Protein Family IF05976

Metagenome
117 Members
36 Samples
117 Scaffolds
314.96 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_358929|Ga0466707_358929_8624_10198
Length
363 aa
Sequence
MAKLYYAEDCDKSVLKGKTIAIIGYGSQGHAHALNLRDSGYDVIVGLYEGSKSAEAARADGFKVVTSAEAVKAADVVTILINDEKQPELYRKSVEANLRPGTTLAFAHGFNIHYGQIVPPADVDVIMIAPKGPGHTVRSQFEEGKGVPDLIAVYQNASGKAKETALAYADGIGGSRAGILETTFKEETETDLFGEQAVLCGPESAYFECVHELKLIIDLVVSQGLSFMRSSISDTAEYGDYTAGPRIITADTKKEMKKILAEIQDGTFARNWIVENQANRPSFTALRRLQSEHLINSVGDELRSKMSWKKPEPKAIPAAEPILQLPAVVEIDVPEVTRGKGKAEVIPEAPVVKQKRKYTRKAK

📊 Sample Types

Isolate 0.0%
Metagenome 100.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 36.1%
Termitidae 30.6%
Rhinotermitidae 8.3%
Unclassified 8.3%
Termopsidae 8.3%
Passalidae 5.6%
Hodotermitidae 2.8%

🌳 Taxonomy

Archaea 0
Bacteria 108
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
8 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
11 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
12 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
13 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
14 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
15 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
16 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
17 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
18 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
19 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
20 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
23 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
24 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
25 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
26 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
27 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
32 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
33 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_131209 3300042611 Bacteria 2809
2 Ga0466705_281951 3300042612 Bacteria 1292
3 Ga0466706_269567 3300042599 Bacteria 2712
4 Ga0466700_103649 3300042600 Bacteria 1480
5 Ga0466707_358929 3300042601 Bacteria 32027
6 Ga0466713_103316 3300042602 Bacteria 5890
7 Ga0466719_029393 3300042606 Bacteria 1464
8 Ga0466719_110237 3300042606 Bacteria 1538
9 Ga0123353_10516263 3300010167 Bacteria 1735
10 Ga0068305_10226261 3300005083 Bacteria 2047
11 Ga0466711_179136 3300042615 Bacteria 3176
12 Ga0466729_315976 3300042621 Bacteria 3525
13 Ga0466703_024134 3300042636 Bacteria 16317
14 Ga0466705_011264 3300042612 Bacteria 3393
15 Ga0466696_447376 3300042596 Unclassified 3913
16 Ga0466706_156906 3300042599 Bacteria 4906
17 Ga0466707_289101 3300042601 Bacteria 3334
18 Ga0466713_077576 3300042602 Bacteria 38989
19 Ga0466716_388194 3300042605 Bacteria 7134
20 Ga0466719_250975 3300042606 Bacteria 7364
21 Ga0466698_484489 3300042610 Bacteria 2951
22 Ga0123356_10051384 3300010049 Bacteria 3834
23 Ga0123356_10151618 3300010049 Bacteria 2302
24 Ga0123353_10025720 3300010167 Bacteria 8976
25 Ga0123354_10200607 3300010882 Bacteria 2195
