Protein Family IF05989
Metagenome
Isolate
160
Members
69
Samples
125
Scaffolds
375.54
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_385305|Ga0466707_385305_277_1485
- Length
- 402 aa
- Sequence
- VFLEIGYTCDNYYFNNIDNVKNERKMKKRWMISLVALGILLSCGEKKEVKLTSGLEKADFVSEVAGKPTALYVLKNANGMEVCVTNYGGRIVSVMVPDKNGKLTDVVLGYDKIADYIASDGNFGALIGRYGNRIAKAKFTLNSVEYQLPENNNGNCLHGGPEGFHVQVWDAVQPDDKTLKLTYLSKDGEAGFPGNLNVTVTYSVTDNNALDIRYEATTDKLTVVNLTNHSYFNLSGIPGSQIMDHLIQINADRYTPVNELLIPTSELAPVKDTPLDLRKLIRIGDKIREPFEQMIRGRGFDHNWVLNTAGDISKPAAKAVSPESGIVLEVFTNEPGVQFYTGNAMNGKDNGKFGVNYPLRGALCLETQHYPDSPNQPTFPTTTLRPGENYLSRCIYRFSVDK
Sample Types
Isolate
21.9%
Metagenome
78.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
37.7%
Kalotermitidae
20.3%
Termitidae
18.8%
Unclassified
8.7%
Rhinotermitidae
7.2%
Termopsidae
5.8%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
155
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 12 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 13 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 14 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 15 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 20 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 21 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 22 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 23 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 24 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 25 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 26 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 27 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 28 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 29 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 33 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 34 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 35 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 38 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 39 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 40 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 41 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 42 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 43 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 44 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 45 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 46 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 47 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 48 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 49 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 50 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 51 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 54 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 55 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 56 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 57 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 58 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 59 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 60 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 61 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 62 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 63 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 64 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 65 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 66 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 67 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 68 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 69 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_048400 | 3300042659 | Bacteria | 7427 |
