Protein Family IF05972

Metagenome Isolate
119 Members
41 Samples
118 Scaffolds
296.04 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_352499|Ga0466707_352499_609_1589
Length
326 aa
Sequence
MSHIANRTWKGNTGGGTLGQRLLIFFFRWWNLRLGYAIMAVVVPFYMLFARKGYLAIYHYFRQQHGFSKWKSFRKTYRNHFLFGQVILDRFAVFSGRRGDFEVEIVGNEHFQRLCNGEKGFVIVGSHVGNFEIAGYLLGQDKKRINALIFGGETATVQQNRSKVLNNNNVNLIPVSADMSHLFAANVALQNGEIVSMPADRVFGSAKSVECDFLNGKADFPVGAFALAASLEVEALAIFCIKISAKRYKIFVQLVSVCHCGLGYRAKSKYDPQSPESKGDSDFHQNDRKKQIANLAKAYVVELEKIVTQYPEQWFNFYEFWKSSEL

📊 Sample Types

Isolate 0.8%
Metagenome 99.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 34.1%
Termitidae 31.7%
Termopsidae 9.8%
Unclassified 9.8%
Rhinotermitidae 7.3%
Passalidae 4.9%
Hodotermitidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 116
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
10 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
11 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
12 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
13 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
14 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
15 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
16 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
17 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
18 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
19 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
20 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
25 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
26 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
29 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
35 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
36 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
37 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
38 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
39 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
40 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
41 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466719_217250 3300042606 Bacteria 1384
2 Ga0466690_202381 3300042590 Bacteria 5525
3 Ga0466692_205318 3300042591 Bacteria 6340
4 Ga0466696_251909 3300042596 Bacteria 7596
5 Ga0466711_338621 3300042615 Bacteria 11912
6 Ga0466735_053315 3300042624 Bacteria 11454
7 Ga0466703_384067 3300042636 Bacteria 3714
8 Ga0466704_002372 3300042643 Bacteria 57196
9 Ga0466704_094724 3300042643 Bacteria 10795
10 Ga0466704_469314 3300042643 Bacteria 1383
11 Ga0466707_103534 3300042601 Bacteria 2223
12 Ga0466722_150720 3300042609 Bacteria 8542
13 Ga0466722_234933 3300042609 Bacteria 3641
14 Ga0466693_272559 3300042592 Bacteria 1440
15 Ga0466691_058246 3300042593 Bacteria 14754
16 IMNBL1DRAFT_c0002369 3300000062 Bacteria 13182
17 Ga0466705_130431 3300042612 Bacteria 14655
18 Ga0466705_158758 3300042612 Bacteria 11045
19 Ga0466706_280280 3300042599 Bacteria 34158
20 Ga0466716_202600 3300042605 Bacteria 25648
21 Ga0466716_423070 3300042605 Bacteria 2061
