Protein Family IF05940

Metagenome Isolate
149 Members
59 Samples
134 Scaffolds
429.17 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_288211|Ga0466707_288211_3387_4769
Length
460 aa
Sequence
MKTICFYFQIHQPFRLRRYRFFDIGNNHXXXDDFQNEEIFHRIAEKCYLPANRTIAEMIKSSGGKFKVAFSISGTALEQMEIYSPEVIDSFKELAQLGNVEFLTETYAHSLSSLGDPDEFKVQVQKHTEKIQSLFNVTPKVFRNTELIYSDDISELVYEMGFEQMLTEGAKHVLGWKSPNYVYASGVRPQLKLLLKNDRFSEDLSIRFGDYSWNEYPLTADKYMSWIASTPESEEVINLFMNYEILGSMHTAETGIFNFFKALPKCAEEHNISFSLPSEIFDSKKVADYISVPYPLSWVDEEKDCSSWLGNTLQQEAYQKINQIGERVRLCDDRRIKQDWVYLQSSDHLYYMNTKHFNLFSPYDSPYDAFNNYMNVFSDFMLRVDAQFPSSIENEELNSLLTTIRNQASEINLLEAKVEMMQEVLEATKKEIKSVTAKKTGRRKLVEVIPVEVEEPVIAK

📊 Sample Types

Isolate 10.1%
Metagenome 89.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 28.8%
Blattidae 25.4%
Kalotermitidae 23.7%
Termopsidae 6.8%
Rhinotermitidae 5.1%
Unclassified 5.1%
Passalidae 3.4%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
8 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 2923982719 Parabacteroides sp. 52 Isolate Blattidae
11 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
12 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
13 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
19 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
20 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
21 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
22 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
31 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
32 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
33 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
34 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
35 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
36 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
37 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
38 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
39 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
40 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
41 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
42 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
43 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
44 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
45 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
46 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
49 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
50 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
51 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
52 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
53 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
54 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
55 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
56 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
57 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
58 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
59 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466657_284474 3300042582 Bacteria 6443
2 Ga0466690_120367 3300042590 Bacteria 5404