| 2 | Ga0466690_321779 | 3300042590 | Bacteria | 7884 |
| 3 | Ga0466692_180216 | 3300042591 | Bacteria | 20868 |
| 4 | Ga0466691_020441 | 3300042593 | Bacteria | 5166 |
| 5 | Ga0466696_025881 | 3300042596 | Bacteria | 17494 |
| 6 | Ga0466711_044318 | 3300042615 | Bacteria | 25037 |
| 7 | Ga0466715_442198 | 3300042616 | Bacteria | 5042 |
| 8 | Ga0466706_024533 | 3300042599 | Bacteria | 13296 |
| 9 | Ga0466706_094083 | 3300042599 | Bacteria | 6297 |
| 10 | Ga0466707_269407 | 3300042601 | Bacteria | 19464 |
| 11 | Ga0466713_045605 | 3300042602 | Bacteria | 15106 |
| 12 | Ga0466722_036176 | 3300042609 | Bacteria | 3226 |
| 13 | Ga0466704_041785 | 3300042643 | Bacteria | 10323 |
| 14 | Ga0466704_152719 | 3300042643 | Bacteria | 1671 |
| 15 | Ga0466708_119059 | 3300042652 | Bacteria | 13518 |
| 16 | Ga0068305_10079689 | 3300005083 | Bacteria | 3439 |
| 17 | Ga0466733_165496 | 3300042659 | Bacteria | 147790 |
| 18 | Ga0466691_073635 | 3300042593 | Bacteria | 11602 |
| 19 | Ga0466711_339108 | 3300042615 | Bacteria | 40685 |
| 20 | Ga0466715_074087 | 3300042616 | Bacteria | 30397 |
| 21 | Ga0466715_499819 | 3300042616 | Bacteria | 11901 |
| 22 | Ga0466726_116950 | 3300042619 | Unclassified | 3968 |
| 23 | Ga0466707_098491 | 3300042601 | Bacteria | 2064 |
| 24 | Ga0123353_10000423 | 3300010167 | Bacteria | 52369 |
| 25 | Ga0466704_180284 | 3300042643 | Bacteria | 2781 |
| 26 | Ga0466709_144300 | 3300042648 | Bacteria | 37983 |
| 27 | Ga0466705_037118 | 3300042612 | Bacteria | 8826 |
| 28 | Ga0466692_063390 | 3300042591 | Bacteria | 95171 |
| 29 | Ga0466696_133430 | 3300042596 | Bacteria | 12489 |
| 30 | Ga0466711_033361 | 3300042615 | Bacteria | 49617 |
| 31 | Ga0466723_138452 | 3300042618 | Bacteria | 14266 |
| 32 | Ga0466726_145902 | 3300042619 | Bacteria | 4397 |
| 33 | Ga0466726_370027 | 3300042619 | Bacteria | 7858 |
| 34 | Ga0466706_264295 | 3300042599 | Bacteria | 25580 |
| 35 | Ga0466706_276402 | 3300042599 | Bacteria | 27912 |
| 36 | Ga0466722_035106 | 3300042609 | Bacteria | 44619 |
| 37 | Ga0466722_244504 | 3300042609 | Bacteria | 11832 |
| 38 | Ga0123356_10038495 | 3300010049 | Unclassified | 4456 |
| 39 | Ga0466730_094575 | 3300042625 | Bacteria | 1576 |
| 40 | Ga0466703_078085 | 3300042636 | Bacteria | 3623 |
| 41 | Ga0466703_241934 | 3300042636 | Unclassified | 10154 |
| 42 | Ga0466704_080074 | 3300042643 | Bacteria | 18633 |
| 43 | Ga0466704_377176 | 3300042643 | Bacteria | 9517 |
| 44 | Ga0466709_297787 | 3300042648 | Bacteria | 33316 |
| 45 | Ga0466708_398349 | 3300042652 | Bacteria | 2615 |
| 46 | Ga0466705_112417 | 3300042612 | Bacteria | 33433 |
| 47 | Ga0466714_021942 | 3300042603 | Bacteria | 13165 |
| 48 | Ga0466714_026440 | 3300042603 | Bacteria | 14022 |
| 49 | Ga0466714_065611 | 3300042603 | Bacteria | 8303 |
