Protein Family IF05912

Metagenome Isolate
126 Members
51 Samples
108 Scaffolds
283.65 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_235805|Ga0466707_235805_2944_3924
Length
326 aa
Sequence
LELRHKNTKIVQGIGKNKIIILSLQDFNKQIPKKMDNKTTKFDGSQIVLYQPDAVLQLEVRVENETVWLSQMQMATLFQTTRNNITMHIGNVFAEKELEEKSVRKDSLHTASDGKKYKTKYYNLDVIISVGYRVKSQRGTQFRIWANQVLKDYLLKGYAINQRIERLEKHAIETNRRIEMHENKIDFFVKMALPPIEGIFYDGQIFDAYAFVADLIKSAKTSIVLIDNYVDESVLLLLSKRKKDVNATIYTAYISDQLNLDLKKHNAQYPTIEIKQFTKSHDRFLIIDDVVYHIGASLKDLGKKWFAFSKMEIKGAFIMTSLLLNK

📊 Sample Types

Isolate 13.5%
Metagenome 86.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.2%
Unclassified 29.4%
Kalotermitidae 17.6%
Termopsidae 5.9%
Rhinotermitidae 3.9%
Blattidae 2.0%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 121
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
2 2778260936 Unclassified Fibrobacteres Co191P3bin13 Isolate Unclassified
3 2820719201 Unclassified Fibrobacteres Lab288P3bin119 Isolate Unclassified
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2778260935 Unclassified Fibrobacteres Co191P1bin79 Isolate Unclassified
11 2778260938 Unclassified Fibrobacteres Co191P3bin71 Isolate Unclassified
12 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
15 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
22 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
23 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
24 2778260940 Unclassified Fibrobacteres Mp193P3bin36 Isolate Unclassified
25 650716102 Treponema primitia ZAS-2 Isolate Unclassified
26 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
27 3004672520 Bacteroides sp. 51 Isolate Blattidae
28 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
29 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
30 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
31 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 2773857778 Unclassified Fibrobacteres Co191P1bin56 Isolate Unclassified
34 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
35 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
36 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
37 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
38 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
39 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
40 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
41 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
42 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
43 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
44 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
45 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
46 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
47 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
48 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
49 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
50 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
51 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24695J34938_10004784 3300002450 Bacteria 8715
2 Ga0068302_10000031 3300005071 Bacteria 1648
3 Ga0466711_125740 3300042615 Bacteria 1672
4 Ga0123355_10000106 3300009826 Bacteria 92457
5 Ga0123356_10003354 3300010049 Bacteria 16814