26 2227511882 2225789004 Unclassified 3535
27 Ga0466715_173929 3300042616 Bacteria 11123
28 Ga0466723_245637 3300042618 Bacteria 12612
29 Ga0466729_272174 3300042621 Bacteria 94053
30 Ga0466704_204690 3300042643 Bacteria 17712
31 Ga0466705_255873 3300042612 Bacteria 7464
32 Ga0466692_174039 3300042591 Bacteria 10129
33 Ga0466696_446560 3300042596 Bacteria 3891
34 Ga0466700_088074 3300042600 Bacteria 2849
35 Ga0466707_179781 3300042601 Bacteria 2901
36 Ga0466719_287857 3300042606 Bacteria 1500
37 Ga0466719_374081 3300042606 Bacteria 4641
38 Ga0123356_10392342 3300010049 Bacteria 1523
39 Ga0466723_074392 3300042618 Bacteria 2423
40 Ga0466728_458103 3300042620 Bacteria 12811
41 Ga0466703_397079 3300042636 Unclassified 2063
42 Ga0466703_397603 3300042636 Bacteria 8031
43 Ga0466705_118691 3300042612 Bacteria 52756
44 Ga0466707_411028 3300042601 Bacteria 21137
45 Ga0466719_204996 3300042606 Bacteria 8091
46 Ga0123354_10006907 3300010882 Bacteria 16951
47 2227466310 2225789004 Bacteria 24399
48 IMNBL1DRAFT_c0000002 3300000062 Bacteria 288751
49 Ga0068302_10009657 3300005071 Bacteria 15376
50 Ga0068302_10051946 3300005071 Unclassified 1418
51 Ga0466726_034837 3300042619 Bacteria 2120
52 Ga0466726_286493 3300042619 Bacteria 10263
53 Ga0466704_067580 3300042643 Bacteria 45946
54 Ga0466708_122933 3300042652 Bacteria 25379
55 Ga0466708_252856 3300042652 Bacteria 26099
56 Ga0466708_445985 3300042652 Bacteria 17770
57 Ga0466727_035596 3300042655 Bacteria 2019
58 Ga0466733_076193 3300042659 Bacteria 4567
59 Ga0466692_085028 3300042591 Bacteria 16287
60 Ga0466692_127369 3300042591 Bacteria 13782
61 Ga0466706_215409 3300042599 Bacteria 21880
62 Ga0466706_273183 3300042599 Bacteria 1626
63 Ga0466719_267563 3300042606 Bacteria 1205
64 Ga0123357_10090479 3300009784 Bacteria 3991
65 Ga0123355_10120989 3300009826 Bacteria 4061
66 Ga0123355_10286795 3300009826 Bacteria 2265
67 Ga0123353_10030887 3300010167 Bacteria 8287
68 2227291912 2225789004 Bacteria 6686
69 2227422488 2225789004 Bacteria 5610
70 IMNBL1DRAFT_c0002983 3300000062 Unclassified 11231
71 Ga0466715_001194 3300042616 Bacteria 2264
72 Ga0466715_520933 3300042616 Bacteria 7099
73 Ga0466726_480234 3300042619 Bacteria 8777
74 Ga0466703_048712 3300042636 Bacteria 1445
75 Ga0466703_168837 3300042636 Bacteria 1249
76 Ga0466709_198661 3300042648 Bacteria 5821
77 Ga0466706_010193 3300042599 Bacteria 22334
78 Ga0466706_083303 3300042599 Bacteria 1588
79 Ga0466707_137994 3300042601 Bacteria 19785
80 Ga0466707_367017 3300042601 Bacteria 14742
81 Ga0466713_142722 3300042602 Bacteria 22184
82 Ga0466722_042792 3300042609 Bacteria 8014
83 Ga0123356_10011801 3300010049 Bacteria 8503
84 Ga0123353_10061297 3300010167 Bacteria 6033
85 2227599624 2225789004 Bacteria 12560
86 Ga0466705_400958 3300042612 Unclassified 2074
87 Ga0466705_451605 3300042612 Bacteria 19411
88 Ga0466715_634618 3300042616 Bacteria 11511
89 Ga0466729_246891 3300042621 Bacteria 5195
90 Ga0466704_144061 3300042643 Bacteria 4285