| 50 | Ga0466729_287263 | 3300042621 | Bacteria | 11580 |
| 51 | Ga0466735_067061 | 3300042624 | Bacteria | 1901 |
| 52 | Ga0466735_203667 | 3300042624 | Bacteria | 1813 |
| 53 | Ga0466704_089691 | 3300042643 | Bacteria | 1865 |
| 54 | Ga0466709_210619 | 3300042648 | Bacteria | 6017 |
| 55 | Ga0466725_381675 | 3300042654 | Bacteria | 4035 |
| 56 | Ga0466727_101685 | 3300042655 | Bacteria | 17782 |
| 57 | Ga0466727_164377 | 3300042655 | Bacteria | 12250 |
| 58 | Ga0466727_314491 | 3300042655 | Bacteria | 7089 |
| 59 | Ga0068302_10074303 | 3300005071 | Bacteria | 10727 |
| 60 | Ga0466705_105572 | 3300042612 | Bacteria | 4845 |
| 61 | Ga0466705_381838 | 3300042612 | Bacteria | 8138 |
| 62 | Ga0466701_009529 | 3300042598 | Bacteria | 375690 |
| 63 | Ga0466711_117224 | 3300042615 | Bacteria | 16870 |
| 64 | Ga0466711_132062 | 3300042615 | Bacteria | 57759 |
| 65 | Ga0466715_052779 | 3300042616 | Bacteria | 19691 |
| 66 | Ga0466728_019784 | 3300042620 | Bacteria | 29732 |
| 67 | Ga0466713_116260 | 3300042602 | Bacteria | 47144 |
| 68 | Ga0466713_124910 | 3300042602 | Bacteria | 6378 |
| 69 | Ga0466714_091791 | 3300042603 | Bacteria | 1027 |
| 70 | Ga0466714_107622 | 3300042603 | Bacteria | 1831 |
| 71 | Ga0466714_109427 | 3300042603 | Bacteria | 1685 |
| 72 | Ga0466716_185596 | 3300042605 | Bacteria | 3119 |
| 73 | Ga0466716_492338 | 3300042605 | Bacteria | 2878 |
| 74 | Ga0466719_351290 | 3300042606 | Bacteria | 4406 |
| 75 | Ga0466722_042520 | 3300042609 | Bacteria | 9397 |
| 76 | Ga0466731_013692 | 3300042622 | Bacteria | 1275 |
| 77 | JGI24702J35022_10000975 | 3300002462 | Bacteria | 17901 |
| 78 | JGI24702J35022_10001597 | 3300002462 | Bacteria | 14014 |
| 79 | Ga0068305_10032150 | 3300005083 | Bacteria | 7165 |
| 80 | Ga0466705_324906 | 3300042612 | Bacteria | 3401 |
| 81 | Ga0466733_184402 | 3300042659 | Bacteria | 35234 |
| 82 | Ga0466690_060403 | 3300042590 | Bacteria | 3881 |
| 83 | Ga0466715_268476 | 3300042616 | Bacteria | 54264 |
| 84 | Ga0466728_216769 | 3300042620 | Bacteria | 9121 |
| 85 | Ga0466706_121657 | 3300042599 | Bacteria | 7251 |
| 86 | Ga0466706_238184 | 3300042599 | Bacteria | 6878 |
| 87 | Ga0466707_417431 | 3300042601 | Bacteria | 2478 |
| 88 | Ga0466713_109231 | 3300042602 | Bacteria | 188899 |
| 89 | Ga0466719_418616 | 3300042606 | Bacteria | 1811 |
| 90 | Ga0466722_046870 | 3300042609 | Bacteria | 4963 |
| 91 | Ga0466730_012265 | 3300042625 | Bacteria | 13761 |
| 92 | Ga0466703_062082 | 3300042636 | Bacteria | 16507 |
| 93 | Ga0466725_027587 | 3300042654 | Bacteria | 14911 |
| 94 | Ga0466705_068396 | 3300042612 | Bacteria | 4157 |
| 95 | Ga0466733_095151 | 3300042659 | Bacteria | 7392 |
| 96 | Ga0466656_221825 | 3300042550 | Bacteria | 7605 |
| 97 | Ga0466690_042411 | 3300042590 | Bacteria | 13618 |
| 98 | Ga0466690_433649 | 3300042590 | Bacteria | 5754 |
| 99 | Ga0466715_100197 | 3300042616 | Bacteria | 60516 |
| 100 | Ga0466729_115252 | 3300042621 | Bacteria | 12884 |
| 101 | Ga0466706_043135 | 3300042599 | Bacteria | 7173 |
| 102 | Ga0466706_131785 | 3300042599 | Bacteria | 9596 |
| 103 | Ga0466706_144992 | 3300042599 | Bacteria | 2774 |
| 104 | Ga0466706_192668 | 3300042599 | Bacteria | 87404 |