3 Ga0466690_181107 3300042590 Bacteria 4016
4 Ga0466696_385368 3300042596 Bacteria 3411
5 Ga0123354_10098703 3300010882 Bacteria 3969
6 Ga0466716_263902 3300042605 Bacteria 6122
7 Ga0466718_110391 3300042617 Bacteria 2999
8 Ga0466709_195586 3300042648 Bacteria 18639
9 Ga0466708_047780 3300042652 Bacteria 13189
10 2227114149 2225789004 Bacteria 9325
11 Ga0466690_293895 3300042590 Bacteria 67504
12 Ga0466690_422531 3300042590 Bacteria 34447
13 Ga0466696_135726 3300042596 Bacteria 1997
14 Ga0466706_078249 3300042599 Bacteria 49927
15 Ga0466707_141319 3300042601 Bacteria 9858
16 Ga0466713_012148 3300042602 Bacteria 23425
17 Ga0466713_057152 3300042602 Bacteria 7179
18 Ga0466713_104700 3300042602 Bacteria 45952
19 Ga0466714_022595 3300042603 Bacteria 225972
20 Ga0466698_411284 3300042610 Bacteria 3473
21 Ga0466711_237748 3300042615 Bacteria 15956
22 Ga0466731_117682 3300042622 Bacteria 2654
23 Ga0466735_073097 3300042624 Bacteria 2751
24 Ga0466735_219706 3300042624 Bacteria 1900
25 Ga0466703_028432 3300042636 Bacteria 36646
26 Ga0466703_064381 3300042636 Bacteria 23622
27 Ga0466703_119368 3300042636 Bacteria 6481
28 Ga0466703_310317 3300042636 Bacteria 8870
29 Ga0466703_420568 3300042636 Bacteria 11340
30 Ga0466704_545422 3300042643 Bacteria 4758
31 Ga0466727_301385 3300042655 Bacteria 6922
32 IMNBL1DRAFT_c0002266 3300000062 Bacteria 13543
33 JGI24702J35022_10032299 3300002462 Bacteria 2804
34 Ga0068305_10057739 3300005083 Bacteria 8409
35 Ga0466697_082893 3300042611 Bacteria 90149
36 Ga0466706_189362 3300042599 Bacteria 4263
37 Ga0466707_107181 3300042601 Bacteria 13174
38 Ga0466713_005670 3300042602 Bacteria 17868
39 Ga0466719_270891 3300042606 Bacteria 6097
40 Ga0466705_442694 3300042612 Bacteria 5680
41 Ga0466711_029321 3300042615 Bacteria 7807
42 Ga0466711_212383 3300042615 Bacteria 31353
43 Ga0466715_563971 3300042616 Bacteria 21271
44 Ga0466723_038078 3300042618 Bacteria 16779
45 Ga0466723_046111 3300042618 Bacteria 28072
46 Ga0466723_061859 3300042618 Bacteria 29829
47 Ga0466723_118143 3300042618 Bacteria 49080
48 Ga0466704_176920 3300042643 Unclassified 3060
49 Ga0466724_68534 3300042649 Bacteria 3703
50 Ga0466727_256129 3300042655 Bacteria 7792
51 IMNBL1DRAFT_c0001110 3300000062 Bacteria 20621
52 Ga0068302_10123691 3300005071 Bacteria 2437
53 Ga0466697_143455 3300042611 Bacteria 1720
54 Ga0466705_142053 3300042612 Bacteria 14920
55 Ga0466733_021359 3300042659 Bacteria 6956
56 Ga0466657_153522 3300042582 Bacteria 2550
57 Ga0466690_367263 3300042590 Bacteria 2664
58 Ga0466696_061752 3300042596 Bacteria 8197
59 Ga0123354_10000180 3300010882 Bacteria 53026
60 Ga0466707_288211 3300042601 Bacteria 6522
61 Ga0466713_044213 3300042602 Bacteria 1792
62 Ga0466716_337511 3300042605 Bacteria 5533
63 Ga0466716_347766 3300042605 Bacteria 17678
64 Ga0466719_080399 3300042606 Bacteria 7857
65 Ga0466719_103623 3300042606 Bacteria 5934
66 Ga0466711_114669 3300042615 Bacteria 3027
67 Ga0466711_512097 3300042615 Bacteria 10031
68 Ga0466703_137567 3300042636 Bacteria 9294
69 Ga0466704_022904 3300042643 Bacteria 16169