6 Ga0123353_10957482 3300010167 Bacteria 1157
7 Ga0123354_10310370 3300010882 Bacteria 1474
8 Ga0466735_092936 3300042624 Bacteria 6469
9 Ga0466703_226114 3300042636 Bacteria 10239
10 Ga0466656_285501 3300042550 Bacteria 1507
11 Ga0466694_051269 3300042594 Bacteria 3152
12 Ga0466705_117748 3300042612 Bacteria 2197
13 Ga0466714_015498 3300042603 Bacteria 1466
14 Ga0466719_358809 3300042606 Bacteria 1153
15 Ga0123357_10037335 3300009784 Bacteria 6612
16 Ga0123353_10080347 3300010167 Bacteria 5243
17 Ga0466735_089588 3300042624 Bacteria 2045
18 Ga0466735_115475 3300042624 Bacteria 1987
19 Ga0466657_165900 3300042582 Bacteria 2402
20 Ga0466691_017102 3300042593 Unclassified 1748
21 Ga0466733_184903 3300042659 Bacteria 1498
22 Ga0466717_068164 3300042604 Bacteria 3749
23 JGI24698J34947_10007864 3300002449 Bacteria 5854
24 JGI24695J34938_10061697 3300002450 Bacteria 1595
25 Ga0123355_10402639 3300009826 Bacteria 1764
26 Ga0123353_10344218 3300010167 Bacteria 2250
27 Ga0123353_10588818 3300010167 Bacteria 1593
28 Ga0466735_161789 3300042624 Bacteria 2390
29 Ga0466691_031819 3300042593 Bacteria 14874
30 Ga0466694_233171 3300042594 Bacteria 2362
31 Ga0466707_177487 3300042601 Bacteria 8579
32 Ga0466707_235805 3300042601 Bacteria 4983
33 Ga0466707_240944 3300042601 Bacteria 1020
34 Ga0466707_354209 3300042601 Bacteria 6270
35 Ga0123355_10001907 3300009826 Bacteria 29322
36 Ga0123356_10291997 3300010049 Bacteria 1731
37 Ga0123353_10204665 3300010167 Bacteria 3102
38 Ga0466735_148823 3300042624 Bacteria 1603
39 Ga0466703_033104 3300042636 Bacteria 1937
40 Ga0466703_146763 3300042636 Bacteria 7913
41 Ga0466704_107812 3300042643 Bacteria 5524
42 Ga0466704_393013 3300042643 Bacteria 2000
43 Ga0415639_042565 3300038395 Bacteria 1560
44 Ga0466691_075601 3300042593 Bacteria 4360
45 Ga0466707_078271 3300042601 Bacteria 19341
46 Ga0123357_10001250 3300009784 Bacteria 26711
47 Ga0466715_029251 3300042616 Bacteria 4961
48 Ga0123355_10000263 3300009826 Bacteria 67357
49 Ga0123353_10077503 3300010167 Bacteria 5341
50 Ga0123354_10148154 3300010882 Bacteria 2860
51 Ga0466703_266950 3300042636 Bacteria 1336
52 Ga0466704_220182 3300042643 Bacteria 5863
53 Ga0466725_436731 3300042654 Bacteria 1744
54 Ga0466656_238420 3300042550 Bacteria 2973
55 Ga0466693_059436 3300042592 Bacteria 2052
56 Ga0466691_141135 3300042593 Bacteria 4270
57 Ga0466694_168502 3300042594 Bacteria 4379
58 Ga0466705_022721 3300042612 Bacteria 3099
59 Ga0466707_074553 3300042601 Bacteria 10604
60 Ga0466707_183334 3300042601 Bacteria 1397
61 Ga0466707_346505 3300042601 Bacteria 1524
62 Ga0466716_265570 3300042605 Bacteria 2994
63 JGI24702J35022_10007916 3300002462 Bacteria 6050
64 JGI24699J35502_11134184 3300002509 Bacteria 47712
65 Ga0466711_175299 3300042615 Bacteria 29148
66 Ga0466711_268980 3300042615 Bacteria 10316
67 Ga0466711_282878 3300042615 Bacteria 1893
68 Ga0123356_10482461 3300010049 Bacteria 1393
69 Ga0123353_10429264 3300010167 Bacteria 1955
70 Ga0123354_10261089 3300010882 Bacteria 1729
71 Ga0466703_362102 3300042636 Bacteria 5254
72 Ga0466656_356327 3300042550 Bacteria 1965
73 Ga0466657_011776 3300042582 Bacteria 3359
74 Ga0466694_041025 3300042594 Bacteria 2826
75 Ga0466705_178173 3300042612 Bacteria 18747
