Protein Family IF05923

Metagenome Isolate
140 Members
42 Samples
134 Scaffolds
247.86 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_256033|Ga0466707_256033_372_1136
Length
254 aa
Sequence
MKLLLILGSDDTYELLSLYIRPLGFSLIRYRHVIKAMDNIDEADPAAIIISARDFPRHWKALVQFVRSERSKEACPIIILQGETLPPEISTQAVYLGVNGIVDETLNTSELDRLQSILSRYIPVNEKRRARRFPAADWNRFGLLLENPIDKTLISGEVKTISHTGVSFVPKDPAMMKDITLNTVLNGCSLRAGETILSPICCMVRPGFPVSLEFISFPPDEYKLLQEYLETMPQKELQARLYPWDVHRFKTGTA

📊 Sample Types

Isolate 4.3%
Metagenome 95.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 35.0%
Termitidae 30.0%
Unclassified 20.0%
Rhinotermitidae 7.5%
Termopsidae 7.5%

🌳 Taxonomy

Archaea 0
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
11 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
18 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
19 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
24 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
25 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
26 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
31 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
32 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
33 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
35 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
36 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
37 650716102 Treponema primitia ZAS-2 Isolate Unclassified
38 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
39 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
40 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
41 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
42 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_256033 3300042601 Bacteria 1210
2 Ga0466722_108537 3300042609 Bacteria 13976
3 Ga0466711_038973 3300042615 Bacteria 29172
4 Ga0466711_195513 3300042615 Bacteria 2296
5 Ga0466715_524989 3300042616 Bacteria 2947
6 Ga0466723_307869 3300042618 Bacteria 4870
7 Ga0415639_125666 3300038395 Bacteria 1190
8 Ga0466691_200294 3300042593 Bacteria 5662
9 Ga0466694_085565 3300042594 Bacteria 1249
10 Ga0466696_414443 3300042596 Bacteria 6316
11 Ga0466709_410668 3300042648 Bacteria 1297
12 Ga0466708_129363 3300042652 Bacteria 25678
13 Ga0466705_290748 3300042612 Bacteria 9050
14 Ga0466705_371823 3300042612 Bacteria 1325
15 Ga0466719_152400 3300042606 Bacteria 2524
16 Ga0466722_000120 3300042609 Bacteria 3665
17 Ga0466715_523869 3300042616 Bacteria 1834
18 Ga0466715_612908 3300042616 Bacteria 4170
19 Ga0466715_620484 3300042616 Bacteria 3631
20 Ga0466718_124315 3300042617 Bacteria 2121
21 Ga0466723_159008 3300042618 Bacteria 56322
22 Ga0466723_229569 3300042618 Bacteria 135891
23 Ga0466723_313185 3300042618 Bacteria 1185
24 Ga0466728_119528 3300042620 Bacteria 22681
25 Ga0466728_201997 3300042620 Bacteria 2419
26 Ga0466692_060044 3300042591 Bacteria 6044
27 Ga0466693_032365 3300042592 Bacteria 2780
28 Ga0466691_137378 3300042593 Bacteria 3325
29 Ga0466691_217877 3300042593 Bacteria 6079
30 Ga0466694_304214 3300042594 Bacteria 1126
31 Ga0466735_016615 3300042624 Bacteria 2013
32 Ga0466704_474733 3300042643 Bacteria 2901
33 AustNasuHG_c1013033 3300000089 Bacteria 2859
34 Ga0466707_301029 3300042601 Bacteria 7956
35 Ga0466716_096997 3300042605 Bacteria 3167
36 Ga0466719_106779 3300042606 Bacteria 10521