70 IMNBL1DRAFT_c0002580 3300000062 Bacteria 12480
71 Ga0466705_193156 3300042612 Unclassified 1722
72 Ga0466705_309838 3300042612 Bacteria 8732
73 Ga0466690_039830 3300042590 Bacteria 7546
74 Ga0466690_314070 3300042590 Unclassified 4184
75 Ga0466692_159326 3300042591 Bacteria 9336
76 Ga0466710_091840 3300042613 Bacteria 6355
77 Ga0466711_243499 3300042615 Bacteria 19688
78 Ga0466715_222457 3300042616 Bacteria 7212
79 Ga0466729_271014 3300042621 Bacteria 1659
80 Ga0466735_078905 3300042624 Bacteria 8335
81 Ga0466703_141011 3300042636 Bacteria 9863
82 Ga0466704_152196 3300042643 Bacteria 5717
83 Ga0466709_345202 3300042648 Bacteria 5004
84 Ga0466708_044823 3300042652 Bacteria 38978
85 Ga0466708_062073 3300042652 Bacteria 36526
86 Ga0466727_030375 3300042655 Bacteria 10426
87 JGI24702J35022_10007120 3300002462 Bacteria 6431
88 Ga0466656_189093 3300042550 Bacteria 9511
89 Ga0466690_188672 3300042590 Bacteria 3338
90 Ga0466693_449145 3300042592 Bacteria 2295
91 Ga0466691_015767 3300042593 Bacteria 27418
92 Ga0466691_021962 3300042593 Bacteria 32901
93 Ga0466691_064359 3300042593 Bacteria 9508
94 Ga0466696_035874 3300042596 Bacteria 2291
95 Ga0123353_10180097 3300010167 Bacteria 3347
96 Ga0466716_533086 3300042605 Bacteria 7146
97 Ga0466711_213693 3300042615 Bacteria 12382
98 Ga0466728_217089 3300042620 Bacteria 4193
99 Ga0466729_076873 3300042621 Bacteria 35472
100 Ga0466703_206270 3300042636 Bacteria 10450
101 Ga0466704_088631 3300042643 Bacteria 16533
102 Ga0466704_140792 3300042643 Bacteria 6152
103 Ga0466704_527853 3300042643 Bacteria 12907
104 2227485763 2225789004 Bacteria 21082
105 IMNBL1DRAFT_c0004653 3300000062 Bacteria 8143
106 Ga0068305_10003562 3300005083 Bacteria 9498
107 Ga0466691_093994 3300042593 Bacteria 6562
108 Ga0466701_086225 3300042598 Bacteria 2681
109 Ga0466722_205722 3300042609 Bacteria 13113
110 Ga0466715_112489 3300042616 Bacteria 27810
111 Ga0466726_132406 3300042619 Bacteria 12761
112 Ga0466728_400668 3300042620 Bacteria 14279
113 Ga0466709_270367 3300042648 Bacteria 6283
114 JGI24702J35022_10025637 3300002462 Bacteria 3179
115 Ga0466705_189024 3300042612 Bacteria 18933
116 Ga0466705_369828 3300042612 Unclassified 3022
117 Ga0466733_025416 3300042659 Bacteria 189255
118 Ga0466733_098696 3300042659 Bacteria 6239
119 Ga0466693_265685 3300042592 Bacteria 2664
120 Ga0466696_394450 3300042596 Bacteria 7005
121 Ga0123356_10071696 3300010049 Bacteria 3252
122 Ga0466713_111827 3300042602 Bacteria 11974
123 Ga0466716_071288 3300042605 Bacteria 25171
124 Ga0466716_507390 3300042605 Bacteria 50325
125 Ga0466719_273606 3300042606 Bacteria 13452
126 Ga0466705_459753 3300042612 Bacteria 12220
127 Ga0466711_259604 3300042615 Bacteria 12234
128 Ga0466711_504327 3300042615 Bacteria 7048
129 Ga0466728_324309 3300042620 Bacteria 5929
130 Ga0466703_305990 3300042636 Bacteria 1939
131 Ga0466725_001714 3300042654 Bacteria 11123
132 Ga0466727_223234 3300042655 Bacteria 11982
133 2227655174 2225789004 Bacteria 10676
134 JGI24702J35022_10000714 3300002462 Bacteria 20392