91 Ga0466727_103846 3300042655 Bacteria 1817
92 Ga0466697_165516 3300042611 Bacteria 6085
93 Ga0466733_163750 3300042659 Bacteria 2559
94 Ga0466691_193887 3300042593 Bacteria 8713
95 Ga0466706_144722 3300042599 Bacteria 12198
96 Ga0466707_094949 3300042601 Bacteria 2070
97 Ga0466714_057768 3300042603 Bacteria 2995
98 Ga0123356_10009927 3300010049 Bacteria 9374
99 Ga0123353_10110443 3300010167 Bacteria 4430
100 Ga0123353_10164264 3300010167 Bacteria 3531
101 Ga0123353_10223692 3300010167 Bacteria 2940
102 IMNBL1DRAFT_c0024741 3300000062 Bacteria 2318
103 IMNBL1DRAFT_c0056308 3300000062 Bacteria 1206
104 JGI24695J34938_10049023 3300002450 Unclassified 1858
105 Ga0123357_10000292 3300009784 Bacteria 47972
106 Ga0466726_123576 3300042619 Bacteria 11277
107 Ga0466728_348745 3300042620 Bacteria 2959
108 Ga0466727_086812 3300042655 Unclassified 13897
109 Ga0466691_003265 3300042593 Bacteria 6210
110 Ga0466706_115059 3300042599 Bacteria 12640
111 Ga0123355_10087807 3300009826 Bacteria 4941
112 IMNBL1DRAFT_c0000006 3300000062 Bacteria 247403
113 JGI24695J34938_10007735 3300002450 Bacteria 6230
114 Ga0466728_052078 3300042620 Unclassified 8128
115 Ga0466728_145504 3300042620 Bacteria 8085
116 Ga0466708_290335 3300042652 Bacteria 28444
117 Ga0466708_407221 3300042652 Bacteria 24446

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10223692 Ga0123353_102236922 291
2 3300005083 Ga0068305_10226261 Ga0068305_102262613 294
3 3300042611 Ga0466697_165516 Ga0466697_165516_3798_4793 297
4 3300042616 Ga0466715_001194 Ga0466715_001194_390_1343 298
5 3300005071 Ga0068302_10051946 Ga0068302_100519461 306
6 2225789004 2227422488 2227863442 310
7 3300009784 Ga0123357_10090479 Ga0123357_100904792 310
8 3300042601 Ga0466707_367017 Ga0466707_367017_298_1287 310
9 3300042606 Ga0466719_029393 Ga0466719_029393_375_1364 310
10 3300042606 Ga0466719_250975 Ga0466719_250975_1129_2118 310
11 3300042606 Ga0466719_267563 Ga0466719_267563_141_1130 310
12 3300042606 Ga0466719_287857 Ga0466719_287857_19_1008 310
13 3300042606 Ga0466719_374081 Ga0466719_374081_2507_3496 310
14 3300042612 Ga0466705_255873 Ga0466705_255873_1693_2682 310
15 3300042612 Ga0466705_281951 Ga0466705_281951_167_1156 310
16 3300042612 Ga0466705_400958 Ga0466705_400958_156_1145 310
17 3300042612 Ga0466705_451605 Ga0466705_451605_6898_7887 310
18 3300042620 Ga0466728_052078 Ga0466728_052078_6264_7253 310
19 3300042621 Ga0466729_272174 Ga0466729_272174_35970_36959 310
20 3300042636 Ga0466703_048712 Ga0466703_048712_351_1340 310
21 3300042636 Ga0466703_168837 Ga0466703_168837_33_1022 310
22 3300042636 Ga0466703_397079 Ga0466703_397079_999_1988 310
23 3300042643 Ga0466704_067580 Ga0466704_067580_21461_22450 310
24 3300042643 Ga0466704_204690 Ga0466704_204690_13596_14585 310
25 3300042652 Ga0466708_407221 Ga0466708_407221_16044_17033 310
26 2225789004 2227599624 2228164507 311
27 3300002450 JGI24695J34938_10007735 JGI24695J34938_100077359 311
28 3300002450 JGI24695J34938_10049023 JGI24695J34938_100490232 311
