Protein Family IF05998

Metagenome Isolate
230 Members
60 Samples
223 Scaffolds
360.04 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_407003|Ga0466707_407003_4880_6013
Length
377 aa
Sequence
MGCELDRIFAGKGNSTMKKALISGVTGQDGAYLSEFLLHKGYEVHGIKRRASSFNTDRIDHLYQDPHEKNKRFFLHYGDLTDTSNIVRIIQEVRPDEIYNLGAQSHVQVSFEVPEYTADADGLGTLRLLEAIRILGMEKKVRLYQASTSELFGKVQEIPQRETTPFYPRSPYAAAKLYAYWIVVNYRESYGMYACNGILFNHESPIRGETFVTRKVTRAAARIKLGLQDKLFMGNIDSKRDWGFAGDYVELMWLMLQQDAPDDYIMATGVTTRVRDFIAMAFAEAGITLKWEGSGVNEKGIDAESGKTLVEIDPKYFRPAEVDILIGDPTKAVTKLGWKPKVQLPELVRMMVKNDLEIAEREIHLKKGGYTIKNYYE

📊 Sample Types

Isolate 3.0%
Metagenome 97.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.3%
Kalotermitidae 23.7%
Unclassified 15.3%
Termopsidae 6.8%
Formicidae 5.1%
Rhinotermitidae 5.1%
Daphniidae 1.7%
Culicidae 1.7%
Hodotermitidae 1.7%
Passalidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 211
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2556921669 Shinella sp. DD12 Isolate Daphniidae
2 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
8 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
14 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
17 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
24 2820010479 Unclassified Spirochaetes Th196P4bin55 Isolate Unclassified
25 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
26 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
27 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
30 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
31 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
32 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
35 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
36 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
37 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
38 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
39 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
40 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
41 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
44 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
45 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
46 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
47 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
48 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
49 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
50 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
51 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
52 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
53 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
54 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
55 2820215626 Unclassified Kiritimatiellaeota Nt197P3bin123 Isolate Unclassified
56 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
57 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
58 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
59 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
60 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_155555 3300042612 Bacteria 10673
2 Ga0466705_222525 3300042612 Unclassified 9497
3 Ga0466732_014040 3300042656 Bacteria 45614
4 Ga0466712_052579 3300042614 Bacteria 20988
5 Ga0466711_222211 3300042615 Bacteria 23711
6 Ga0466711_405393 3300042615 Bacteria 5102
7 Ga0466715_096909 3300042616 Bacteria 3898
8 Ga0466715_187074 3300042616 Bacteria 2062
9 Ga0466726_062635 3300042619 Bacteria 4645
10 Ga0466728_448040 3300042620 Bacteria 14502
11 Ga0466729_254100 3300042621 Bacteria 4005
