Protein Family IF05967

Metagenome
105 Members
27 Samples
105 Scaffolds
302.64 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_339569|Ga0466707_339569_528_1472
Length
314 aa
Sequence
MLETGIVAVLQREFIYFWYYFEIQFRQIFGYWVLGMALGSVISVFGKDSIHRAFAGMRDKKLGALGVIPASLLGIASPLCMYGTIPIAASFAEKGMAEDWIAAFCMSSILLNPQLLFYSAALGPTALAIRFITCFLCGAAAGLCVRVFFKKKPFFRFTGFYAGTENHDTDPNPVLRLLKNFLRNIKATGLYFLIGIVLSALFQRYVPPDGFAKLFGSGRHGFGVLMAATVGVPVYVCGGGTIPLLVEWLRNGMSMGSATAFMLTGPATKITNLGAVKIVLGMKNFVLYLLFTMLFAFMSGVFVDWCIRALAVYK

📊 Sample Types

Isolate 0.0%
Metagenome 100.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 53.8%
Termitidae 23.1%
Rhinotermitidae 11.5%
Termopsidae 7.7%
Unclassified 3.8%

🌳 Taxonomy

Archaea 1
Bacteria 90
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
5 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
6 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
9 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
10 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
11 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
12 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
13 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
14 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
15 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
27 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466695_005119 3300042595 Bacteria 3063
2 Ga0466705_415743 3300042612 Bacteria 5427
3 Ga0466712_182133 3300042614 Bacteria 6525
4 Ga0466711_046456 3300042615 Bacteria 9489
5 Ga0466723_138167 3300042618 Bacteria 7231
6 Ga0466726_007599 3300042619 Bacteria 9503
7 Ga0466728_112941 3300042620 Bacteria 4042
8 Ga0466728_162551 3300042620 Bacteria 5745
9 Ga0466728_205882 3300042620 Bacteria 1224
10 Ga0466703_185697 3300042636 Bacteria 25709
11 Ga0466704_202160 3300042643 Bacteria 1306
12 Ga0466704_367015 3300042643 Bacteria 11571
13 Ga0466707_339569 3300042601 Bacteria 2115
14 Ga0466719_077102 3300042606 Bacteria 3856
15 Ga0466705_082272 3300042612 Bacteria 8216
16 Ga0466705_211341 3300042612 Bacteria 7695
17 Ga0466705_229994 3300042612 Bacteria 2639
18 Ga0415639_077710 3300038395 Unclassified 4220
19 Ga0466690_062648 3300042590 Bacteria 8325
20 Ga0466696_079495 3300042596 Bacteria 2326
21 Ga0466728_075088 3300042620 Bacteria 1670
22 Ga0466728_096187 3300042620 Bacteria 5802
23 Ga0466728_101731 3300042620 Bacteria 11817
24 Ga0466703_130567 3300042636 Bacteria 4640
25 Ga0466704_120416 3300042643 Bacteria 30382
26 Ga0466704_270988 3300042643 Bacteria 24720
27 Ga0466719_151859 3300042606 Bacteria 4701
28 Ga0466719_321974 3300042606 Bacteria 26448
29 Ga0456237_0012842 3300041968 Unclassified 1207
30 Ga0466690_135182 3300042590 Bacteria 2239
31 Ga0466711_294510 3300042615 Bacteria 8916
32 Ga0466723_137349 3300042618 Bacteria 5699
33 Ga0466723_227797 3300042618 Bacteria 5279
34 Ga0466726_126520 3300042619 Bacteria 1415
35 Ga0466728_030049 3300042620 Bacteria 2065
36 Ga0466728_150957 3300042620 Bacteria 1995
37 Ga0466728_226329 3300042620 Unclassified 1118
38 Ga0466704_035118 3300042643 Bacteria 4401
