacteria 2916858470 2916863271 303
66 iso_pr_bacteria 2940202316 2940204508 303
67 iso_pr_bacteria 8064008355 8064011792 303
68 3300002462 JGI24702J35022_10044613 JGI24702J35022_100446132 304
69 3300002501 JGI24703J35330_11748857 JGI24703J35330_1174885731 304
70 3300002834 JGI24696J40584_12955805 JGI24696J40584_129558052 304
71 3300009826 Ga0123355_10006806 Ga0123355_100068066 304
72 3300010167 Ga0123353_10000996 Ga0123353_1000099624 304
73 3300010167 Ga0123353_10003759 Ga0123353_100037594 304
74 3300010167 Ga0123353_10636038 Ga0123353_106360382 304
75 3300042613 Ga0466710_102939 Ga0466710_102939_95_1009 304
76 3300042617 Ga0466718_091324 Ga0466718_091324_104_1018 304
77 3300042636 Ga0466703_403284 Ga0466703_403284_1097_2011 304
78 iso_pr_bacteria 2820549969 2820550728 304
79 iso_pr_bacteria 2820584674 2820585849 304
80 iso_pr_bacteria 2900804455 2900805623 304
81 iso_pr_bacteria 8002519755 8002522051 304
82 2035265001 GhopperDRAF_NODE_354648_len_3032_cov_7_404354 GhopperDRAFT_142980 305
83 3300005083 Ga0068305_10256038 Ga0068305_102560385 305
84 3300005201 Ga0072941_1003221 Ga0072941_100322112 305
85 3300009784 Ga0123357_10041458 Ga0123357_100414583 305
86 3300009826 Ga0123355_10159935 Ga0123355_101599352 305
87 3300010167 Ga0123353_10013338 Ga0123353_100133386 305
88 3300042596 Ga0466696_278891 Ga0466696_278891_97579_98496 305
89 3300042599 Ga0466706_138852 Ga0466706_138852_34328_35245 305
90 3300042601 Ga0466707_278592 Ga0466707_278592_75254_76171 305
91 3300042609 Ga0466722_062168 Ga0466722_062168_1942_2859 305
92 3300042655 Ga0466727_294305 Ga0466727_294305_10667_11584 305
93 3300042659 Ga0466733_151608 Ga0466733_151608_4234_5151 305
94 3300056814 Ga0562378_0234 Ga0562378_0234_61167_62084 305
95 3300056842 Ga0562377_0742 Ga0562377_0742_16345_17262 305
96 3300056842 Ga0562377_1957 Ga0562377_1957_15581_16498 305
97 iso_pr_bacteria 2820312173 2820313468 305
98 iso_pr_bacteria 2940373808 2940374638 305
99 iso_pr_bacteria 8018750880 8018751870 305
100 iso_pr_bacteria 8018754795 8018756498 305
101 3300002504 JGI24705J35276_12238076 JGI24705J35276_1223807614 306
102 3300010167 Ga0123353_10003277 Ga0123353_1000327713 306
103 3300010167 Ga0123353_10230193 Ga0123353_102301932 306
104 3300042636 Ga0466703_125596 Ga0466703_125596_1283_2203 306
105 3300056790 Ga0562379_0455 Ga0562379_0455_58832_59752 306
106 3300056857 Ga0562376_1303 Ga0562376_1303_4700_5620 306
107 iso_pr_bacteria 2917496769 2917496931 306
108 iso_pr_bacteria 2940228231 2940230232 306
109 iso_pr_bacteria 8012112996 8012113154 306
110 iso_pr_bacteria 8112490586 8112490729 306
111 3300009826 Ga0123355_10091507 Ga0123355_100915073 307
112 3300010049 Ga0123356_10039960 Ga0123356_100399602 307
113 3300042591 Ga0466692_169156 Ga0466692_169156_7930_8853 307
114 3300042599 Ga0466706_193899 Ga0466706_193899_579_1502 307
115 3300042599 Ga0466706_201404 Ga0466706_201404_18546_19469 307
116 3300042609 Ga0466722_016215 Ga0466722_016215_4202_5125 307
117 3300042619 Ga0466726_191097 Ga0466726_191097_3984_4907 307
118 3300042624 Ga0466735_183521 Ga0466735_183521_17885_18808 307
119 3300042643 Ga0466704_026770 Ga0466704_026770_39404_40327 307
120 iso_pr_bacteria 2775507073 2777017496 307
121 iso_pr_bacteria 2820426531 2820427656 307
122 iso_pr_bacteria 8018794549 8018796546 307
123 3300010049 Ga0123356_10279749 Ga0123356_102797492 308