12 Ga0466735_005020 3300042624 Bacteria 1497
13 Ga0466730_103184 3300042625 Bacteria 430539
14 Ga0466703_359855 3300042636 Bacteria 2337
15 Ga0466709_159182 3300042648 Bacteria 5192
16 Ga0466708_167407 3300042652 Bacteria 4512
17 Ga0264413_130029 3300024493 Bacteria 11639
18 Ga0466690_343583 3300042590 Bacteria 1371
19 Ga0466691_141887 3300042593 Bacteria 2837
20 Ga0466699_088613 3300042597 Bacteria 91931
21 Ga0466699_103184 3300042597 Bacteria 50050
22 Ga0123353_10692297 3300010167 Bacteria 1433
23 Ga0466707_339723 3300042601 Bacteria 5526
24 Ga0466719_025223 3300042606 Bacteria 8914
25 Ga0466720_088947 3300042607 Bacteria 35866
26 Ga0466698_019507 3300042610 Bacteria 1622
27 AustNasuHG_c1005480 3300000089 Unclassified 4534
28 AustNasuHG_c1016618 3300000089 Unclassified 2458
29 JGI24698J34947_10013235 3300002449 Bacteria 4507
30 Ga0068302_10114806 3300005071 Bacteria 2490
31 Ga0466712_255603 3300042614 Bacteria 2230
32 Ga0466711_506740 3300042615 Bacteria 9051
33 Ga0466715_383273 3300042616 Bacteria 14984
34 Ga0466715_436538 3300042616 Unclassified 2659
35 Ga0466726_107116 3300042619 Bacteria 1978
36 Ga0466726_121530 3300042619 Bacteria 2809
37 Ga0466726_407865 3300042619 Bacteria 5996
38 Ga0466726_443895 3300042619 Bacteria 1837
39 Ga0466726_453231 3300042619 Bacteria 23036
40 Ga0466702_278760 3300042635 Bacteria 1648
41 Ga0466703_046479 3300042636 Bacteria 1882
42 Ga0466704_533230 3300042643 Bacteria 3574
43 Ga0466724_37932 3300042649 Bacteria 325221
44 Ga0466708_115688 3300042652 Bacteria 7560
45 Ga0466727_154470 3300042655 Bacteria 5561
46 Ga0466727_181029 3300042655 Bacteria 14375
47 Ga0264413_144475 3300024493 Bacteria 6139
48 Ga0466690_188657 3300042590 Bacteria 1688
49 Ga0466691_160775 3300042593 Bacteria 10837
50 Ga0466695_175366 3300042595 Bacteria 1542
51 Ga0466699_140004 3300042597 Bacteria 9722
52 Ga0466707_307614 3300042601 Bacteria 54795
53 Ga0466719_119570 3300042606 Unclassified 2116
54 Ga0466719_536782 3300042606 Bacteria 22487
55 Ga0466720_012895 3300042607 Bacteria 75127
56 Ga0466720_131560 3300042607 Bacteria 48024
57 JGI24695J34938_10010631 3300002450 Bacteria 5022
58 JGI24695J34938_10034656 3300002450 Bacteria 2314
59 JGI24702J35022_10005854 3300002462 Bacteria 7151
60 Ga0466718_058641 3300042617 Bacteria 14058
61 Ga0466718_149421 3300042617 Bacteria 7099
62 Ga0466726_032144 3300042619 Bacteria 3962
63 Ga0466728_383692 3300042620 Bacteria 5957
64 Ga0466702_334994 3300042635 Bacteria 5067
65 Ga0466703_202571 3300042636 Bacteria 5818
66 Ga0466704_252811 3300042643 Bacteria 3387
67 Ga0466709_125856 3300042648 Bacteria 4414
68 Ga0466708_129239 3300042652 Bacteria 6499
69 Ga0466708_348483 3300042652 Bacteria 6771
70 Ga0160472_100076 3300012839 Bacteria 162972
71 Ga0264413_130018 3300024493 Bacteria 4642
72 Ga0456237_0000880 3300041968 Bacteria 4722
73 Ga0466692_120803 3300042591 Bacteria 9382
74 Ga0466692_183929 3300042591 Bacteria 5019
75 Ga0466691_135981 3300042593 Bacteria 4333
76 Ga0466699_025462 3300042597 Bacteria 14239
77 Ga0466699_051193 3300042597 Bacteria 5044
78 Ga0466699_164791 3300042597 Bacteria 2677
79 Ga0466699_279932 3300042597 Bacteria 1795
80 Ga0466699_425983 3300042597 Bacteria 2888
81 Ga0466706_169152 3300042599 Bacteria 2355
82 AustNasuHG_c1007559 3300000089 Unclassified 3858
83 Ga0466705_073088 3300042612 Bacteria 16899
84 Ga0466732_047959 3300042656 Unclassified 10589
85 Ga0466732_227977 3300042656 Bacteria 17179
86 Ga0466705_407256 3300042612 Bacteria 6643