29 3300042591 Ga0466692_085028 Ga0466692_085028_11553_12545 311
30 3300042591 Ga0466692_127369 Ga0466692_127369_6906_7898 311
31 3300042591 Ga0466692_174039 Ga0466692_174039_210_1202 311
32 3300042599 Ga0466706_083303 Ga0466706_083303_175_1167 311
33 3300042599 Ga0466706_269567 Ga0466706_269567_1306_2298 311
34 3300042599 Ga0466706_273183 Ga0466706_273183_56_1048 311
35 3300042600 Ga0466700_088074 Ga0466700_088074_647_1639 311
36 3300042602 Ga0466713_077576 Ga0466713_077576_20231_21223 311
37 3300042602 Ga0466713_103316 Ga0466713_103316_1877_2869 311
38 3300042612 Ga0466705_011264 Ga0466705_011264_341_1333 311
39 3300042616 Ga0466715_520933 Ga0466715_520933_1791_2783 311
40 3300042619 Ga0466726_123576 Ga0466726_123576_3824_4816 311
41 3300042621 Ga0466729_246891 Ga0466729_246891_3496_4488 311
42 3300042621 Ga0466729_315976 Ga0466729_315976_1810_2802 311
43 3300042636 Ga0466703_024134 Ga0466703_024134_11341_12333 311
44 3300042636 Ga0466703_397603 Ga0466703_397603_212_1204 311
45 3300042643 Ga0466704_144061 Ga0466704_144061_2550_3542 311
46 3300042655 Ga0466727_086812 Ga0466727_086812_285_1277 311
47 3300042655 Ga0466727_103846 Ga0466727_103846_65_1057 311
48 3300005071 Ga0068302_10009657 Ga0068302_100096575 312
49 3300009826 Ga0123355_10286795 Ga0123355_102867953 312
50 3300010882 Ga0123354_10006907 Ga0123354_1000690710 312
51 3300042593 Ga0466691_003265 Ga0466691_003265_1778_2773 312
52 3300042593 Ga0466691_193887 Ga0466691_193887_3276_4271 312
53 3300042596 Ga0466696_446560 Ga0466696_446560_1917_2912 312
54 3300042596 Ga0466696_447376 Ga0466696_447376_1983_2978 312
55 3300042599 Ga0466706_144722 Ga0466706_144722_2093_3085 312
56 3300042600 Ga0466700_103649 Ga0466700_103649_143_1138 312
57 3300042601 Ga0466707_179781 Ga0466707_179781_472_1464 312
58 3300042605 Ga0466716_388194 Ga0466716_388194_3510_4505 312
59 3300042606 Ga0466719_110237 Ga0466719_110237_493_1488 312
60 3300042606 Ga0466719_204996 Ga0466719_204996_515_1510 312
61 3300042611 Ga0466697_131209 Ga0466697_131209_372_1367 312
62 3300042615 Ga0466711_179136 Ga0466711_179136_1474_2469 312
63 3300042616 Ga0466715_173929 Ga0466715_173929_1404_2399 312
64 3300042616 Ga0466715_634618 Ga0466715_634618_246_1241 312
65 3300042618 Ga0466723_074392 Ga0466723_074392_1120_2115 312
66 3300042618 Ga0466723_245637 Ga0466723_245637_5621_6616 312
67 3300042620 Ga0466728_348745 Ga0466728_348745_985_1980 312
68 3300042620 Ga0466728_458103 Ga0466728_458103_6087_7082 312
69 3300042652 Ga0466708_122933 Ga0466708_122933_10502_11497 312
70 3300042652 Ga0466708_290335 Ga0466708_290335_6998_7993 312
71 3300042659 Ga0466733_076193 Ga0466733_076193_1771_2766 312
72 3300042659 Ga0466733_163750 Ga0466733_163750_853_1848 312
73 3300009826 Ga0123355_10087807 Ga0123355_100878073 313
74 3300009826 Ga0123355_10120989 Ga0123355_101209893 313
75 3300010049 Ga0123356_10011801 Ga0123356_100118012 313
76 3300042599 Ga0466706_115059 Ga0466706_115059_10336_11334 313
77 3300042601 Ga0466707_094949 Ga0466707_094949_694_1692 313