22 Ga0466719_158323 3300042606 Bacteria 1449
23 Ga0123354_10011041 3300010882 Bacteria 13936
24 Ga0466711_468146 3300042615 Bacteria 29475
25 Ga0466715_440572 3300042616 Bacteria 3452
26 Ga0466728_046855 3300042620 Bacteria 21751
27 Ga0466709_315607 3300042648 Bacteria 6478
28 Ga0466708_085174 3300042652 Bacteria 23155
29 Ga0466708_347084 3300042652 Bacteria 11166
30 JGI24696J40584_12959541 3300002834 Bacteria 5263
31 Ga0068302_10317979 3300005071 Bacteria 1320
32 Ga0466701_075789 3300042598 Bacteria 4653
33 Ga0466713_092950 3300042602 Bacteria 117604
34 Ga0466690_015023 3300042590 Bacteria 27335
35 Ga0466690_147695 3300042590 Bacteria 7532
36 Ga0466690_409142 3300042590 Bacteria 5724
37 Ga0466691_191216 3300042593 Bacteria 6785
38 Ga0466691_194715 3300042593 Bacteria 2878
39 Ga0123357_10039887 3300009784 Bacteria 6393
40 Ga0466715_232040 3300042616 Bacteria 3467
41 Ga0466728_281160 3300042620 Bacteria 13069
42 Ga0466728_333383 3300042620 Bacteria 8910
43 Ga0466729_157892 3300042621 Bacteria 5818
44 Ga0466704_366088 3300042643 Unclassified 4810
45 IMNBL1DRAFT_c0004635 3300000062 Bacteria 8172
46 Ga0072940_1244072 3300005200 Bacteria 2111
47 Ga0466706_190648 3300042599 Bacteria 33307
48 Ga0466707_285997 3300042601 Bacteria 2276
49 Ga0466713_114133 3300042602 Bacteria 18530
50 Ga0466690_153086 3300042590 Bacteria 2408
51 Ga0466691_148747 3300042593 Bacteria 15449
52 Ga0123357_10426605 3300009784 Bacteria 1177
53 Ga0466726_242969 3300042619 Bacteria 2037
54 Ga0466726_263213 3300042619 Unclassified 1306
55 Ga0466726_419621 3300042619 Bacteria 4688
56 Ga0466728_138171 3300042620 Bacteria 48750
57 Ga0466704_322171 3300042643 Bacteria 8368
58 Ga0466704_322472 3300042643 Bacteria 3162
59 Ga0466704_343880 3300042643 Bacteria 4222
60 Ga0466704_565068 3300042643 Bacteria 14460
61 Ga0466708_060683 3300042652 Bacteria 49198
62 Ga0466708_455953 3300042652 Bacteria 1901
63 2227502413 2225789004 Bacteria 19081
64 JGI24705J35276_12235187 3300002504 Bacteria 6268
65 Ga0466706_196261 3300042599 Bacteria 6844
66 Ga0466707_352499 3300042601 Bacteria 5876
67 Ga0466716_030847 3300042605 Bacteria 18551
68 Ga0466716_475844 3300042605 Bacteria 2497
69 Ga0466722_007385 3300042609 Bacteria 1937
70 Ga0466722_059383 3300042609 Bacteria 11770
71 Ga0466690_045391 3300042590 Bacteria 5444
72 Ga0466690_051493 3300042590 Bacteria 11140
73 Ga0466696_024005 3300042596 Bacteria 8939
74 Ga0466715_604151 3300042616 Bacteria 27450
75 Ga0466703_311997 3300042636 Bacteria 13194
76 Ga0466704_156837 3300042643 Bacteria 12573
77 IMNBL1DRAFT_c0010407 3300000062 Bacteria 4457
78 JGI24702J35022_10011745 3300002462 Bacteria 4879
79 JGI24702J35022_10020359 3300002462 Bacteria 3602
80 Ga0466705_372726 3300042612 Bacteria 12512
81 Ga0466706_237718 3300042599 Bacteria 1235
82 Ga0466716_345506 3300042605 Bacteria 2857
83 Ga0466716_355646 3300042605 Bacteria 19620
84 Ga0466719_304807 3300042606 Bacteria 2115
85 Ga0466657_249935 3300042582 Unclassified 1677
86 Ga0466692_078297 3300042591 Bacteria 14149