76 Ga0466707_375900 3300042601 Bacteria 2197
77 Ga0466707_403664 3300042601 Bacteria 44626
78 Ga0466721_160705 3300042608 Unclassified 1236
79 Ga0466721_368720 3300042608 Bacteria 9571
80 Ga0466722_118900 3300042609 Bacteria 1856
81 Ga0466705_432211 3300042612 Bacteria 2647
82 Ga0123357_10092087 3300009784 Bacteria 3945
83 Ga0123355_10001154 3300009826 Bacteria 36615
84 Ga0123353_10001789 3300010167 Unclassified 26417
85 Ga0123353_10281455 3300010167 Bacteria 2554
86 Ga0466729_313877 3300042621 Bacteria 1351
87 Ga0466704_571559 3300042643 Bacteria 1064
88 Ga0466727_294858 3300042655 Bacteria 5510
89 Ga0466690_037046 3300042590 Bacteria 5448
90 Ga0466691_023019 3300042593 Bacteria 12671
91 Ga0466706_039623 3300042599 Bacteria 3288
92 Ga0466706_041479 3300042599 Bacteria 4369
93 Ga0466707_402186 3300042601 Bacteria 60568
94 JGI24695J34938_10000514 3300002450 Unclassified 37726
95 JGI24695J34938_10002169 3300002450 Unclassified 15316
96 Ga0466705_402062 3300042612 Bacteria 2006
97 Ga0123356_10004217 3300010049 Bacteria 14867
98 Ga0123356_10374561 3300010049 Bacteria 1554
99 Ga0123356_10484348 3300010049 Bacteria 1391
100 Ga0466735_020881 3300042624 Bacteria 1151
101 Ga0466724_69176 3300042649 Bacteria 3001
102 Ga0466727_180220 3300042655 Bacteria 1265
103 Ga0466693_394751 3300042592 Bacteria 1284
104 Ga0466705_040655 3300042612 Bacteria 10984
105 Ga0466733_199822 3300042659 Bacteria 1972
106 Ga0466707_202638 3300042601 Bacteria 1441
107 Ga0466707_242556 3300042601 Bacteria 3304
108 Ga0466707_280524 3300042601 Bacteria 3101

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_10484348 Ga0123356_104843483 238
2 3300042612 Ga0466705_117748 Ga0466705_117748_1070_1858 262
3 3300042550 Ga0466656_356327 Ga0466656_356327_728_1579 263
4 3300042643 Ga0466704_571559 Ga0466704_571559_14_826 264
5 3300042636 Ga0466703_266950 Ga0466703_266950_219_1019 266
6 3300009784 Ga0123357_10092087 Ga0123357_100920873 269
7 3300042605 Ga0466716_265570 Ga0466716_265570_739_1677 269
8 iso_pr_bacteria 2820746860 2820748017 269
9 3300042582 Ga0466657_011776 Ga0466657_011776_85_927 270
10 3300042624 Ga0466735_161789 Ga0466735_161789_1487_2356 270
11 iso_pr_bacteria 2820746860 2820748046 272
12 3300009784 Ga0123357_10037335 Ga0123357_100373356 274
13 3300010167 Ga0123353_10588818 Ga0123353_105888182 274
14 3300010882 Ga0123354_10148154 Ga0123354_101481542 274
15 3300042594 Ga0466694_041025 Ga0466694_041025_363_1223 274
16 3300042601 Ga0466707_240944 Ga0466707_240944_62_886 274
17 3300042606 Ga0466719_358809 Ga0466719_358809_128_952 274
18 3300042612 Ga0466705_022721 Ga0466705_022721_252_1076 274
19 3300009784 Ga0123357_10001250 Ga0123357_1000125015 275
20 3300042621 Ga0466729_313877 Ga0466729_313877_318_1199 275
21 3300010167 Ga0123353_10344218 Ga0123353_103442182 276
22 3300042604 Ga0466717_068164 Ga0466717_068164_1189_2052 276
23 3300009826 Ga0123355_10001154 Ga0123355_100011549 277
24 3300042582 Ga0466657_011776 Ga0466657_011776_986_1819 277
25 3300042594 Ga0466694_051269 Ga0466694_051269_1436_2269 277
26 3300042601 Ga0466707_078271 Ga0466707_078271_17719_18552 277
27 3300042624 Ga0466735_092936 Ga0466735_092936_2968_3801 277
28 3300010049 Ga0123356_10482461 Ga0123356_104824611 278