| 105 | Ga0466707_153234 | 3300042601 | Bacteria | 4443 |
| 106 | Ga0466707_385305 | 3300042601 | Bacteria | 6191 |
| 107 | Ga0466713_115244 | 3300042602 | Bacteria | 27943 |
| 108 | Ga0466714_022542 | 3300042603 | Bacteria | 5094 |
| 109 | Ga0466735_013034 | 3300042624 | Bacteria | 2940 |
| 110 | Ga0466704_029025 | 3300042643 | Bacteria | 1755 |
| 111 | Ga0466704_111454 | 3300042643 | Unclassified | 6434 |
| 112 | Ga0466704_252223 | 3300042643 | Bacteria | 2243 |
| 113 | Ga0466708_202391 | 3300042652 | Bacteria | 24700 |
| 114 | JGI24705J35276_12238724 | 3300002504 | Bacteria | 45437 |
| 115 | Ga0068305_10022576 | 3300005083 | Bacteria | 24603 |
| 116 | Ga0068305_10032151 | 3300005083 | Unclassified | 7493 |
| 117 | Ga0466733_086393 | 3300042659 | Bacteria | 29643 |
| 118 | Ga0466690_228091 | 3300042590 | Bacteria | 31086 |
| 119 | Ga0466715_444198 | 3300042616 | Bacteria | 4382 |
| 120 | Ga0466713_001813 | 3300042602 | Bacteria | 32083 |
| 121 | Ga0466713_051288 | 3300042602 | Bacteria | 230715 |
| 122 | Ga0466716_409460 | 3300042605 | Bacteria | 2015 |
| 123 | Ga0123355_10146193 | 3300009826 | Bacteria | 3604 |
| 124 | Ga0466704_301673 | 3300042643 | Bacteria | 8735 |
| 125 | Ga0072940_1007596 | 3300005200 | Bacteria | 4521 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042605 | Ga0466716_409460 | Ga0466716_409460_1009_1932 | 307 |
| 2 | 3300042603 | Ga0466714_091791 | Ga0466714_091791_25_954 | 309 |
| 3 | 3300042622 | Ga0466731_013692 | Ga0466731_013692_17_985 | 322 |
| 4 | 3300042609 | Ga0466722_035106 | Ga0466722_035106_22072_23064 | 330 |
| 5 | 3300042652 | Ga0466708_398349 | Ga0466708_398349_43_1092 | 349 |
| 6 | 3300042619 | Ga0466726_370027 | Ga0466726_370027_5234_6304 | 351 |
| 7 | 3300042599 | Ga0466706_238184 | Ga0466706_238184_1867_3000 | 352 |
| 8 | 3300042602 | Ga0466713_045605 | Ga0466713_045605_2836_3969 | 355 |
| 9 | 3300042643 | Ga0466704_089691 | Ga0466704_089691_305_1435 | 359 |
| 10 | iso_pr_bacteria | 2609459943 | 2610742093 | 360 |
| 11 | 3300042648 | Ga0466709_210619 | Ga0466709_210619_1251_2339 | 362 |
| 12 | 3300042654 | Ga0466725_381675 | Ga0466725_381675_1287_2423 | 365 |
| 13 | 3300042659 | Ga0466733_086393 | Ga0466733_086393_28423_29547 | 366 |
| 14 | 3300002462 | JGI24702J35022_10001597 | JGI24702J35022_100015975 | 367 |
| 15 | 3300005083 | Ga0068305_10032151 | Ga0068305_100321518 | 367 |
| 16 | 3300042591 | Ga0466692_180216 | Ga0466692_180216_19409_20542 | 367 |
| 17 | 3300042602 | Ga0466713_124910 | Ga0466713_124910_2541_3644 | 367 |
| 18 | 3300042599 | Ga0466706_121657 | Ga0466706_121657_4736_5842 | 368 |
| 19 | 3300042655 | Ga0466727_164377 | Ga0466727_164377_1850_2956 | 368 |
| 20 | 3300042603 | Ga0466714_026440 | Ga0466714_026440_10582_11718 | 370 |
| 21 | 3300042648 | Ga0466709_297787 | Ga0466709_297787_25916_27061 | 371 |
| 22 | 3300005083 | Ga0068305_10032150 | Ga0068305_100321507 | 373 |
| 23 | 3300009826 | Ga0123355_10146193 | Ga0123355_101461932 | 373 |
| 24 | 3300010049 | Ga0123356_10038495 | Ga0123356_100384952 | 373 |
| 25 | 3300042602 | Ga0466713_115244 | Ga0466713_115244_24861_25985 | 374 |
| 26 | 3300042609 | Ga0466722_244504 | Ga0466722_244504_4875_5999 | 374 |