37 Ga0466705_414329 3300042612 Bacteria 10412
38 Ga0466715_015511 3300042616 Bacteria 3177
39 Ga0466715_152140 3300042616 Bacteria 2616
40 Ga0466726_128123 3300042619 Bacteria 1840
41 Ga0264413_159477 3300024493 Bacteria 1088
42 Ga0123357_10182739 3300009784 Bacteria 2442
43 Ga0466704_250379 3300042643 Bacteria 3965
44 Ga0466704_309115 3300042643 Bacteria 4577
45 Ga0466709_236114 3300042648 Bacteria 5884
46 Ga0466708_236116 3300042652 Bacteria 1776
47 Ga0466727_117731 3300042655 Bacteria 1896
48 AustNasuHG_c1001942 3300000089 Bacteria 7446
49 JGI24695J34938_10070567 3300002450 Bacteria 1461
50 Ga0466719_316739 3300042606 Bacteria 2922
51 Ga0466705_488157 3300042612 Bacteria 3513
52 Ga0466723_166933 3300042618 Bacteria 1052
53 Ga0466728_090418 3300042620 Bacteria 7669
54 Ga0466728_131555 3300042620 Bacteria 2813
55 Ga0466690_222531 3300042590 Bacteria 10767
56 Ga0466691_021546 3300042593 Bacteria 6091
57 Ga0466695_099873 3300042595 Bacteria 4687
58 Ga0466709_274018 3300042648 Bacteria 2402
59 Ga0466708_060309 3300042652 Bacteria 1812
60 JGI24705J35276_12227914 3300002504 Bacteria 3089
61 Ga0466707_266256 3300042601 Bacteria 2676
62 Ga0466707_326746 3300042601 Bacteria 1056
63 Ga0466713_126061 3300042602 Bacteria 5285
64 Ga0466719_271434 3300042606 Bacteria 2262
65 Ga0466711_376987 3300042615 Bacteria 1168
66 Ga0466715_054271 3300042616 Bacteria 9457
67 Ga0466715_121320 3300042616 Bacteria 10399
68 Ga0466715_137698 3300042616 Bacteria 1569
69 Ga0466715_156625 3300042616 Bacteria 2892
70 Ga0466715_228370 3300042616 Bacteria 4152
71 Ga0466715_518914 3300042616 Bacteria 2448
72 Ga0466694_069808 3300042594 Bacteria 7838
73 Ga0123357_10576460 3300009784 Bacteria 880
74 Ga0466704_130381 3300042643 Bacteria 5516
75 Ga0466704_354677 3300042643 Bacteria 30303
76 Ga0466704_433461 3300042643 Bacteria 3953
77 Ga0466709_201551 3300042648 Bacteria 5773
78 Ga0466709_291870 3300042648 Bacteria 15952
79 Ga0466709_305677 3300042648 Bacteria 1310
80 Ga0466708_156432 3300042652 Bacteria 1479
81 Ga0466727_330145 3300042655 Bacteria 1430
82 Ga0466705_261585 3300042612 Bacteria 9487
83 Ga0466719_332659 3300042606 Bacteria 2319
84 Ga0466719_459331 3300042606 Bacteria 11143
85 Ga0466722_054182 3300042609 Bacteria 2191
86 Ga0466722_237646 3300042609 Bacteria 1833
87 Ga0466705_396067 3300042612 Bacteria 1456
88 Ga0466715_006809 3300042616 Bacteria 5592
89 Ga0466726_431901 3300042619 Bacteria 1449
90 Ga0466728_324764 3300042620 Bacteria 1876
91 Ga0123357_10198356 3300009784 Bacteria 2292
92 Ga0123353_10306896 3300010167 Bacteria 2418
93 Ga0466729_259851 3300042621 Bacteria 2857
94 Ga0466704_475542 3300042643 Bacteria 1086
95 Ga0466708_047441 3300042652 Bacteria 3003
96 Ga0466708_096531 3300042652 Bacteria 1951
97 Ga0466705_124948 3300042612 Bacteria 1910
98 Ga0466707_032040 3300042601 Bacteria 2112
99 Ga0466707_095003 3300042601 Bacteria 2815
100 Ga0466719_140783 3300042606 Bacteria 2775
101 Ga0466719_311982 3300042606 Bacteria 4088
102 Ga0466705_459639 3300042612 Bacteria 8763
103 Ga0466711_341939 3300042615 Bacteria 29295
104 Ga0466718_060812 3300042617 Bacteria 2899
105 Ga0466723_050301 3300042618 Bacteria 15280
106 Ga0466726_035140 3300042619 Bacteria 13387
107 Ga0466690_306174 3300042590 Unclassified 1151
108 Ga0466696_050893 3300042596 Bacteria 3662