29 3300042594 Ga0466694_233171 Ga0466694_233171_556_1392 278
30 3300042601 Ga0466707_354209 Ga0466707_354209_977_1813 278
31 3300042636 Ga0466703_226114 Ga0466703_226114_9100_10005 278
32 3300042655 Ga0466727_294858 Ga0466727_294858_561_1433 278
33 3300042659 Ga0466733_184903 Ga0466733_184903_220_1116 278
34 iso_pr_bacteria 2820788205 2820789506 278
35 3300002450 JGI24695J34938_10002169 JGI24695J34938_100021692 279
36 3300009826 Ga0123355_10001907 Ga0123355_1000190723 279
37 3300042592 Ga0466693_059436 Ga0466693_059436_339_1208 279
38 3300042601 Ga0466707_403664 Ga0466707_403664_26800_27639 279
39 iso_pr_bacteria 2778260940 2778357522 279
40 3300002449 JGI24698J34947_10007864 JGI24698J34947_100078647 280
41 3300042590 Ga0466690_037046 Ga0466690_037046_108_950 280
42 3300042593 Ga0466691_031819 Ga0466691_031819_12485_13375 280
43 3300042599 Ga0466706_041479 Ga0466706_041479_692_1534 280
44 iso_pr_bacteria 2820795054 2820795358 280
45 3300042612 Ga0466705_432211 Ga0466705_432211_613_1497 281
46 3300002450 JGI24695J34938_10061697 JGI24695J34938_100616972 282
47 3300010167 Ga0123353_10957482 Ga0123353_109574821 282
48 3300042550 Ga0466656_285501 Ga0466656_285501_478_1326 282
49 3300042593 Ga0466691_023019 Ga0466691_023019_4624_5472 282
50 3300042601 Ga0466707_402186 Ga0466707_402186_1806_2792 282
51 3300042659 Ga0466733_199822 Ga0466733_199822_421_1269 282
52 3300042609 Ga0466722_118900 Ga0466722_118900_919_1770 283
53 3300042612 Ga0466705_040655 Ga0466705_040655_6493_7344 283
54 3300042643 Ga0466704_393013 Ga0466704_393013_927_1778 283
55 3300010049 Ga0123356_10374561 Ga0123356_103745613 284
56 3300010167 Ga0123353_10077503 Ga0123353_100775031 284
57 3300010882 Ga0123354_10261089 Ga0123354_102610891 284
58 3300042594 Ga0466694_168502 Ga0466694_168502_1727_2581 284
59 3300042601 Ga0466707_202638 Ga0466707_202638_224_1078 284
60 3300042601 Ga0466707_346505 Ga0466707_346505_282_1136 284
61 3300042636 Ga0466703_033104 Ga0466703_033104_97_1002 284
62 3300042636 Ga0466703_146763 Ga0466703_146763_2530_3420 284
63 3300042643 Ga0466704_220182 Ga0466704_220182_1101_1979 284
64 3300042649 Ga0466724_69176 Ga0466724_69176_609_1463 284
65 3300042654 Ga0466725_436731 Ga0466725_436731_712_1566 284
66 iso_pr_bacteria 2820661146 2820663242 284
67 iso_pr_bacteria 2820690275 2820692280 284
68 3300002450 JGI24695J34938_10004784 JGI24695J34938_100047841 285
69 3300005071 Ga0068302_10000031 Ga0068302_100000312 285
70 3300009826 Ga0123355_10000106 Ga0123355_1000010635 285
71 3300009826 Ga0123355_10402639 Ga0123355_104026392 285
72 3300010049 Ga0123356_10004217 Ga0123356_100042176 285
73 3300042601 Ga0466707_177487 Ga0466707_177487_115_972 285
74 3300042615 Ga0466711_282878 Ga0466711_282878_788_1696 285
75 iso_pr_bacteria 2820737921 2820738942 285
76 iso_pr_bacteria 2820737921 2820739216 285
77 3300002462 JGI24702J35022_10007916 JGI24702J35022_100079161 286
78 3300042550 Ga0466656_238420 Ga0466656_238420_1002_1880 286
79 3300042624 Ga0466735_115475 Ga0466735_115475_31_891 286
80 3300042624 Ga0466735_148823 Ga0466735_148823_222_1082 286
81 3300042655 Ga0466727_180220 Ga0466727_180220_22_882 286
82 3300038395 Ga0415639_042565 Ga0415639_042565_31_894 287