39 Ga0466704_036237 3300042643 Bacteria 2456
40 Ga0466704_434098 3300042643 Bacteria 82573
41 Ga0466709_237340 3300042648 Bacteria 2616
42 Ga0466719_000307 3300042606 Bacteria 2975
43 Ga0466733_184996 3300042659 Unclassified 2046
44 Ga0466728_432725 3300042620 Bacteria 3271
45 Ga0072941_1004857 3300005201 Unclassified 14339
46 Ga0466703_010414 3300042636 Bacteria 8127
47 Ga0466703_201279 3300042636 Bacteria 1348
48 Ga0466704_247065 3300042643 Unclassified 1259
49 Ga0466704_608704 3300042643 Bacteria 2547
50 Ga0466704_622319 3300042643 Bacteria 6830
51 Ga0466709_351380 3300042648 Bacteria 3720
52 Ga0466719_080739 3300042606 Bacteria 19547
53 Ga0466705_010923 3300042612 Bacteria 5698
54 Ga0466705_180006 3300042612 Bacteria 14139
55 Ga0466715_595088 3300042616 Bacteria 4599
56 Ga0466723_193985 3300042618 Bacteria 2129
57 Ga0466726_041759 3300042619 Bacteria 1199
58 Ga0466726_056568 3300042619 Archaea 3976
59 Ga0466728_134033 3300042620 Bacteria 6092
60 Ga0466703_058560 3300042636 Bacteria 3418
61 Ga0466703_175647 3300042636 Bacteria 3027
62 Ga0466704_115382 3300042643 Bacteria 7098
63 Ga0466704_232712 3300042643 Bacteria 11168
64 Ga0466719_181010 3300042606 Bacteria 14792
65 Ga0466719_309527 3300042606 Bacteria 3292
66 Ga0466705_013181 3300042612 Bacteria 3558
67 Ga0466705_048869 3300042612 Unclassified 4979
68 Ga0466705_080622 3300042612 Bacteria 10577
69 Ga0466690_071716 3300042590 Bacteria 11302
70 Ga0466690_180072 3300042590 Unclassified 1442
71 Ga0466690_194552 3300042590 Bacteria 2481
72 Ga0466691_034646 3300042593 Bacteria 10784
73 Ga0466691_221539 3300042593 Bacteria 5482
74 Ga0466694_107532 3300042594 Bacteria 21959
75 Ga0466728_001779 3300042620 Bacteria 2490
76 Ga0466728_388274 3300042620 Bacteria 2445
77 Ga0466729_218495 3300042621 Unclassified 1709
78 Ga0466735_055146 3300042624 Bacteria 2773
79 Ga0466703_358754 3300042636 Bacteria 14270
80 Ga0466722_062068 3300042609 Bacteria 1954
81 Ga0466705_129516 3300042612 Bacteria 2400
82 Ga0466705_268849 3300042612 Bacteria 3835
83 Ga0466733_051499 3300042659 Bacteria 21579
84 Ga0466715_115606 3300042616 Bacteria 4398
85 Ga0466715_588110 3300042616 Bacteria 16163
86 Ga0466726_399823 3300042619 Bacteria 2433
87 Ga0466728_020637 3300042620 Bacteria 8786
88 Ga0466728_182892 3300042620 Bacteria 3096
89 Ga0466704_145582 3300042643 Bacteria 1577
90 Ga0466709_125418 3300042648 Bacteria 2616
91 Ga0466708_189217 3300042652 Bacteria 3681
92 Ga0466707_279281 3300042601 Bacteria 3320
93 Ga0466716_047003 3300042605 Unclassified 7238
94 Ga0466716_120423 3300042605 Bacteria 6286
95 Ga0466705_049163 3300042612 Bacteria 6741
96 Ga0123356_10144179 3300010049 Bacteria 2354
97 Ga0466690_327770 3300042590 Bacteria 1155
98 Ga0466691_033083 3300042593 Bacteria 3761
99 Ga0466723_323862 3300042618 Bacteria 13939
100 Ga0466726_042911 3300042619 Bacteria 3025
101 Ga0466726_096021 3300042619 Unclassified 6323
102 Ga0466735_067989 3300042624 Unclassified 3296
103 Ga0466735_127739 3300042624 Bacteria 1308
104 Ga0466707_213253 3300042601 Unclassified 1019
105 Ga0466707_395127 3300042601 Unclassified 1033