109 Ga0123357_10197792 3300009784 Bacteria 2297
110 Ga0466735_214883 3300042624 Bacteria 1252
111 Ga0466735_230763 3300042624 Bacteria 1936
112 Ga0466703_046184 3300042636 Bacteria 8350
113 Ga0466703_101873 3300042636 Bacteria 27649
114 Ga0466708_334651 3300042652 Bacteria 78030
115 Ga0072941_1290018 3300005201 Bacteria 1401
116 Ga0466705_123311 3300042612 Bacteria 5591
117 Ga0466707_055485 3300042601 Bacteria 1333
118 Ga0466719_003934 3300042606 Bacteria 3482
119 Ga0466720_053943 3300042607 Bacteria 2174
120 Ga0466722_075561 3300042609 Bacteria 3124
121 Ga0466711_334274 3300042615 Bacteria 18177
122 Ga0466726_340919 3300042619 Unclassified 1015
123 Ga0466728_067000 3300042620 Bacteria 10024
124 Ga0466692_107587 3300042591 Bacteria 1470
125 Ga0466694_297201 3300042594 Bacteria 4949
126 Ga0466696_012727 3300042596 Bacteria 6837
127 Ga0466696_415076 3300042596 Bacteria 5320
128 Ga0123353_10156616 3300010167 Bacteria 3630
129 Ga0123353_10728575 3300010167 Bacteria 1385
130 Ga0123354_10562712 3300010882 Bacteria 854
131 Ga0466709_107705 3300042648 Bacteria 11751
132 Ga0466708_006119 3300042652 Bacteria 8932
133 Ga0466708_075050 3300042652 Bacteria 1662
134 Ga0466708_146527 3300042652 Bacteria 7314

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042609 Ga0466722_237646 Ga0466722_237646_393_1031 212
2 3300042601 Ga0466707_095003 Ga0466707_095003_13_663 216
3 3300042591 Ga0466692_107587 Ga0466692_107587_645_1307 220
4 3300042606 Ga0466719_332659 Ga0466719_332659_647_1315 222
5 3300042643 Ga0466704_475542 Ga0466704_475542_41_718 225
6 3300042621 Ga0466729_259851 Ga0466729_259851_685_1389 234
7 iso_pr_bacteria 2781125690 2781428480 234
8 3300042594 Ga0466694_069808 Ga0466694_069808_919_1626 235
9 3300042636 Ga0466703_046184 Ga0466703_046184_714_1478 236
10 3300042612 Ga0466705_488157 Ga0466705_488157_421_1137 238
11 3300042591 Ga0466692_060044 Ga0466692_060044_2066_2785 239
12 3300042619 Ga0466726_035140 Ga0466726_035140_4912_5631 239
13 3300042615 Ga0466711_334274 Ga0466711_334274_14444_15166 240
14 3300042594 Ga0466694_085565 Ga0466694_085565_171_896 241
15 3300042648 Ga0466709_305677 Ga0466709_305677_401_1132 243
16 3300000089 AustNasuHG_c1013033 AustNasuHG_10130332 244
17 3300042593 Ga0466691_137378 Ga0466691_137378_1828_2562 244
18 3300042593 Ga0466691_217877 Ga0466691_217877_115_849 244
19 3300042596 Ga0466696_012727 Ga0466696_012727_4882_5616 244
20 3300042606 Ga0466719_140783 Ga0466719_140783_1361_2095 244
21 3300042606 Ga0466719_459331 Ga0466719_459331_1950_2684 244
22 3300042609 Ga0466722_108537 Ga0466722_108537_6616_7350 244
23 3300042612 Ga0466705_459639 Ga0466705_459639_690_1424 244
24 3300042618 Ga0466723_313185 Ga0466723_313185_220_954 244
25 3300042620 Ga0466728_324764 Ga0466728_324764_693_1427 244
26 3300042648 Ga0466709_236114 Ga0466709_236114_1171_1905 244
27 iso_pr_bacteria 2781125697 2781444205 244
28 3300010167 Ga0123353_10156616 Ga0123353_101566162 245
29 3300010882 Ga0123354_10562712 Ga0123354_105627121 245
30 3300024493 Ga0264413_159477 Ga0264413_1594772 245
31 3300042590 Ga0466690_306174 Ga0466690_306174_303_1040 245
32 3300042594 Ga0466694_297201 Ga0466694_297201_3412_4149 245
33 3300042602 Ga0466713_126061 Ga0466713_126061_1447_2184 245
34 3300042606 Ga0466719_152400 Ga0466719_152400_1575_2312 245