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042602 Ga0466713_057152 Ga0466713_057152_593_1708 371
2 3300042602 Ga0466713_005670 Ga0466713_005670_11869_12990 373
3 3300042606 Ga0466719_103623 Ga0466719_103623_4603_5748 381
4 3300042655 Ga0466727_301385 Ga0466727_301385_5003_6151 382
5 3300042655 Ga0466727_030375 Ga0466727_030375_2807_3961 384
6 3300042612 Ga0466705_309838 Ga0466705_309838_2874_4040 388
7 3300042596 Ga0466696_061752 Ga0466696_061752_6418_7587 389
8 3300042620 Ga0466728_324309 Ga0466728_324309_4421_5596 391
9 3300042643 Ga0466704_088631 Ga0466704_088631_8154_9341 395
10 3300042590 Ga0466690_422531 Ga0466690_422531_29035_30237 400
11 3300042643 Ga0466704_140792 Ga0466704_140792_515_1717 400
12 3300042605 Ga0466716_263902 Ga0466716_263902_2302_3600 402
13 3300042654 Ga0466725_001714 Ga0466725_001714_2788_4035 402
14 2225789004 2227485763 2227951895 404
15 3300042590 Ga0466690_039830 Ga0466690_039830_2929_4230 404
16 3300042606 Ga0466719_080399 Ga0466719_080399_27_1244 405
17 3300042643 Ga0466704_545422 Ga0466704_545422_3370_4656 406
18 3300042622 Ga0466731_117682 Ga0466731_117682_466_1746 411
19 3300042602 Ga0466713_104700 Ga0466713_104700_4087_5382 413
20 3300042643 Ga0466704_152196 Ga0466704_152196_1164_2486 414
21 3300000062 IMNBL1DRAFT_c0001110 IMNBL1DRAFT_000111010 415
22 3300005083 Ga0068305_10003562 Ga0068305_100035627 415
23 3300042599 Ga0466706_078249 Ga0466706_078249_17359_18720 415
24 3300042618 Ga0466723_046111 Ga0466723_046111_22721_24019 415
25 3300042592 Ga0466693_265685 Ga0466693_265685_1280_2587 416
26 3300042601 Ga0466707_107181 Ga0466707_107181_3428_4726 418
27 3300042550 Ga0466656_189093 Ga0466656_189093_3485_4774 419
28 3300002462 JGI24702J35022_10025637 JGI24702J35022_100256372 420
29 3300042590 Ga0466690_314070 Ga0466690_314070_1540_2844 420
30 3300042618 Ga0466723_061859 Ga0466723_061859_24295_25599 421
31 3300042636 Ga0466703_206270 Ga0466703_206270_5295_6596 421
32 3300000062 IMNBL1DRAFT_c0004653 IMNBL1DRAFT_00046533 422
33 3300042605 Ga0466716_507390 Ga0466716_507390_14115_15422 422
34 3300042602 Ga0466713_044213 Ga0466713_044213_157_1428 423
35 3300042602 Ga0466713_111827 Ga0466713_111827_5291_6562 423
36 3300042611 Ga0466697_143455 Ga0466697_143455_46_1317 423
37 3300000062 IMNBL1DRAFT_c0002580 IMNBL1DRAFT_000258010 424
38 3300010882 Ga0123354_10098703 Ga0123354_100987035 424
39 3300042593 Ga0466691_064359 Ga0466691_064359_3687_4994 424
40 3300042610 Ga0466698_411284 Ga0466698_411284_10_1284 424
41 3300042617 Ga0466718_110391 Ga0466718_110391_1367_2641 424
42 3300042598 Ga0466701_086225 Ga0466701_086225_233_1609 425
43 3300042601 Ga0466707_141319 Ga0466707_141319_4221_5498 425
44 3300042605 Ga0466716_533086 Ga0466716_533086_4333_5637 425
45 3300042609 Ga0466722_205722 Ga0466722_205722_3500_4852 425
46 3300010882 Ga0123354_10000180 Ga0123354_100001806 427
47 3300042590 Ga0466690_367263 Ga0466690_367263_686_1993 427
48 3300042615 Ga0466711_243499 Ga0466711_243499_2085_3368 427
49 3300042648 Ga0466709_270367 Ga0466709_270367_4903_6225 427