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_079495 Ga0466696_079495_1414_2205 263
2 3300042590 Ga0466690_180072 Ga0466690_180072_131_928 265
3 3300041968 Ga0456237_0012842 Ga0456237_0012842_22_843 273
4 3300042601 Ga0466707_213253 Ga0466707_213253_47_868 273
5 3300042619 Ga0466726_041759 Ga0466726_041759_300_1133 277
6 3300042619 Ga0466726_126520 Ga0466726_126520_528_1361 277
7 3300042643 Ga0466704_120416 Ga0466704_120416_16040_16879 279
8 3300042595 Ga0466695_005119 Ga0466695_005119_1309_2214 285
9 3300042636 Ga0466703_130567 Ga0466703_130567_1838_2752 286
10 3300042612 Ga0466705_129516 Ga0466705_129516_320_1237 293
11 3300042620 Ga0466728_205882 Ga0466728_205882_133_1044 293
12 3300042624 Ga0466735_055146 Ga0466735_055146_1377_2282 296
13 3300042624 Ga0466735_067989 Ga0466735_067989_1765_2685 296
14 3300042620 Ga0466728_075088 Ga0466728_075088_561_1454 297
15 3300042590 Ga0466690_194552 Ga0466690_194552_1149_2045 298
16 3300042619 Ga0466726_042911 Ga0466726_042911_1812_2708 298
17 3300042606 Ga0466719_321974 Ga0466719_321974_2724_3623 299
18 3300042606 Ga0466719_077102 Ga0466719_077102_463_1365 300
19 3300042606 Ga0466719_151859 Ga0466719_151859_1833_2735 300
20 3300042612 Ga0466705_180006 Ga0466705_180006_10734_11636 300
21 3300042593 Ga0466691_033083 Ga0466691_033083_794_1699 301
22 3300042612 Ga0466705_010923 Ga0466705_010923_1884_2789 301
23 3300042624 Ga0466735_127739 Ga0466735_127739_85_990 301
24 3300042659 Ga0466733_051499 Ga0466733_051499_13938_14843 301
25 3300042659 Ga0466733_184996 Ga0466733_184996_17_922 301
26 3300010049 Ga0123356_10144179 Ga0123356_101441792 302
27 3300042614 Ga0466712_182133 Ga0466712_182133_3836_4744 302
28 3300042616 Ga0466715_588110 Ga0466715_588110_6776_7684 302
29 3300042618 Ga0466723_227797 Ga0466723_227797_2761_3669 302
30 3300042620 Ga0466728_101731 Ga0466728_101731_9330_10238 302
31 3300042620 Ga0466728_112941 Ga0466728_112941_1338_2246 302
32 3300042620 Ga0466728_134033 Ga0466728_134033_3988_4896 302
33 3300042620 Ga0466728_150957 Ga0466728_150957_94_1002 302
34 3300042620 Ga0466728_182892 Ga0466728_182892_63_971 302
35 3300005201 Ga0072941_1004857 Ga0072941_100485717 303
36 3300038395 Ga0415639_077710 Ga0415639_077710_185_1096 303
37 3300042590 Ga0466690_071716 Ga0466690_071716_2836_3747 303
38 3300042594 Ga0466694_107532 Ga0466694_107532_4802_5713 303
39 3300042606 Ga0466719_181010 Ga0466719_181010_2117_3028 303
40 3300042606 Ga0466719_309527 Ga0466719_309527_863_1774 303
41 3300042612 Ga0466705_048869 Ga0466705_048869_2509_3420 303
42 3300042612 Ga0466705_082272 Ga0466705_082272_185_1096 303
43 3300042612 Ga0466705_211341 Ga0466705_211341_2848_3759 303
44 3300042612 Ga0466705_229994 Ga0466705_229994_1470_2381 303
45 3300042612 Ga0466705_415743 Ga0466705_415743_3909_4820 303
46 3300042615 Ga0466711_046456 Ga0466711_046456_4332_5243 303
47 3300042615 Ga0466711_294510 Ga0466711_294510_1256_2167 303
48 3300042616 Ga0466715_115606 Ga0466715_115606_2229_3140 303
49 3300042616 Ga0466715_595088 Ga0466715_595088_3555_4466 303
50 3300042618 Ga0466723_137349 Ga0466723_137349_2431_3342 303
51 3300042618 Ga0466723_138167 Ga0466723_138167_6053_6964 303
52 3300042620 Ga0466728_162551 Ga0466728_162551_1900_2811 303
53 3300042620 Ga0466728_226329 Ga0466728_226329_108_1019 303
54 3300042621 Ga0466729_218495 Ga0466729_218495_181_1092 303