35 3300042615 Ga0466711_195513 Ga0466711_195513_369_1106 245
36 3300042615 Ga0466711_376987 Ga0466711_376987_44_781 245
37 3300042652 Ga0466708_146527 Ga0466708_146527_1915_2652 245
38 3300042655 Ga0466727_117731 Ga0466727_117731_326_1063 245
39 iso_pr_bacteria 2781125685 2781417814 245
40 iso_pr_bacteria 650716102 650882548 245
41 3300002504 JGI24705J35276_12227914 JGI24705J35276_122279144 246
42 3300009784 Ga0123357_10197792 Ga0123357_101977922 246
43 3300038395 Ga0415639_125666 Ga0415639_125666_173_913 246
44 3300042596 Ga0466696_414443 Ga0466696_414443_1788_2528 246
45 3300042615 Ga0466711_038973 Ga0466711_038973_11855_12595 246
46 3300042616 Ga0466715_156625 Ga0466715_156625_475_1215 246
47 3300042616 Ga0466715_523869 Ga0466715_523869_876_1616 246
48 3300042636 Ga0466703_101873 Ga0466703_101873_26288_27028 246
49 3300042648 Ga0466709_201551 Ga0466709_201551_4878_5618 246
50 3300042652 Ga0466708_096531 Ga0466708_096531_1106_1846 246
51 3300042601 Ga0466707_055485 Ga0466707_055485_44_787 247
52 3300042606 Ga0466719_003934 Ga0466719_003934_1855_2598 247
53 3300042612 Ga0466705_124948 Ga0466705_124948_863_1606 247
54 3300042617 Ga0466718_060812 Ga0466718_060812_1098_1841 247
55 3300042618 Ga0466723_166933 Ga0466723_166933_259_1002 247
56 3300042619 Ga0466726_128123 Ga0466726_128123_692_1435 247
57 3300042620 Ga0466728_131555 Ga0466728_131555_679_1422 247
58 3300042643 Ga0466704_250379 Ga0466704_250379_2269_3012 247
59 3300042652 Ga0466708_047441 Ga0466708_047441_1121_1864 247
60 3300002450 JGI24695J34938_10070567 JGI24695J34938_100705672 248
61 3300005201 Ga0072941_1290018 Ga0072941_12900182 248
62 3300042592 Ga0466693_032365 Ga0466693_032365_1892_2638 248
63 3300042594 Ga0466694_304214 Ga0466694_304214_71_817 248
64 3300042596 Ga0466696_050893 Ga0466696_050893_1307_2053 248
65 3300042606 Ga0466719_271434 Ga0466719_271434_1465_2211 248
66 3300042612 Ga0466705_123311 Ga0466705_123311_3269_4015 248
67 3300042612 Ga0466705_290748 Ga0466705_290748_3404_4150 248
68 3300042616 Ga0466715_121320 Ga0466715_121320_8696_9442 248
69 3300042616 Ga0466715_518914 Ga0466715_518914_1399_2145 248
70 3300042618 Ga0466723_229569 Ga0466723_229569_29136_29882 248
71 3300042624 Ga0466735_214883 Ga0466735_214883_333_1079 248
72 3300042643 Ga0466704_354677 Ga0466704_354677_12823_13569 248
73 3300042648 Ga0466709_291870 Ga0466709_291870_834_1580 248
74 3300009784 Ga0123357_10182739 Ga0123357_101827393 249
75 3300010167 Ga0123353_10306896 Ga0123353_103068962 249
76 3300042601 Ga0466707_266256 Ga0466707_266256_598_1347 249
77 3300042606 Ga0466719_316739 Ga0466719_316739_755_1504 249
78 3300042615 Ga0466711_341939 Ga0466711_341939_534_1283 249
79 3300042616 Ga0466715_137698 Ga0466715_137698_33_782 249
80 iso_pr_bacteria 2781125666 2781342867 249
81 3300000089 AustNasuHG_c1001942 AustNasuHG_10019424 250
82 3300042601 Ga0466707_301029 Ga0466707_301029_7128_7880 250
83 3300042612 Ga0466705_371823 Ga0466705_371823_385_1137 250
84 3300042616 Ga0466715_015511 Ga0466715_015511_1876_2628 250
85 3300042620 Ga0466728_119528 Ga0466728_119528_18898_19650 250
86 3300042624 Ga0466735_016615 Ga0466735_016615_349_1101 250
87 3300010167 Ga0123353_10728575 Ga0123353_107285752 251
88 3300042590 Ga0466690_222531 Ga0466690_222531_5617_6372 251
89 3300042607 Ga0466720_053943 Ga0466720_053943_645_1400 251