87 Ga0466712_023843 3300042614 Bacteria 22246
88 Ga0466712_170058 3300042614 Bacteria 6603
89 Ga0466718_013791 3300042617 Bacteria 36967
90 Ga0466726_314489 3300042619 Bacteria 6295
91 Ga0466726_346816 3300042619 Bacteria 19893
92 Ga0466728_428094 3300042620 Bacteria 1851
93 Ga0466735_013511 3300042624 Bacteria 1945
94 Ga0466703_230351 3300042636 Bacteria 2426
95 Ga0466704_045974 3300042643 Unclassified 1453
96 Ga0466727_167730 3300042655 Bacteria 2496
97 Ga0466727_308651 3300042655 Bacteria 1636
98 Ga0264413_113106 3300024493 Bacteria 6645
99 Ga0264413_130176 3300024493 Bacteria 4769
100 Ga0466691_032366 3300042593 Bacteria 2454
101 Ga0466713_091793 3300042602 Bacteria 7782
102 Ga0466717_088342 3300042604 Bacteria 1567
103 Ga0466720_084667 3300042607 Bacteria 9501
104 2227289122 2225789004 Bacteria 6731
105 JGI24698J34947_10019534 3300002449 Bacteria 3655
106 JGI24700J35501_10930789 3300002508 Bacteria 24096
107 Ga0466711_287934 3300042615 Bacteria 10820
108 Ga0466711_500941 3300042615 Bacteria 2562
109 Ga0466715_049034 3300042616 Bacteria 21580
110 Ga0466715_322538 3300042616 Bacteria 4870
111 Ga0466723_240599 3300042618 Bacteria 21672
112 Ga0466723_265570 3300042618 Bacteria 2340
113 Ga0466726_104369 3300042619 Bacteria 3307
114 Ga0466704_152795 3300042643 Bacteria 9678
115 Ga0466704_531949 3300042643 Bacteria 19307
116 Ga0466724_25707 3300042649 Bacteria 20045
117 Ga0466692_066226 3300042591 Bacteria 16969
118 Ga0466692_175042 3300042591 Bacteria 5723
119 Ga0466693_194917 3300042592 Bacteria 2805
120 Ga0466691_006945 3300042593 Bacteria 10732
121 Ga0466691_018555 3300042593 Bacteria 15185
122 Ga0466694_103716 3300042594 Bacteria 2120
123 Ga0466699_118972 3300042597 Bacteria 29522
124 Ga0466699_159096 3300042597 Bacteria 3493
125 Ga0466699_222854 3300042597 Bacteria 1471
126 Ga0466699_386498 3300042597 Bacteria 3148
127 Ga0123355_10000659 3300009826 Bacteria 46817
128 Ga0466707_409008 3300042601 Bacteria 1947
129 Ga0466716_300829 3300042605 Bacteria 2743
130 Ga0466720_046917 3300042607 Bacteria 61630
131 Ga0466720_109839 3300042607 Bacteria 13943
132 Ga0466720_166545 3300042607 Bacteria 1592
133 AustNasuHG_c1013239 3300000089 Bacteria 2832
134 JGI24702J35022_10021695 3300002462 Bacteria 3481
135 Ga0466732_132729 3300042656 Bacteria 1206
136 Ga0466732_165313 3300042656 Unclassified 8517
137 Ga0466715_063984 3300042616 Bacteria 3747
138 Ga0466715_282120 3300042616 Bacteria 19105
139 Ga0466718_135231 3300042617 Bacteria 1972
140 Ga0466718_142718 3300042617 Bacteria 3958
141 Ga0466726_083553 3300042619 Bacteria 12952
142 Ga0466726_092030 3300042619 Bacteria 4971
143 Ga0466726_328179 3300042619 Bacteria 13195
144 Ga0466734_137994 3300042623 Bacteria 2267
145 Ga0466703_103794 3300042636 Bacteria 6558
146 Ga0466703_180752 3300042636 Bacteria 53591
147 Ga0466704_116062 3300042643 Bacteria 4261
148 Ga0466704_196391 3300042643 Bacteria 1999
149 Ga0466704_540763 3300042643 Bacteria 3213
150 Ga0466704_591323 3300042643 Unclassified 3365
151 Ga0466709_078962 3300042648 Bacteria 7955
152 Ga0466709_203933 3300042648 Unclassified 3805
153 Ga0466709_246429 3300042648 Bacteria 6953
154 Ga0466709_247574 3300042648 Unclassified 7750
155 Ga0466727_287120 3300042655 Unclassified 1378
156 Ga0456237_0000951 3300041968 Bacteria 4555
157 Ga0466691_108014 3300042593 Bacteria 8191
158 Ga0466696_214550 3300042596 Bacteria 1565
159 Ga0466699_043963 3300042597 Bacteria 22179
160 Ga0466699_404390 3300042597 Bacteria 2266
161 Ga0466699_437613 3300042597 Bacteria 28017