| 27 | 3300042616 | Ga0466715_442198 | Ga0466715_442198_1092_2246 | 374 |
| 28 | 3300042624 | Ga0466735_013034 | Ga0466735_013034_177_1301 | 374 |
| 29 | 3300042550 | Ga0466656_221825 | Ga0466656_221825_518_1645 | 375 |
| 30 | 3300042601 | Ga0466707_098491 | Ga0466707_098491_491_1618 | 375 |
| 31 | 3300042605 | Ga0466716_492338 | Ga0466716_492338_372_1499 | 375 |
| 32 | 3300042616 | Ga0466715_444198 | Ga0466715_444198_2390_3517 | 375 |
| 33 | 3300042618 | Ga0466723_138452 | Ga0466723_138452_9149_10276 | 375 |
| 34 | 3300042621 | Ga0466729_287263 | Ga0466729_287263_4776_5903 | 375 |
| 35 | 3300042624 | Ga0466735_067061 | Ga0466735_067061_299_1426 | 375 |
| 36 | 3300042624 | Ga0466735_203667 | Ga0466735_203667_335_1462 | 375 |
| 37 | 3300042636 | Ga0466703_062082 | Ga0466703_062082_13241_14368 | 375 |
| 38 | 3300042643 | Ga0466704_152719 | Ga0466704_152719_245_1372 | 375 |
| 39 | 3300042652 | Ga0466708_119059 | Ga0466708_119059_5986_7113 | 375 |
| 40 | iso_pr_bacteria | 2923982719 | 2923984414 | 375 |
| 41 | iso_pr_bacteria | 2940195863 | 2940199036 | 375 |
| 42 | iso_pr_bacteria | 2940346213 | 2940347073 | 375 |
| 43 | iso_pr_bacteria | 2940371297 | 2940373788 | 375 |
| 44 | 3300002462 | JGI24702J35022_10000975 | JGI24702J35022_1000097517 | 376 |
| 45 | 3300002504 | JGI24705J35276_12238724 | JGI24705J35276_122387246 | 376 |
| 46 | 3300005200 | Ga0072940_1007596 | Ga0072940_10075961 | 376 |
| 47 | 3300042590 | Ga0466690_060403 | Ga0466690_060403_2386_3516 | 376 |
| 48 | 3300042590 | Ga0466690_321779 | Ga0466690_321779_6425_7555 | 376 |
| 49 | 3300042599 | Ga0466706_094083 | Ga0466706_094083_4992_6122 | 376 |
| 50 | 3300042599 | Ga0466706_131785 | Ga0466706_131785_540_1670 | 376 |
| 51 | 3300042601 | Ga0466707_417431 | Ga0466707_417431_142_1272 | 376 |
| 52 | 3300042609 | Ga0466722_042520 | Ga0466722_042520_1856_2986 | 376 |
| 53 | 3300042612 | Ga0466705_037118 | Ga0466705_037118_3781_4911 | 376 |
| 54 | 3300042612 | Ga0466705_068396 | Ga0466705_068396_2744_3874 | 376 |
| 55 | 3300042615 | Ga0466711_339108 | Ga0466711_339108_15673_16803 | 376 |
| 56 | 3300042616 | Ga0466715_074087 | Ga0466715_074087_26330_27460 | 376 |
| 57 | 3300042620 | Ga0466728_216769 | Ga0466728_216769_6359_7489 | 376 |
| 58 | 3300042643 | Ga0466704_029025 | Ga0466704_029025_432_1562 | 376 |
| 59 | 3300042643 | Ga0466704_041785 | Ga0466704_041785_45_1175 | 376 |
| 60 | 3300042643 | Ga0466704_111454 | Ga0466704_111454_1854_2984 | 376 |
| 61 | 3300042643 | Ga0466704_377176 | Ga0466704_377176_4970_6100 | 376 |
| 62 | 3300042654 | Ga0466725_027587 | Ga0466725_027587_13613_14743 | 376 |
| 63 | iso_pr_bacteria | 2830041218 | 2830044215 | 376 |
| 64 | iso_pr_bacteria | 3004672520 | 3004673236 | 376 |
| 65 | 3300042590 | Ga0466690_433649 | Ga0466690_433649_1104_2237 | 377 |
| 66 | 3300042593 | Ga0466691_020441 | Ga0466691_020441_2863_3996 | 377 |
| 67 | 3300042596 | Ga0466696_025881 | Ga0466696_025881_2108_3241 | 377 |
| 68 | 3300042596 | Ga0466696_133430 | Ga0466696_133430_4291_5424 | 377 |
| 69 | 3300042603 | Ga0466714_107622 | Ga0466714_107622_663_1796 | 377 |
| 70 | 3300042605 | Ga0466716_185596 | Ga0466716_185596_765_1898 | 377 |
| 71 | 3300042606 | Ga0466719_351290 | Ga0466719_351290_1148_2281 | 377 |