50 3300042652 Ga0466708_047780 Ga0466708_047780_5703_6986 427
51 3300010049 Ga0123356_10071696 Ga0123356_100716962 428
52 3300042592 Ga0466693_449145 Ga0466693_449145_530_1816 428
53 3300042615 Ga0466711_212383 Ga0466711_212383_26417_27727 428
54 3300042615 Ga0466711_512097 Ga0466711_512097_5905_7212 428
55 2225789004 2227655174 2228252867 429
56 3300042615 Ga0466711_029321 Ga0466711_029321_5234_6523 429
57 3300042590 Ga0466690_188672 Ga0466690_188672_586_1878 430
58 3300042606 Ga0466719_270891 Ga0466719_270891_4658_5950 430
59 3300042612 Ga0466705_442694 Ga0466705_442694_270_1562 430
60 2225789004 2227114149 2227504263 431
61 3300042612 Ga0466705_142053 Ga0466705_142053_5487_6782 431
62 3300042615 Ga0466711_259604 Ga0466711_259604_4657_5952 431
63 iso_pr_bacteria 2923982719 2923983559 431
64 iso_pr_bacteria 2940371297 2940371490 431
65 3300042606 Ga0466719_273606 Ga0466719_273606_8520_9818 432
66 3300042616 Ga0466715_222457 Ga0466715_222457_5445_6743 432
67 3300042624 Ga0466735_219706 Ga0466735_219706_564_1865 433
68 3300042636 Ga0466703_028432 Ga0466703_028432_25872_27173 433
69 3300042636 Ga0466703_141011 Ga0466703_141011_8199_9500 433
70 3300002462 JGI24702J35022_10032299 JGI24702J35022_100322992 434
71 3300010167 Ga0123353_10180097 Ga0123353_101800972 434
72 3300042590 Ga0466690_120367 Ga0466690_120367_401_1705 434
73 3300042590 Ga0466690_181107 Ga0466690_181107_873_2177 434
74 3300042648 Ga0466709_345202 Ga0466709_345202_2967_4271 434
75 3300042590 Ga0466690_293895 Ga0466690_293895_12482_13789 435
76 3300042591 Ga0466692_159326 Ga0466692_159326_4862_6169 435
77 3300042593 Ga0466691_093994 Ga0466691_093994_4921_6228 435
78 3300042612 Ga0466705_189024 Ga0466705_189024_6127_7434 435
79 3300042612 Ga0466705_193156 Ga0466705_193156_321_1628 435
80 3300042612 Ga0466705_369828 Ga0466705_369828_764_2071 435
81 3300042615 Ga0466711_114669 Ga0466711_114669_1031_2338 435
82 3300042616 Ga0466715_112489 Ga0466715_112489_10544_11851 435
83 3300042616 Ga0466715_563971 Ga0466715_563971_18044_19351 435
84 3300042618 Ga0466723_038078 Ga0466723_038078_806_2113 435
85 3300042620 Ga0466728_217089 Ga0466728_217089_738_2045 435
86 3300042620 Ga0466728_400668 Ga0466728_400668_8820_10127 435
87 3300042624 Ga0466735_078905 Ga0466735_078905_4790_6097 435
88 3300042636 Ga0466703_420568 Ga0466703_420568_9765_11072 435
89 3300042643 Ga0466704_176920 Ga0466704_176920_887_2194 435
90 3300042652 Ga0466708_044823 Ga0466708_044823_28563_29870 435
91 3300042652 Ga0466708_062073 Ga0466708_062073_10799_12106 435
92 3300000062 IMNBL1DRAFT_c0002266 IMNBL1DRAFT_00022668 436
93 3300005071 Ga0068302_10123691 Ga0068302_101236912 436
94 3300042596 Ga0466696_394450 Ga0466696_394450_45_1412 436
95 3300042605 Ga0466716_347766 Ga0466716_347766_12040_13350 436
96 3300042615 Ga0466711_213693 Ga0466711_213693_5772_7082 436
97 3300042615 Ga0466711_237748 Ga0466711_237748_1201_2511 436
98 3300042615 Ga0466711_504327 Ga0466711_504327_5311_6621 436
99 3300042636 Ga0466703_119368 Ga0466703_119368_4114_5424 436
100 3300042643 Ga0466704_527853 Ga0466704_527853_7507_8817 436