162 Ga0123355_10002172 3300009826 Bacteria 27651
163 Ga0123353_10120850 3300010167 Unclassified 4212
164 Ga0123353_10256866 3300010167 Bacteria 2702
165 Ga0466707_159112 3300042601 Bacteria 3536
166 Ga0466707_404135 3300042601 Bacteria 1562
167 Ga0466716_455033 3300042605 Bacteria 1300
168 Ga0466720_048496 3300042607 Bacteria 6333
169 AustNasuHG_c1013379 3300000089 Unclassified 2813
170 JGI24695J34938_10004265 3300002450 Bacteria 9463
171 JGI24695J34938_10009119 3300002450 Bacteria 5551
172 JGI24695J34938_10032034 3300002450 Bacteria 2433
173 Ga0102734_1002339 3300007129 Bacteria 9234
174 Ga0102740_1000238 3300007140 Bacteria 15885
175 Ga0466705_037517 3300042612 Bacteria 13726
176 Ga0466705_429802 3300042612 Bacteria 4644
177 Ga0466726_033777 3300042619 Bacteria 3078
178 Ga0466726_034060 3300042619 Bacteria 15500
179 Ga0466726_109582 3300042619 Bacteria 4829
180 Ga0466726_380703 3300042619 Bacteria 6982
181 Ga0466735_038650 3300042624 Bacteria 16304
182 Ga0466704_023429 3300042643 Unclassified 2315
183 Ga0466704_611132 3300042643 Bacteria 7052
184 Ga0466690_000156 3300042590 Bacteria 1551
185 Ga0466692_073689 3300042591 Bacteria 2928
186 Ga0466692_181859 3300042591 Bacteria 4856
187 Ga0466691_170012 3300042593 Bacteria 38393
188 Ga0466696_371532 3300042596 Bacteria 5332
189 Ga0123356_10442260 3300010049 Bacteria 1447
190 Ga0123353_10354165 3300010167 Bacteria 2210
191 Ga0123353_10455076 3300010167 Bacteria 1883
192 Ga0466707_407003 3300042601 Bacteria 9031
193 Ga0466716_021507 3300042605 Bacteria 1422
194 Ga0466720_111060 3300042607 Bacteria 15389
195 JGI24695J34938_10019396 3300002450 Bacteria 3371
196 Ga0068302_10249455 3300005071 Bacteria 3637
197 Ga0068305_10013509 3300005083 Bacteria 19158
198 Ga0466705_069379 3300042612 Bacteria 11811
199 Ga0466705_071801 3300042612 Unclassified 10473
200 Ga0466705_368462 3300042612 Bacteria 5994
201 Ga0466715_582525 3300042616 Bacteria 12290
202 Ga0466718_129224 3300042617 Bacteria 36457
203 Ga0466726_233406 3300042619 Bacteria 1410
204 Ga0466726_383371 3300042619 Bacteria 24063
205 Ga0466726_393190 3300042619 Bacteria 2408
206 Ga0466703_182948 3300042636 Bacteria 14030
207 Ga0466704_074570 3300042643 Bacteria 2648
208 Ga0466708_051941 3300042652 Bacteria 9560
209 Ga0466708_420903 3300042652 Bacteria 1421
210 Ga0466691_047325 3300042593 Bacteria 2378
211 Ga0466691_073673 3300042593 Bacteria 3268
212 Ga0466691_217074 3300042593 Bacteria 7694
213 Ga0123353_10014823 3300010167 Unclassified 11271
214 Ga0123353_10688150 3300010167 Bacteria 1438
215 Ga0466706_007687 3300042599 Bacteria 2493
216 Ga0466707_343058 3300042601 Bacteria 2187
217 Ga0466719_241815 3300042606 Bacteria 12515
218 Ga0466720_112435 3300042607 Bacteria 45324
219 Ga0466720_145662 3300042607 Bacteria 157622
220 Ga0466720_203223 3300042607 Bacteria 14766
221 AustNasuHG_c1009754 3300000089 Bacteria 3362
222 AustNasuHG_c1024734 3300000089 Unclassified 1898
223 CVPL010W_10000014 3300002931 Bacteria 89080

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042610 Ga0466698_019507 Ga0466698_019507_27_959 310
2 3300002449 JGI24698J34947_10019534 JGI24698J34947_100195341 319
3 3300042614 Ga0466712_255603 Ga0466712_255603_1244_2203 319
4 3300042590 Ga0466690_188657 Ga0466690_188657_292_1341 334
5 3300010049 Ga0123356_10442260 Ga0123356_104422601 335
6 3300024493 Ga0264413_144475 Ga0264413_1444754 339
7 3300042655 Ga0466727_181029 Ga0466727_181029_12312_13343 343
8 iso_pr_bacteria 2820215626 2820216708 343