87 Ga0123357_10117989 3300009784 Bacteria 3355
88 Ga0123356_10773617 3300010049 Bacteria 1131
89 Ga0466715_340747 3300042616 Bacteria 15029
90 Ga0466715_443592 3300042616 Bacteria 6540
91 Ga0466723_030880 3300042618 Bacteria 5193
92 Ga0466723_271659 3300042618 Bacteria 24829
93 Ga0466728_149086 3300042620 Bacteria 2769
94 Ga0466703_173935 3300042636 Bacteria 16868
95 Ga0466703_217268 3300042636 Bacteria 30172
96 Ga0466703_418661 3300042636 Bacteria 1739
97 Ga0466704_102498 3300042643 Bacteria 21970
98 Ga0466709_279583 3300042648 Bacteria 6500
99 Ga0466709_286457 3300042648 Bacteria 7521
100 Ga0068305_10078188 3300005083 Bacteria 1630
101 Ga0466705_264324 3300042612 Bacteria 17030
102 Ga0466733_042701 3300042659 Bacteria 7371
103 Ga0466700_193309 3300042600 Bacteria 37158
104 Ga0466713_033344 3300042602 Bacteria 37079
105 Ga0466713_110191 3300042602 Bacteria 1850
106 Ga0466714_007204 3300042603 Bacteria 3156
107 Ga0466716_340092 3300042605 Bacteria 13961
108 Ga0466719_009948 3300042606 Bacteria 7289
109 Ga0466719_449519 3300042606 Bacteria 14404
110 Ga0466711_165052 3300042615 Bacteria 2666
111 Ga0466715_342363 3300042616 Bacteria 29081
112 Ga0466723_025842 3300042618 Bacteria 14881
113 Ga0466723_233898 3300042618 Bacteria 28559
114 Ga0466728_161462 3300042620 Bacteria 1091
115 Ga0466727_067939 3300042655 Bacteria 1625
116 Ga0466727_120065 3300042655 Bacteria 6775
117 Ga0466727_139855 3300042655 Bacteria 1514
118 Ga0068305_10921901 3300005083 Bacteria 4315

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_190648 Ga0466706_190648_47_817 256
2 3300042591 Ga0466692_205318 Ga0466692_205318_67_852 261
3 3300042599 Ga0466706_196261 Ga0466706_196261_23_814 263
4 3300042618 Ga0466723_271659 Ga0466723_271659_9821_10657 268
5 3300042602 Ga0466713_033344 Ga0466713_033344_25797_26657 269
6 3300042619 Ga0466726_419621 Ga0466726_419621_1548_2447 270
7 3300042618 Ga0466723_030880 Ga0466723_030880_3364_4179 271
8 3300042659 Ga0466733_042701 Ga0466733_042701_4201_5103 273
9 3300042582 Ga0466657_249935 Ga0466657_249935_477_1373 276
10 3300042652 Ga0466708_085174 Ga0466708_085174_7296_8135 279
11 3300010882 Ga0123354_10011041 Ga0123354_100110412 280
12 3300042603 Ga0466714_007204 Ga0466714_007204_1060_1968 282
13 3300002504 JGI24705J35276_12235187 JGI24705J35276_122351874 283
14 3300042590 Ga0466690_147695 Ga0466690_147695_1944_2795 283
15 3300042598 Ga0466701_075789 Ga0466701_075789_503_1354 283
16 3300042593 Ga0466691_194715 Ga0466691_194715_1634_2536 284
17 3300042615 Ga0466711_338621 Ga0466711_338621_9073_9969 284
18 3300042606 Ga0466719_217250 Ga0466719_217250_204_1118 285
19 3300009784 Ga0123357_10426605 Ga0123357_104266052 286
20 3300042590 Ga0466690_202381 Ga0466690_202381_1735_2661 286
21 3300010049 Ga0123356_10773617 Ga0123356_107736172 287
22 3300042601 Ga0466707_103534 Ga0466707_103534_361_1239 292
23 3300042605 Ga0466716_355646 Ga0466716_355646_11028_11924 292
24 3300042606 Ga0466719_158323 Ga0466719_158323_536_1420 294
25 3300042655 Ga0466727_067939 Ga0466727_067939_97_981 294