124 3300056842 Ga0562377_0010 Ga0562377_0010_929247_930173 308
125 3300056856 Ga0562375_0009 Ga0562375_0009_1186881_1187807 308
126 iso_pr_bacteria 2834951433 2834952612 308
127 iso_pr_bacteria 2940218408 2940219474 308
128 iso_pr_bacteria 2940261461 2940262521 308
129 3300042616 Ga0466715_037900 Ga0466715_037900_74246_75175 309
130 3300056790 Ga0562379_0005 Ga0562379_0005_2152668_2153597 309
131 3300056790 Ga0562379_0078 Ga0562379_0078_220753_221682 309
132 3300056814 Ga0562378_0208 Ga0562378_0208_85424_86353 309
133 3300056856 Ga0562375_0063 Ga0562375_0063_408498_409427 309
134 iso_pr_bacteria 2820236043 2820237358 309
135 iso_pr_bacteria 8038268975 8038269565 309
136 3300005200 Ga0072940_1317600 Ga0072940_13176006 310
137 3300007767 Ga0105553_1039235 Ga0105553_10392358 310
138 3300010167 Ga0123353_10005512 Ga0123353_100055125 310
139 3300042635 Ga0466702_310712 Ga0466702_310712_13251_14183 310
140 iso_pr_bacteria 2820240463 2820242447 310
141 iso_pr_bacteria 2825804107 2825806405 310
142 iso_pr_bacteria 2850695442 2850696105 310
143 2225789004 2227480168 2227937647 311
144 3300009826 Ga0123355_10006048 Ga0123355_1000604819 311
145 3300042613 Ga0466710_258608 Ga0466710_258608_252_1187 311
146 3300056790 Ga0562379_0401 Ga0562379_0401_59001_59936 311
147 3300056856 Ga0562375_0201 Ga0562375_0201_8598_9533 311
148 3300057007 Ga0562374_0006 Ga0562374_0006_105615_106550 311
149 iso_pr_bacteria 2878857142 2878857449 311
150 3300003973 Ga0063521_1001778 Ga0063521_10017785 312
151 iso_pr_bacteria 647533136 647747864 312
152 iso_pr_bacteria 8077780672 8077782176 312
153 3300002501 JGI24703J35330_11747475 JGI24703J35330_117474754 313
154 3300002932 CVPL010L_1001223 CVPL010L_10012232 313
155 3300009826 Ga0123355_10039016 Ga0123355_100390165 313
156 3300042608 Ga0466721_242939 Ga0466721_242939_272_1213 313
157 3300042621 Ga0466729_187625 Ga0466729_187625_1882_2823 313
158 iso_pr_bacteria 2767802234 2769330102 313
159 iso_pr_bacteria 2864816158 2864820005 313
160 3300042617 Ga0466718_097691 Ga0466718_097691_42_986 314
161 3300042619 Ga0466726_221848 Ga0466726_221848_1314_2258 314
162 iso_pr_bacteria 2905310146 2905311894 314
163 3300010167 Ga0123353_10000366 Ga0123353_1000036626 315
164 3300002462 JGI24702J35022_10008652 JGI24702J35022_100086524 316
165 3300002462 JGI24702J35022_10021564 JGI24702J35022_100215643 316
166 3300010167 Ga0123353_10077696 Ga0123353_100776962 316
167 3300042603 Ga0466714_064391 Ga0466714_064391_305_1255 316
168 3300056842 Ga0562377_0231 Ga0562377_0231_95904_96854 316
169 3300056842 Ga0562377_2700 Ga0562377_2700_5295_6260 321
170 3300010049 Ga0123356_10007342 Ga0123356_100073422 322
171 3300042612 Ga0466705_506200 Ga0466705_506200_7863_8843 326
172 3300042620 Ga0466728_017755 Ga0466728_017755_17406_18401 331
173 3300042602 Ga0466713_007360 Ga0466713_007360_2936_3943 335
174 3300042648 Ga0466709_147127 Ga0466709_147127_22802_23809 335

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01180 DHO_dh Dihydroorotate dehydrogenase 31 315 0.99
PF03060 NMO Nitronate monooxygenase 241 296 0.9
PF00977 His_biosynth Histidine biosynthesis protein 250 324 0.87
PF01207 Dus Dihydrouridine synthase (Dus) 132 306 0.84

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03060 GO:0018580 nitronate monooxygenase activity MF
PF00977 GO:0000105 L-histidine biosynthetic process BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.