9 2225789004 2227289122 2227740121 346
10 3300002462 JGI24702J35022_10005854 JGI24702J35022_100058541 347
11 3300009826 Ga0123355_10002172 Ga0123355_1000217217 348
12 3300042606 Ga0466719_119570 Ga0466719_119570_433_1482 349
13 3300042619 Ga0466726_383371 Ga0466726_383371_6678_7745 349
14 3300042643 Ga0466704_611132 Ga0466704_611132_5059_6108 349
15 3300042652 Ga0466708_129239 Ga0466708_129239_5111_6160 349
16 3300010167 Ga0123353_10692297 Ga0123353_106922972 350
17 3300042592 Ga0466693_194917 Ga0466693_194917_691_1743 350
18 3300042623 Ga0466734_137994 Ga0466734_137994_1039_2091 350
19 3300010167 Ga0123353_10014823 Ga0123353_100148233 351
20 3300010167 Ga0123353_10120850 Ga0123353_101208501 351
21 3300010167 Ga0123353_10354165 Ga0123353_103541653 351
22 3300010167 Ga0123353_10455076 Ga0123353_104550762 351
23 3300007140 Ga0102740_1000238 Ga0102740_10002382 356
24 3300042606 Ga0466719_025223 Ga0466719_025223_61_1131 356
25 iso_pr_bacteria 2556921669 2558282108 356
26 3300042649 Ga0466724_25707 Ga0466724_25707_9440_10513 357
27 3300002449 JGI24698J34947_10013235 JGI24698J34947_100132354 359
28 3300042625 Ga0466730_103184 Ga0466730_103184_255503_256582 359
29 3300042649 Ga0466724_37932 Ga0466724_37932_97011_98090 359
30 iso_pr_bacteria 2820171952 2820173787 359
31 3300007129 Ga0102734_1002339 Ga0102734_10023399 360
32 3300024493 Ga0264413_113106 Ga0264413_1131062 361
33 3300024493 Ga0264413_130018 Ga0264413_1300182 361
34 3300024493 Ga0264413_130029 Ga0264413_1300294 361
35 3300024493 Ga0264413_130176 Ga0264413_1301765 361
36 3300041968 Ga0456237_0000880 Ga0456237_0000880_2111_3196 361
37 3300041968 Ga0456237_0000951 Ga0456237_0000951_2933_4018 361
38 3300042590 Ga0466690_000156 Ga0466690_000156_207_1292 361
39 3300042590 Ga0466690_343583 Ga0466690_343583_132_1217 361
40 3300042591 Ga0466692_066226 Ga0466692_066226_9225_10310 361
41 3300042591 Ga0466692_120803 Ga0466692_120803_1632_2717 361
42 3300042591 Ga0466692_175042 Ga0466692_175042_3363_4448 361
43 3300042591 Ga0466692_181859 Ga0466692_181859_2034_3119 361
44 3300042591 Ga0466692_183929 Ga0466692_183929_444_1529 361
45 3300042593 Ga0466691_006945 Ga0466691_006945_2416_3501 361
46 3300042593 Ga0466691_018555 Ga0466691_018555_3681_4766 361
47 3300042593 Ga0466691_032366 Ga0466691_032366_152_1237 361
48 3300042593 Ga0466691_047325 Ga0466691_047325_1248_2333 361
49 3300042593 Ga0466691_073673 Ga0466691_073673_1149_2234 361
50 3300042593 Ga0466691_135981 Ga0466691_135981_3025_4110 361
51 3300042593 Ga0466691_160775 Ga0466691_160775_8612_9697 361
52 3300042593 Ga0466691_170012 Ga0466691_170012_21591_22676 361
53 3300042593 Ga0466691_217074 Ga0466691_217074_157_1242 361
54 3300042594 Ga0466694_103716 Ga0466694_103716_94_1179 361
55 3300042597 Ga0466699_025462 Ga0466699_025462_988_2073 361
56 3300042597 Ga0466699_043963 Ga0466699_043963_2152_3237 361
57 3300042597 Ga0466699_051193 Ga0466699_051193_3369_4454 361
58 3300042597 Ga0466699_088613 Ga0466699_088613_59693_60778 361
59 3300042597 Ga0466699_103184 Ga0466699_103184_18837_19922 361
60 3300042597 Ga0466699_118972 Ga0466699_118972_1728_2813 361
61 3300042597 Ga0466699_159096 Ga0466699_159096_1959_3044 361
62 3300042597 Ga0466699_164791 Ga0466699_164791_40_1125 361
63 3300042597 Ga0466699_222854 Ga0466699_222854_150_1235 361
64 3300042597 Ga0466699_386498 Ga0466699_386498_1213_2298 361
65 3300042597 Ga0466699_404390 Ga0466699_404390_826_1911 361
66 3300042597 Ga0466699_437613 Ga0466699_437613_13852_14937 361