26 3300002462 JGI24702J35022_10020359 JGI24702J35022_100203592 296
27 3300042602 Ga0466713_114133 Ga0466713_114133_5473_6363 296
28 3300042605 Ga0466716_340092 Ga0466716_340092_5178_6068 296
29 3300042606 Ga0466719_449519 Ga0466719_449519_4889_5803 296
30 3300042620 Ga0466728_046855 Ga0466728_046855_5611_6528 296
31 3300042621 Ga0466729_157892 Ga0466729_157892_1544_2434 296
32 3300042636 Ga0466703_311997 Ga0466703_311997_7765_8655 296
33 3300042643 Ga0466704_156837 Ga0466704_156837_3834_4724 296
34 3300042643 Ga0466704_322171 Ga0466704_322171_1552_2442 296
35 3300042655 Ga0466727_139855 Ga0466727_139855_32_922 296
36 3300005071 Ga0068302_10317979 Ga0068302_103179791 297
37 3300005083 Ga0068305_10078188 Ga0068305_100781883 297
38 3300042592 Ga0466693_272559 Ga0466693_272559_178_1071 297
39 3300042593 Ga0466691_148747 Ga0466691_148747_10440_11333 297
40 3300042601 Ga0466707_285997 Ga0466707_285997_1026_1919 297
41 3300042612 Ga0466705_130431 Ga0466705_130431_3712_4605 297
42 3300042612 Ga0466705_158758 Ga0466705_158758_4562_5455 297
43 3300042612 Ga0466705_372726 Ga0466705_372726_7651_8544 297
44 3300042616 Ga0466715_232040 Ga0466715_232040_1404_2297 297
45 3300042616 Ga0466715_342363 Ga0466715_342363_4262_5155 297
46 3300042619 Ga0466726_242969 Ga0466726_242969_102_995 297
47 3300042620 Ga0466728_138171 Ga0466728_138171_2150_3043 297
48 3300042620 Ga0466728_333383 Ga0466728_333383_2123_3016 297
49 3300042624 Ga0466735_053315 Ga0466735_053315_6356_7249 297
50 3300042636 Ga0466703_418661 Ga0466703_418661_492_1385 297
51 3300042643 Ga0466704_094724 Ga0466704_094724_4744_5637 297
52 3300042652 Ga0466708_347084 Ga0466708_347084_4001_4894 297
53 3300000062 IMNBL1DRAFT_c0004635 IMNBL1DRAFT_00046355 298
54 3300042590 Ga0466690_045391 Ga0466690_045391_4188_5084 298
55 3300042605 Ga0466716_475844 Ga0466716_475844_920_1816 298
56 3300042609 Ga0466722_150720 Ga0466722_150720_6263_7159 298
57 3300042616 Ga0466715_340747 Ga0466715_340747_11215_12111 298
58 3300042618 Ga0466723_025842 Ga0466723_025842_9831_10727 298
59 3300042620 Ga0466728_149086 Ga0466728_149086_507_1403 298
60 3300042643 Ga0466704_366088 Ga0466704_366088_2917_3813 298
61 3300042643 Ga0466704_469314 Ga0466704_469314_120_1016 298
62 3300042648 Ga0466709_286457 Ga0466709_286457_4108_5004 298
63 3300042652 Ga0466708_060683 Ga0466708_060683_47046_47942 298
64 3300042655 Ga0466727_120065 Ga0466727_120065_2234_3130 298
65 3300000062 IMNBL1DRAFT_c0002369 IMNBL1DRAFT_00023697 299
66 3300000062 IMNBL1DRAFT_c0010407 IMNBL1DRAFT_00104073 299
67 3300002462 JGI24702J35022_10011745 JGI24702J35022_100117454 299
68 3300042590 Ga0466690_051493 Ga0466690_051493_4502_5401 299
69 3300042591 Ga0466692_078297 Ga0466692_078297_6599_7498 299
70 3300042605 Ga0466716_030847 Ga0466716_030847_4084_4983 299
71 3300042612 Ga0466705_264324 Ga0466705_264324_4622_5521 299
72 3300042636 Ga0466703_217268 Ga0466703_217268_676_1575 299
73 3300042643 Ga0466704_322472 Ga0466704_322472_1550_2449 299