90 3300042616 Ga0466715_054271 Ga0466715_054271_3262_4017 251
91 3300042617 Ga0466718_124315 Ga0466718_124315_1061_1816 251
92 3300042618 Ga0466723_307869 Ga0466723_307869_1243_1998 251
93 3300042619 Ga0466726_431901 Ga0466726_431901_482_1237 251
94 3300042643 Ga0466704_433461 Ga0466704_433461_2803_3558 251
95 3300042593 Ga0466691_200294 Ga0466691_200294_4754_5512 252
96 3300042595 Ga0466695_099873 Ga0466695_099873_3489_4247 252
97 3300042601 Ga0466707_032040 Ga0466707_032040_1070_1828 252
98 3300042605 Ga0466716_096997 Ga0466716_096997_1196_1954 252
99 3300042606 Ga0466719_106779 Ga0466719_106779_6477_7235 252
100 3300042606 Ga0466719_311982 Ga0466719_311982_2416_3174 252
101 3300042612 Ga0466705_396067 Ga0466705_396067_304_1062 252
102 3300042616 Ga0466715_006809 Ga0466715_006809_911_1669 252
103 3300042616 Ga0466715_152140 Ga0466715_152140_566_1324 252
104 3300042616 Ga0466715_524989 Ga0466715_524989_2011_2769 252
105 3300042618 Ga0466723_050301 Ga0466723_050301_3884_4642 252
106 3300042620 Ga0466728_201997 Ga0466728_201997_580_1338 252
107 3300042624 Ga0466735_230763 Ga0466735_230763_783_1541 252
108 3300042643 Ga0466704_130381 Ga0466704_130381_125_883 252
109 3300042643 Ga0466704_474733 Ga0466704_474733_245_1003 252
110 3300042648 Ga0466709_107705 Ga0466709_107705_482_1240 252
111 3300042652 Ga0466708_060309 Ga0466708_060309_151_909 252
112 3300042652 Ga0466708_075050 Ga0466708_075050_692_1450 252
113 3300042652 Ga0466708_129363 Ga0466708_129363_9315_10073 252
114 3300042652 Ga0466708_156432 Ga0466708_156432_334_1092 252
115 3300042601 Ga0466707_326746 Ga0466707_326746_158_919 253
116 3300042609 Ga0466722_075561 Ga0466722_075561_1278_2039 253
117 3300042612 Ga0466705_414329 Ga0466705_414329_5309_6070 253
118 3300042616 Ga0466715_620484 Ga0466715_620484_899_1660 253
119 3300042619 Ga0466726_340919 Ga0466726_340919_86_847 253
120 3300042643 Ga0466704_309115 Ga0466704_309115_1258_2019 253
121 3300042652 Ga0466708_006119 Ga0466708_006119_264_1025 253
122 3300042652 Ga0466708_334651 Ga0466708_334651_5104_5865 253
123 3300009784 Ga0123357_10576460 Ga0123357_105764601 254
124 3300042596 Ga0466696_415076 Ga0466696_415076_1498_2262 254
125 3300042601 Ga0466707_256033 Ga0466707_256033_372_1136 254
126 3300042648 Ga0466709_274018 Ga0466709_274018_1040_1804 254
127 3300042609 Ga0466722_054182 Ga0466722_054182_73_840 255
128 3300042616 Ga0466715_228370 Ga0466715_228370_2166_2936 256
129 3300042655 Ga0466727_330145 Ga0466727_330145_523_1293 256
130 3300042652 Ga0466708_236116 Ga0466708_236116_644_1417 257
131 iso_pr_bacteria 650716099 650879500 257
132 3300009784 Ga0123357_10198356 Ga0123357_101983562 258
133 3300042593 Ga0466691_021546 Ga0466691_021546_5062_5841 259
134 3300042609 Ga0466722_000120 Ga0466722_000120_1735_2517 260
135 3300042620 Ga0466728_090418 Ga0466728_090418_773_1555 260
136 3300042618 Ga0466723_159008 Ga0466723_159008_31488_32273 261
137 3300042620 Ga0466728_067000 Ga0466728_067000_8845_9630 261
138 3300042612 Ga0466705_261585 Ga0466705_261585_1390_2178 262
139 3300042648 Ga0466709_410668 Ga0466709_410668_147_935 262
140 3300042616 Ga0466715_612908 Ga0466715_612908_2069_2863 264

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.56 0.58 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.