| 72 | 3300042619 | Ga0466726_145902 | Ga0466726_145902_2052_3185 | 377 |
| 73 | 3300042636 | Ga0466703_241934 | Ga0466703_241934_674_1807 | 377 |
| 74 | 3300042643 | Ga0466704_301673 | Ga0466704_301673_899_2032 | 377 |
| 75 | 3300042655 | Ga0466727_101685 | Ga0466727_101685_14431_15564 | 377 |
| 76 | iso_pr_bacteria | 3004667792 | 3004670584 | 377 |
| 77 | 3300005083 | Ga0068305_10079689 | Ga0068305_100796892 | 378 |
| 78 | 3300042599 | Ga0466706_144992 | Ga0466706_144992_202_1338 | 378 |
| 79 | 3300042599 | Ga0466706_276402 | Ga0466706_276402_6090_7226 | 378 |
| 80 | 3300042612 | Ga0466705_324906 | Ga0466705_324906_355_1491 | 378 |
| 81 | 3300042616 | Ga0466715_100197 | Ga0466715_100197_33628_34764 | 378 |
| 82 | 3300042616 | Ga0466715_268476 | Ga0466715_268476_16379_17515 | 378 |
| 83 | 3300042643 | Ga0466704_080074 | Ga0466704_080074_16596_17732 | 378 |
| 84 | 3300042652 | Ga0466708_202391 | Ga0466708_202391_7866_9002 | 378 |
| 85 | 3300042659 | Ga0466733_048400 | Ga0466733_048400_3028_4164 | 378 |
| 86 | iso_pr_bacteria | 2940205530 | 2940207881 | 378 |
| 87 | iso_pr_bacteria | 2940212447 | 2940214796 | 378 |
| 88 | iso_pr_bacteria | 2940298504 | 2940300850 | 378 |
| 89 | iso_pr_bacteria | 2940302308 | 2940304652 | 378 |
| 90 | iso_pr_bacteria | 2940306115 | 2940308341 | 378 |
| 91 | iso_pr_bacteria | 2940309933 | 2940312181 | 378 |
| 92 | iso_pr_bacteria | 2940313741 | 2940315865 | 378 |
| 93 | iso_pr_bacteria | 2940317558 | 2940319809 | 378 |
| 94 | iso_pr_bacteria | 2940321370 | 2940323286 | 378 |
| 95 | iso_pr_bacteria | 2940325180 | 2940327649 | 378 |
| 96 | iso_pr_bacteria | 2940328985 | 2940331454 | 378 |
| 97 | iso_pr_bacteria | 2940332795 | 2940334917 | 378 |
| 98 | iso_pr_bacteria | 3004672520 | 3004673306 | 378 |
| 99 | 3300042590 | Ga0466690_228091 | Ga0466690_228091_18443_19582 | 379 |
| 100 | 3300042591 | Ga0466692_063390 | Ga0466692_063390_72679_73818 | 379 |
| 101 | 3300042593 | Ga0466691_073635 | Ga0466691_073635_124_1263 | 379 |
| 102 | 3300042599 | Ga0466706_192668 | Ga0466706_192668_43820_44959 | 379 |
| 103 | 3300042601 | Ga0466707_269407 | Ga0466707_269407_6605_7744 | 379 |
| 104 | 3300042602 | Ga0466713_051288 | Ga0466713_051288_155599_156738 | 379 |
| 105 | 3300042603 | Ga0466714_022542 | Ga0466714_022542_940_2079 | 379 |
| 106 | 3300042612 | Ga0466705_381838 | Ga0466705_381838_445_1584 | 379 |
| 107 | 3300042616 | Ga0466715_052779 | Ga0466715_052779_6774_7913 | 379 |
| 108 | iso_pr_bacteria | 2609459943 | 2610743921 | 379 |
| 109 | iso_pr_bacteria | 2695420314 | 2695470710 | 379 |
| 110 | iso_pr_bacteria | 2830041218 | 2830042034 | 379 |
| 111 | iso_pr_bacteria | 2910959314 | 2910959968 | 379 |
| 112 | iso_pr_bacteria | 3004672520 | 3004676539 | 379 |
| 113 | 3300005083 | Ga0068305_10022576 | Ga0068305_1002257612 | 380 |
| 114 | 3300042590 | Ga0466690_042411 | Ga0466690_042411_10402_11544 | 380 |
| 115 | 3300042599 | Ga0466706_024533 | Ga0466706_024533_9578_10720 | 380 |
| 116 | 3300042601 | Ga0466707_153234 | Ga0466707_153234_2200_3342 | 380 |
| 117 | 3300042602 | Ga0466713_109231 | Ga0466713_109231_156154_157296 | 380 |
| 118 | 3300042602 | Ga0466713_116260 | Ga0466713_116260_11015_12157 | 380 |