67 3300042599 Ga0466706_169152 Ga0466706_169152_1088_2173 361
68 3300042601 Ga0466707_307614 Ga0466707_307614_15605_16690 361
69 3300042601 Ga0466707_343058 Ga0466707_343058_687_1772 361
70 3300042601 Ga0466707_404135 Ga0466707_404135_19_1104 361
71 3300042601 Ga0466707_409008 Ga0466707_409008_707_1792 361
72 3300042602 Ga0466713_091793 Ga0466713_091793_6562_7647 361
73 3300042604 Ga0466717_088342 Ga0466717_088342_212_1297 361
74 3300042605 Ga0466716_300829 Ga0466716_300829_188_1273 361
75 3300042605 Ga0466716_455033 Ga0466716_455033_27_1112 361
76 3300042606 Ga0466719_241815 Ga0466719_241815_9211_10296 361
77 3300042607 Ga0466720_046917 Ga0466720_046917_28922_30007 361
78 3300042607 Ga0466720_048496 Ga0466720_048496_1899_2984 361
79 3300042607 Ga0466720_088947 Ga0466720_088947_5894_6979 361
80 3300042607 Ga0466720_109839 Ga0466720_109839_5353_6438 361
81 3300042607 Ga0466720_111060 Ga0466720_111060_2967_4052 361
82 3300042607 Ga0466720_112435 Ga0466720_112435_25301_26386 361
83 3300042607 Ga0466720_131560 Ga0466720_131560_5092_6177 361
84 3300042607 Ga0466720_145662 Ga0466720_145662_90289_91374 361
85 3300042607 Ga0466720_166545 Ga0466720_166545_164_1249 361
86 3300042607 Ga0466720_203223 Ga0466720_203223_2579_3664 361
87 3300042612 Ga0466705_037517 Ga0466705_037517_8964_10049 361
88 3300042612 Ga0466705_069379 Ga0466705_069379_7256_8341 361
89 3300042612 Ga0466705_071801 Ga0466705_071801_2800_3885 361
90 3300042612 Ga0466705_073088 Ga0466705_073088_6580_7665 361
91 3300042612 Ga0466705_155555 Ga0466705_155555_805_1890 361
92 3300042612 Ga0466705_222525 Ga0466705_222525_7219_8304 361
93 3300042612 Ga0466705_407256 Ga0466705_407256_4083_5168 361
94 3300042612 Ga0466705_429802 Ga0466705_429802_630_1715 361
95 3300042614 Ga0466712_023843 Ga0466712_023843_20206_21291 361
96 3300042614 Ga0466712_052579 Ga0466712_052579_17661_18746 361
97 3300042614 Ga0466712_170058 Ga0466712_170058_2920_4005 361
98 3300042615 Ga0466711_222211 Ga0466711_222211_17562_18647 361
99 3300042615 Ga0466711_287934 Ga0466711_287934_4999_6084 361
100 3300042615 Ga0466711_506740 Ga0466711_506740_1537_2622 361
101 3300042616 Ga0466715_049034 Ga0466715_049034_3467_4552 361
102 3300042616 Ga0466715_063984 Ga0466715_063984_2489_3574 361
103 3300042616 Ga0466715_096909 Ga0466715_096909_1853_2938 361
104 3300042616 Ga0466715_187074 Ga0466715_187074_564_1649 361
105 3300042616 Ga0466715_282120 Ga0466715_282120_1798_2883 361
106 3300042616 Ga0466715_322538 Ga0466715_322538_414_1499 361
107 3300042616 Ga0466715_383273 Ga0466715_383273_6100_7185 361
108 3300042616 Ga0466715_582525 Ga0466715_582525_3680_4765 361
109 3300042617 Ga0466718_013791 Ga0466718_013791_6562_7647 361
110 3300042617 Ga0466718_058641 Ga0466718_058641_1589_2674 361
111 3300042617 Ga0466718_129224 Ga0466718_129224_25928_27013 361
112 3300042617 Ga0466718_135231 Ga0466718_135231_384_1469 361
113 3300042617 Ga0466718_142718 Ga0466718_142718_2159_3244 361
114 3300042617 Ga0466718_149421 Ga0466718_149421_4953_6038 361
115 3300042618 Ga0466723_240599 Ga0466723_240599_18974_20059 361
116 3300042618 Ga0466723_265570 Ga0466723_265570_651_1736 361
117 3300042619 Ga0466726_032144 Ga0466726_032144_1175_2260 361
118 3300042619 Ga0466726_034060 Ga0466726_034060_5215_6300 361
119 3300042619 Ga0466726_062635 Ga0466726_062635_1668_2753 361
120 3300042619 Ga0466726_083553 Ga0466726_083553_3941_5026 361
121 3300042619 Ga0466726_092030 Ga0466726_092030_1862_2947 361
122 3300042619 Ga0466726_104369 Ga0466726_104369_1383_2468 361