101 3300002462 JGI24702J35022_10000714 JGI24702J35022_100007145 437
102 3300042602 Ga0466713_012148 Ga0466713_012148_5808_7121 437
103 3300042619 Ga0466726_132406 Ga0466726_132406_1219_2532 437
104 3300042621 Ga0466729_076873 Ga0466729_076873_16392_17705 437
105 3300042636 Ga0466703_137567 Ga0466703_137567_2804_4117 437
106 iso_pr_bacteria 2940205530 2940206780 437
107 iso_pr_bacteria 2940212447 2940213518 437
108 iso_pr_bacteria 2940298504 2940299573 437
109 iso_pr_bacteria 2940302308 2940303557 437
110 iso_pr_bacteria 2940306115 2940307577 437
111 iso_pr_bacteria 2940309933 2940311110 437
112 iso_pr_bacteria 2940313741 2940314745 437
113 iso_pr_bacteria 2940317558 2940318560 437
114 iso_pr_bacteria 2940321370 2940322549 437
115 iso_pr_bacteria 2940325180 2940326251 437
116 iso_pr_bacteria 2940328985 2940330057 437
117 iso_pr_bacteria 2940332795 2940333975 437
118 3300002462 JGI24702J35022_10007120 JGI24702J35022_100071205 438
119 3300005083 Ga0068305_10057739 Ga0068305_100577392 439
120 3300042621 Ga0466729_271014 Ga0466729_271014_154_1473 439
121 3300042649 Ga0466724_68534 Ga0466724_68534_1265_2584 439
122 3300042655 Ga0466727_223234 Ga0466727_223234_685_2004 439
123 3300042599 Ga0466706_189362 Ga0466706_189362_2128_3450 440
124 3300042603 Ga0466714_022595 Ga0466714_022595_103726_105105 440
125 3300042582 Ga0466657_153522 Ga0466657_153522_401_1726 441
126 3300042582 Ga0466657_284474 Ga0466657_284474_1746_3071 441
127 3300042611 Ga0466697_082893 Ga0466697_082893_81021_82346 441
128 3300042636 Ga0466703_064381 Ga0466703_064381_15361_16686 441
129 3300042613 Ga0466710_091840 Ga0466710_091840_94_1422 442
130 3300042648 Ga0466709_195586 Ga0466709_195586_724_2052 442
131 3300042659 Ga0466733_021359 Ga0466733_021359_3664_5232 442
132 3300042596 Ga0466696_035874 Ga0466696_035874_683_2014 443
133 3300042605 Ga0466716_337511 Ga0466716_337511_246_1595 443
134 3300042659 Ga0466733_098696 Ga0466733_098696_2484_3815 443
135 iso_pr_bacteria 2940202316 2940204568 443
136 3300042596 Ga0466696_135726 Ga0466696_135726_520_1854 444
137 3300042659 Ga0466733_025416 Ga0466733_025416_18577_19917 446
138 3300042636 Ga0466703_305990 Ga0466703_305990_504_1853 449
139 3300042655 Ga0466727_256129 Ga0466727_256129_4656_6005 449
140 3300042593 Ga0466691_021962 Ga0466691_021962_968_2323 451
141 3300042636 Ga0466703_310317 Ga0466703_310317_5533_6888 451
142 3300042596 Ga0466696_385368 Ga0466696_385368_383_1741 452
143 3300042618 Ga0466723_118143 Ga0466723_118143_39223_40581 452
144 3300042612 Ga0466705_459753 Ga0466705_459753_9915_11279 454
145 3300042643 Ga0466704_022904 Ga0466704_022904_14405_15769 454
146 3300042593 Ga0466691_015767 Ga0466691_015767_11318_12691 457
147 3300042605 Ga0466716_071288 Ga0466716_071288_4015_5388 457
148 3300042601 Ga0466707_288211 Ga0466707_288211_3387_4769 460
149 3300042624 Ga0466735_073097 Ga0466735_073097_479_1861 460

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03065 Glyco_hydro_57 Glycosyl hydrolase family 57 6 292 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.