55 3300042636 Ga0466703_058560 Ga0466703_058560_234_1145 303
56 3300042636 Ga0466703_175647 Ga0466703_175647_180_1091 303
57 3300042636 Ga0466703_185697 Ga0466703_185697_1753_2664 303
58 3300042636 Ga0466703_201279 Ga0466703_201279_227_1138 303
59 3300042636 Ga0466703_358754 Ga0466703_358754_752_1663 303
60 3300042643 Ga0466704_035118 Ga0466704_035118_1205_2116 303
61 3300042643 Ga0466704_036237 Ga0466704_036237_1007_1918 303
62 3300042643 Ga0466704_145582 Ga0466704_145582_330_1241 303
63 3300042643 Ga0466704_232712 Ga0466704_232712_216_1127 303
64 3300042643 Ga0466704_622319 Ga0466704_622319_4442_5353 303
65 3300042648 Ga0466709_351380 Ga0466709_351380_490_1401 303
66 3300042652 Ga0466708_189217 Ga0466708_189217_1591_2502 303
67 3300042593 Ga0466691_034646 Ga0466691_034646_99_1013 304
68 3300042605 Ga0466716_047003 Ga0466716_047003_1067_1981 304
69 3300042619 Ga0466726_399823 Ga0466726_399823_66_980 304
70 3300042620 Ga0466728_020637 Ga0466728_020637_6927_7841 304
71 3300042643 Ga0466704_202160 Ga0466704_202160_226_1140 304
72 3300042643 Ga0466704_608704 Ga0466704_608704_927_1841 304
73 3300042606 Ga0466719_000307 Ga0466719_000307_440_1357 305
74 3300042612 Ga0466705_080622 Ga0466705_080622_1330_2247 305
75 3300042620 Ga0466728_432725 Ga0466728_432725_497_1414 305
76 3300042643 Ga0466704_115382 Ga0466704_115382_4697_5614 305
77 3300042643 Ga0466704_247065 Ga0466704_247065_325_1242 305
78 3300042648 Ga0466709_125418 Ga0466709_125418_350_1267 305
79 3300042601 Ga0466707_279281 Ga0466707_279281_1957_2877 306
80 3300042619 Ga0466726_096021 Ga0466726_096021_1929_2849 306
81 3300042612 Ga0466705_013181 Ga0466705_013181_2504_3427 307
82 3300042612 Ga0466705_049163 Ga0466705_049163_5271_6194 307
83 3300042619 Ga0466726_007599 Ga0466726_007599_1324_2247 307
84 3300042619 Ga0466726_056568 Ga0466726_056568_767_1690 307
85 3300042590 Ga0466690_327770 Ga0466690_327770_47_973 308
86 3300042606 Ga0466719_080739 Ga0466719_080739_1294_2220 308
87 3300042609 Ga0466722_062068 Ga0466722_062068_228_1154 308
88 3300042620 Ga0466728_096187 Ga0466728_096187_1056_1982 308
89 3300042643 Ga0466704_270988 Ga0466704_270988_4638_5564 308
90 3300042643 Ga0466704_367015 Ga0466704_367015_1452_2378 308
91 3300042601 Ga0466707_395127 Ga0466707_395127_38_967 309
92 3300042612 Ga0466705_268849 Ga0466705_268849_1731_2660 309
93 3300042620 Ga0466728_388274 Ga0466728_388274_1396_2328 310
94 3300042593 Ga0466691_221539 Ga0466691_221539_267_1202 311
95 3300042620 Ga0466728_030049 Ga0466728_030049_898_1833 311
96 3300042590 Ga0466690_135182 Ga0466690_135182_858_1802 314
97 3300042601 Ga0466707_339569 Ga0466707_339569_528_1472 314
98 3300042618 Ga0466723_193985 Ga0466723_193985_322_1266 314
99 3300042605 Ga0466716_120423 Ga0466716_120423_4313_5260 315
100 3300042648 Ga0466709_237340 Ga0466709_237340_1394_2389 315
101 3300042636 Ga0466703_010414 Ga0466703_010414_6411_7361 316
102 3300042643 Ga0466704_434098 Ga0466704_434098_27834_28787 317
103 3300042618 Ga0466723_323862 Ga0466723_323862_4270_5244 324
104 3300042620 Ga0466728_001779 Ga0466728_001779_905_1936 343
105 3300042590 Ga0466690_062648 Ga0466690_062648_339_1379 346

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03773 ArsP_1 Predicted permease 29 302 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.79 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.