123 3300042619 Ga0466726_107116 Ga0466726_107116_865_1950 361
124 3300042619 Ga0466726_109582 Ga0466726_109582_1153_2238 361
125 3300042619 Ga0466726_121530 Ga0466726_121530_1190_2275 361
126 3300042619 Ga0466726_233406 Ga0466726_233406_176_1261 361
127 3300042619 Ga0466726_314489 Ga0466726_314489_3680_4765 361
128 3300042619 Ga0466726_328179 Ga0466726_328179_10355_11440 361
129 3300042619 Ga0466726_346816 Ga0466726_346816_11982_13067 361
130 3300042619 Ga0466726_380703 Ga0466726_380703_2406_3491 361
131 3300042619 Ga0466726_407865 Ga0466726_407865_2431_3516 361
132 3300042619 Ga0466726_443895 Ga0466726_443895_326_1411 361
133 3300042619 Ga0466726_453231 Ga0466726_453231_12882_13967 361
134 3300042620 Ga0466728_383692 Ga0466728_383692_2689_3774 361
135 3300042620 Ga0466728_428094 Ga0466728_428094_98_1183 361
136 3300042620 Ga0466728_448040 Ga0466728_448040_6727_7812 361
137 3300042624 Ga0466735_005020 Ga0466735_005020_337_1422 361
138 3300042624 Ga0466735_013511 Ga0466735_013511_791_1876 361
139 3300042635 Ga0466702_278760 Ga0466702_278760_138_1223 361
140 3300042635 Ga0466702_334994 Ga0466702_334994_901_1986 361
141 3300042636 Ga0466703_046479 Ga0466703_046479_239_1324 361
142 3300042636 Ga0466703_103794 Ga0466703_103794_4366_5451 361
143 3300042636 Ga0466703_180752 Ga0466703_180752_11974_13059 361
144 3300042636 Ga0466703_182948 Ga0466703_182948_494_1579 361
145 3300042636 Ga0466703_202571 Ga0466703_202571_1582_2667 361
146 3300042636 Ga0466703_359855 Ga0466703_359855_847_1932 361
147 3300042643 Ga0466704_023429 Ga0466704_023429_925_2010 361
148 3300042643 Ga0466704_045974 Ga0466704_045974_34_1119 361
149 3300042643 Ga0466704_074570 Ga0466704_074570_596_1681 361
150 3300042643 Ga0466704_116062 Ga0466704_116062_327_1412 361
151 3300042643 Ga0466704_152795 Ga0466704_152795_6451_7536 361
152 3300042643 Ga0466704_196391 Ga0466704_196391_648_1733 361
153 3300042643 Ga0466704_252811 Ga0466704_252811_1798_2883 361
154 3300042643 Ga0466704_531949 Ga0466704_531949_17896_18981 361
155 3300042643 Ga0466704_533230 Ga0466704_533230_1244_2329 361
156 3300042643 Ga0466704_540763 Ga0466704_540763_1079_2164 361
157 3300042643 Ga0466704_591323 Ga0466704_591323_1482_2567 361
158 3300042648 Ga0466709_078962 Ga0466709_078962_6653_7738 361
159 3300042648 Ga0466709_125856 Ga0466709_125856_185_1270 361
160 3300042648 Ga0466709_159182 Ga0466709_159182_1147_2232 361
161 3300042648 Ga0466709_203933 Ga0466709_203933_377_1462 361
162 3300042648 Ga0466709_246429 Ga0466709_246429_5740_6825 361
163 3300042648 Ga0466709_247574 Ga0466709_247574_6578_7663 361
164 3300042652 Ga0466708_115688 Ga0466708_115688_583_1668 361
165 3300042652 Ga0466708_167407 Ga0466708_167407_1562_2647 361
166 3300042652 Ga0466708_348483 Ga0466708_348483_1207_2292 361
167 3300042655 Ga0466727_308651 Ga0466727_308651_93_1178 361
168 3300042656 Ga0466732_014040 Ga0466732_014040_7046_8131 361
169 3300042656 Ga0466732_047959 Ga0466732_047959_2198_3283 361
170 3300042656 Ga0466732_132729 Ga0466732_132729_49_1134 361
171 3300042656 Ga0466732_165313 Ga0466732_165313_7363_8448 361
172 3300042656 Ga0466732_227977 Ga0466732_227977_857_1942 361
173 iso_pr_bacteria 2781125629 2781262884 361
174 iso_pr_bacteria 2781125655 2781317095 361
175 iso_pr_bacteria 2819992462 2819994650 361
176 iso_pr_bacteria 2820010479 2820010887 361
177 3300000089 AustNasuHG_c1005480 AustNasuHG_10054804 362
178 3300000089 AustNasuHG_c1007559 AustNasuHG_10075594 362
179 3300000089 AustNasuHG_c1009754 AustNasuHG_10097542 362