| 119 | 3300042606 | Ga0466719_418616 | Ga0466719_418616_233_1438 | 380 |
| 120 | 3300042612 | Ga0466705_105572 | Ga0466705_105572_3020_4162 | 380 |
| 121 | 3300042612 | Ga0466705_112417 | Ga0466705_112417_16426_17568 | 380 |
| 122 | 3300042615 | Ga0466711_044318 | Ga0466711_044318_16091_17233 | 380 |
| 123 | 3300042616 | Ga0466715_499819 | Ga0466715_499819_3669_4811 | 380 |
| 124 | 3300042625 | Ga0466730_094575 | Ga0466730_094575_223_1365 | 380 |
| 125 | 3300042643 | Ga0466704_180284 | Ga0466704_180284_1468_2610 | 380 |
| 126 | 3300042643 | Ga0466704_252223 | Ga0466704_252223_969_2111 | 380 |
| 127 | 3300042648 | Ga0466709_144300 | Ga0466709_144300_31012_32154 | 380 |
| 128 | 3300042659 | Ga0466733_095151 | Ga0466733_095151_2869_4011 | 380 |
| 129 | 3300042659 | Ga0466733_184402 | Ga0466733_184402_12521_13663 | 380 |
| 130 | iso_pr_bacteria | 2910930387 | 2910931288 | 380 |
| 131 | iso_pr_bacteria | 2910942425 | 2910945499 | 380 |
| 132 | iso_pr_bacteria | 2940244548 | 2940245414 | 380 |
| 133 | iso_pr_bacteria | 2940248789 | 2940249654 | 380 |
| 134 | iso_pr_bacteria | 2940253009 | 2940253764 | 380 |
| 135 | iso_pr_bacteria | 2940257232 | 2940257619 | 380 |
| 136 | iso_pr_bacteria | 3004677695 | 3004678573 | 380 |
| 137 | iso_pr_bacteria | 8100166142 | 8100166478 | 380 |
| 138 | 3300042599 | Ga0466706_043135 | Ga0466706_043135_5336_6481 | 381 |
| 139 | 3300042603 | Ga0466714_021942 | Ga0466714_021942_3667_4812 | 381 |
| 140 | 3300042619 | Ga0466726_116950 | Ga0466726_116950_1796_2941 | 381 |
| 141 | 3300042621 | Ga0466729_115252 | Ga0466729_115252_10700_11845 | 381 |
| 142 | 3300042659 | Ga0466733_165496 | Ga0466733_165496_90225_91370 | 381 |
| 143 | 3300005071 | Ga0068302_10074303 | Ga0068302_100743037 | 382 |
| 144 | 3300042599 | Ga0466706_264295 | Ga0466706_264295_8518_9666 | 382 |
| 145 | 3300042603 | Ga0466714_109427 | Ga0466714_109427_524_1672 | 382 |
| 146 | 3300042615 | Ga0466711_033361 | Ga0466711_033361_7018_8166 | 382 |
| 147 | 3300042620 | Ga0466728_019784 | Ga0466728_019784_11454_12602 | 382 |
| 148 | 3300042602 | Ga0466713_001813 | Ga0466713_001813_23656_24852 | 383 |
| 149 | 3300042609 | Ga0466722_046870 | Ga0466722_046870_748_1899 | 383 |
| 150 | 3300010167 | Ga0123353_10000423 | Ga0123353_100004232 | 384 |
| 151 | 3300042609 | Ga0466722_036176 | Ga0466722_036176_1612_2766 | 384 |
| 152 | 3300042625 | Ga0466730_012265 | Ga0466730_012265_231_1385 | 384 |
| 153 | 3300042636 | Ga0466703_078085 | Ga0466703_078085_1335_2489 | 384 |
| 154 | 3300042598 | Ga0466701_009529 | Ga0466701_009529_168087_169244 | 385 |
| 155 | iso_pr_bacteria | 2687453786 | 2690171716 | 385 |
| 156 | 3300042615 | Ga0466711_132062 | Ga0466711_132062_16492_17670 | 392 |
| 157 | 3300042655 | Ga0466727_314491 | Ga0466727_314491_3867_5051 | 394 |
| 158 | 3300042603 | Ga0466714_065611 | Ga0466714_065611_405_1598 | 397 |
| 159 | 3300042615 | Ga0466711_117224 | Ga0466711_117224_4877_6082 | 401 |
| 160 | 3300042601 | Ga0466707_385305 | Ga0466707_385305_277_1485 | 402 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01263 | Aldose_epim | Aldose 1-epimerase | 71 | 397 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.87 | 0.93 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.