78 3300042601 Ga0466707_137994 Ga0466707_137994_1559_2557 313
79 3300042619 Ga0466726_286493 Ga0466726_286493_8835_9833 313
80 3300010049 Ga0123356_10009927 Ga0123356_100099277 314
81 3300010167 Ga0123353_10110443 Ga0123353_101104435 314
82 3300010167 Ga0123353_10164264 Ga0123353_101642642 314
83 3300042599 Ga0466706_215409 Ga0466706_215409_11054_12055 314
84 3300042610 Ga0466698_484489 Ga0466698_484489_1916_2917 314
85 3300042619 Ga0466726_034837 Ga0466726_034837_955_1950 314
86 3300042620 Ga0466728_145504 Ga0466728_145504_6259_7260 314
87 3300042648 Ga0466709_198661 Ga0466709_198661_3605_4606 314
88 3300042599 Ga0466706_010193 Ga0466706_010193_1726_2730 315
89 3300042599 Ga0466706_156906 Ga0466706_156906_3295_4296 315
90 3300042652 Ga0466708_252856 Ga0466708_252856_21210_22205 316
91 2225789004 2227466310 2227905819 317
92 3300010049 Ga0123356_10051384 Ga0123356_100513842 317
93 3300042652 Ga0466708_445985 Ga0466708_445985_2698_3696 317
94 2225789004 2227291912 2227742723 318
95 2225789004 2227511882 2228007020 318
96 3300042603 Ga0466714_057768 Ga0466714_057768_1038_2051 318
97 3300000062 IMNBL1DRAFT_c0000002 IMNBL1DRAFT_0000002336 319
98 3300000062 IMNBL1DRAFT_c0000006 IMNBL1DRAFT_0000006148 319
99 3300000062 IMNBL1DRAFT_c0002983 IMNBL1DRAFT_00029831 319
100 3300000062 IMNBL1DRAFT_c0024741 IMNBL1DRAFT_00247413 319
101 3300000062 IMNBL1DRAFT_c0056308 IMNBL1DRAFT_00563081 319
102 3300010882 Ga0123354_10200607 Ga0123354_102006072 319
103 3300042609 Ga0466722_042792 Ga0466722_042792_3780_4793 319
104 3300010167 Ga0123353_10030887 Ga0123353_100308872 321
105 3300042655 Ga0466727_035596 Ga0466727_035596_770_1798 323
106 3300042612 Ga0466705_118691 Ga0466705_118691_31355_32389 325
107 3300042619 Ga0466726_480234 Ga0466726_480234_7527_8561 325
108 3300009784 Ga0123357_10000292 Ga0123357_1000029215 326
109 3300010167 Ga0123353_10061297 Ga0123353_100612974 326
110 3300010167 Ga0123353_10516263 Ga0123353_105162632 329
111 3300010049 Ga0123356_10392342 Ga0123356_103923422 330
112 3300042602 Ga0466713_142722 Ga0466713_142722_1594_2643 331
113 3300010049 Ga0123356_10151618 Ga0123356_101516182 334
114 3300010167 Ga0123353_10025720 Ga0123353_100257205 336
115 3300042601 Ga0466707_411028 Ga0466707_411028_1729_3246 358
116 3300042601 Ga0466707_358929 Ga0466707_358929_8624_10198 363
117 3300042601 Ga0466707_289101 Ga0466707_289101_1511_3004 408

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain 14 178 0.99
PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain 202 308 0.99
PF00670 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD binding domain 13 78 0.87
PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase 19 104 0.85
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 19 93 0.84
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 13 85 0.82

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03446 GO:0050661 NADP binding MF
PF02826 GO:0051287 NAD binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.78 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.