180 3300000089 AustNasuHG_c1013239 AustNasuHG_10132392 362
181 3300000089 AustNasuHG_c1013379 AustNasuHG_10133792 362
182 3300000089 AustNasuHG_c1016618 AustNasuHG_10166182 362
183 3300000089 AustNasuHG_c1024734 AustNasuHG_10247342 362
184 3300002450 JGI24695J34938_10009119 JGI24695J34938_100091194 362
185 3300002450 JGI24695J34938_10010631 JGI24695J34938_100106312 362
186 3300002450 JGI24695J34938_10019396 JGI24695J34938_100193963 362
187 3300002450 JGI24695J34938_10032034 JGI24695J34938_100320343 362
188 3300002450 JGI24695J34938_10034656 JGI24695J34938_100346562 362
189 3300002462 JGI24702J35022_10021695 JGI24702J35022_100216955 362
190 3300002508 JGI24700J35501_10930789 JGI24700J35501_1093078911 362
191 3300005071 Ga0068302_10114806 Ga0068302_101148062 362
192 3300005071 Ga0068302_10249455 Ga0068302_102494553 362
193 3300005083 Ga0068305_10013509 Ga0068305_1001350921 362
194 3300009826 Ga0123355_10000659 Ga0123355_1000065934 362
195 3300010167 Ga0123353_10688150 Ga0123353_106881502 362
196 3300042596 Ga0466696_371532 Ga0466696_371532_455_1543 362
197 3300042597 Ga0466699_279932 Ga0466699_279932_158_1246 362
198 3300042597 Ga0466699_425983 Ga0466699_425983_17_1105 362
199 3300042601 Ga0466707_339723 Ga0466707_339723_4231_5319 362
200 3300042615 Ga0466711_500941 Ga0466711_500941_933_2021 362
201 3300042621 Ga0466729_254100 Ga0466729_254100_769_1857 362
202 3300042636 Ga0466703_230351 Ga0466703_230351_1253_2341 362
203 3300042655 Ga0466727_154470 Ga0466727_154470_153_1241 362
204 3300042595 Ga0466695_175366 Ga0466695_175366_116_1207 363
205 3300042599 Ga0466706_007687 Ga0466706_007687_980_2071 363
206 3300042615 Ga0466711_405393 Ga0466711_405393_2799_3890 363
207 3300042593 Ga0466691_108014 Ga0466691_108014_2956_4050 364
208 3300042593 Ga0466691_141887 Ga0466691_141887_213_1307 364
209 3300042605 Ga0466716_021507 Ga0466716_021507_216_1310 364
210 3300042601 Ga0466707_159112 Ga0466707_159112_1448_2545 365
211 3300042612 Ga0466705_368462 Ga0466705_368462_2824_3921 365
212 3300042619 Ga0466726_033777 Ga0466726_033777_1126_2286 365
213 3300042652 Ga0466708_051941 Ga0466708_051941_6274_7371 365
214 3300042652 Ga0466708_420903 Ga0466708_420903_188_1285 365
215 3300042596 Ga0466696_214550 Ga0466696_214550_326_1426 366
216 3300042606 Ga0466719_536782 Ga0466719_536782_10321_11421 366
217 3300010167 Ga0123353_10256866 Ga0123353_102568663 367
218 3300042616 Ga0466715_436538 Ga0466715_436538_942_2045 367
219 3300042619 Ga0466726_393190 Ga0466726_393190_20_1123 367
220 3300002931 CVPL010W_10000014 CVPL010W_1000001435 368
221 3300042591 Ga0466692_073689 Ga0466692_073689_1164_2270 368
222 3300042655 Ga0466727_287120 Ga0466727_287120_255_1361 368
223 3300042597 Ga0466699_140004 Ga0466699_140004_4215_5324 369
224 3300002450 JGI24695J34938_10004265 JGI24695J34938_100042654 370
225 3300042607 Ga0466720_084667 Ga0466720_084667_744_1856 370
226 3300042624 Ga0466735_038650 Ga0466735_038650_12647_13771 374
227 3300042655 Ga0466727_167730 Ga0466727_167730_392_1516 374
228 3300042607 Ga0466720_012895 Ga0466720_012895_41025_42152 375
229 3300042601 Ga0466707_407003 Ga0466707_407003_4880_6013 377
230 3300012839 Ga0160472_100076 Ga0160472_10007626 384

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 21 351 0.99
PF01370 Epimerase NAD dependent epimerase/dehydratase family 20 264 0.98
PF04321 RmlD_sub_bind RmlD substrate binding domain 19 183 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.91 0.94 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.