74 3300042643 Ga0466704_343880 Ga0466704_343880_2475_3374 299
75 3300005200 Ga0072940_1244072 Ga0072940_12440722 300
76 3300042590 Ga0466690_409142 Ga0466690_409142_2061_2963 300
77 3300042593 Ga0466691_191216 Ga0466691_191216_3975_4877 300
78 3300042609 Ga0466722_007385 Ga0466722_007385_743_1645 300
79 3300042609 Ga0466722_234933 Ga0466722_234933_480_1382 300
80 3300042620 Ga0466728_161462 Ga0466728_161462_93_995 300
81 3300042643 Ga0466704_102498 Ga0466704_102498_7590_8492 300
82 3300042643 Ga0466704_565068 Ga0466704_565068_6463_7365 300
83 3300042648 Ga0466709_279583 Ga0466709_279583_4496_5398 300
84 iso_pr_bacteria 2820776227 2820778316 300
85 3300009784 Ga0123357_10039887 Ga0123357_100398875 301
86 3300042602 Ga0466713_110191 Ga0466713_110191_636_1565 301
87 3300042636 Ga0466703_384067 Ga0466703_384067_769_1674 301
88 3300002834 JGI24696J40584_12959541 JGI24696J40584_129595414 302
89 3300009784 Ga0123357_10117989 Ga0123357_101179892 302
90 3300042596 Ga0466696_251909 Ga0466696_251909_2377_3285 302
91 3300042599 Ga0466706_237718 Ga0466706_237718_221_1129 302
92 3300042605 Ga0466716_202600 Ga0466716_202600_15289_16197 302
93 3300042616 Ga0466715_604151 Ga0466715_604151_11445_12353 302
94 3300042636 Ga0466703_173935 Ga0466703_173935_11249_12157 302
95 3300042643 Ga0466704_002372 Ga0466704_002372_4776_5684 302
96 3300042590 Ga0466690_153086 Ga0466690_153086_1343_2254 303
97 3300042593 Ga0466691_058246 Ga0466691_058246_10572_11483 303
98 3300042605 Ga0466716_345506 Ga0466716_345506_756_1667 303
99 3300042605 Ga0466716_423070 Ga0466716_423070_126_1037 303
100 3300042606 Ga0466719_304807 Ga0466719_304807_78_989 303
101 3300042616 Ga0466715_440572 Ga0466715_440572_372_1283 303
102 3300042616 Ga0466715_443592 Ga0466715_443592_372_1283 303
103 3300042618 Ga0466723_233898 Ga0466723_233898_13320_14231 303
104 3300042648 Ga0466709_315607 Ga0466709_315607_3901_4812 303
105 2225789004 2227502413 2227986684 304
106 3300042590 Ga0466690_015023 Ga0466690_015023_22458_23372 304
107 3300042596 Ga0466696_024005 Ga0466696_024005_4136_5050 304
108 3300042600 Ga0466700_193309 Ga0466700_193309_2016_2930 304
109 3300042602 Ga0466713_092950 Ga0466713_092950_112869_113783 304
110 3300042606 Ga0466719_009948 Ga0466719_009948_3975_4892 305
111 3300042615 Ga0466711_468146 Ga0466711_468146_22507_23424 305
112 3300042620 Ga0466728_281160 Ga0466728_281160_7101_8018 305
113 3300042599 Ga0466706_280280 Ga0466706_280280_11655_12575 306
114 3300042652 Ga0466708_455953 Ga0466708_455953_226_1146 306
115 3300042619 Ga0466726_263213 Ga0466726_263213_125_1057 310
116 3300042609 Ga0466722_059383 Ga0466722_059383_5106_6041 311
117 3300042615 Ga0466711_165052 Ga0466711_165052_163_1110 315
118 3300005083 Ga0068305_10921901 Ga0068305_109219013 318
119 3300042601 Ga0466707_352499 Ga0466707_352499_609_1589 326

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03279 Lip_A_acyltrans Bacterial lipid A biosynthesis acyltransferase 94 322 0.83

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.