83 3300042592 Ga0466693_394751 Ga0466693_394751_386_1249 287
84 3300042601 Ga0466707_280524 Ga0466707_280524_1679_2542 287
85 iso_pr_bacteria 2778260935 2778343883 287
86 iso_pr_bacteria 2778260938 2778350445 287
87 3300002450 JGI24695J34938_10000514 JGI24695J34938_1000051429 288
88 3300010167 Ga0123353_10281455 Ga0123353_102814553 288
89 3300042601 Ga0466707_074553 Ga0466707_074553_377_1243 288
90 3300042601 Ga0466707_375900 Ga0466707_375900_244_1110 288
91 3300042624 Ga0466735_089588 Ga0466735_089588_1025_1891 288
92 iso_pr_bacteria 2773857778 2774476731 288
93 iso_pr_bacteria 2778260936 2778346799 288
94 3300042593 Ga0466691_141135 Ga0466691_141135_1491_2360 289
95 3300042615 Ga0466711_175299 Ga0466711_175299_4350_5219 289
96 3300042615 Ga0466711_268980 Ga0466711_268980_315_1184 289
97 3300042599 Ga0466706_039623 Ga0466706_039623_1804_2676 290
98 3300042601 Ga0466707_183334 Ga0466707_183334_165_1037 290
99 3300042608 Ga0466721_160705 Ga0466721_160705_158_1030 290
100 iso_pr_bacteria 2820759988 2820762142 290
101 iso_pr_bacteria 3004672520 3004676761 290
102 3300002509 JGI24699J35502_11134184 JGI24699J35502_111341843 291
103 3300010049 Ga0123356_10003354 Ga0123356_100033548 291
104 3300010049 Ga0123356_10291997 Ga0123356_102919973 291
105 3300010167 Ga0123353_10080347 Ga0123353_100803474 291
106 3300010167 Ga0123353_10429264 Ga0123353_104292641 291
107 3300010882 Ga0123354_10310370 Ga0123354_103103702 291
108 3300042582 Ga0466657_165900 Ga0466657_165900_1354_2229 291
109 3300042603 Ga0466714_015498 Ga0466714_015498_371_1246 291
110 3300042608 Ga0466721_368720 Ga0466721_368720_8179_9054 291
111 3300042612 Ga0466705_178173 Ga0466705_178173_17359_18234 291
112 iso_pr_bacteria 650716102 650882492 291
113 3300042593 Ga0466691_017102 Ga0466691_017102_383_1330 292
114 3300042593 Ga0466691_075601 Ga0466691_075601_2671_3549 292
115 3300042643 Ga0466704_107812 Ga0466704_107812_2154_3053 292
116 3300042612 Ga0466705_402062 Ga0466705_402062_824_1732 293
117 3300042616 Ga0466715_029251 Ga0466715_029251_1217_2098 293
118 3300042624 Ga0466735_020881 Ga0466735_020881_47_931 294
119 3300009826 Ga0123355_10000263 Ga0123355_1000026328 296
120 3300010167 Ga0123353_10204665 Ga0123353_102046653 296
121 iso_pr_bacteria 2820719201 2820720240 297
122 3300010167 Ga0123353_10001789 Ga0123353_100017899 298
123 3300042636 Ga0466703_362102 Ga0466703_362102_3972_4874 300
124 3300042601 Ga0466707_242556 Ga0466707_242556_109_1029 306
125 3300042601 Ga0466707_235805 Ga0466707_235805_2944_3924 326
126 3300042615 Ga0466711_125740 Ga0466711_125740_299_1288 329

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13310 Virulence_RhuM Virulence protein RhuM family 103 175 0.8

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
7v55-assembly1.cif.gz_A Crystal structure of phospholipase D from Pseudomonas aeruginosa PAO1 using in situ proteolysis 0.752 197 298
6ohp-assembly3.cif.gz_C Structure of compound 1 (halopemide) bound human Phospholipase D2 catalytic domain 0.724 196 298
6ohp-assembly2.cif.gz_B Structure of compound 1 (halopemide) bound human Phospholipase D2 catalytic domain 0.723 197 298
6ohs-assembly4.cif.gz_D Structure of compound 3 (ML299) bound human Phospholipase D2 catalytic domain 0.722 196 298
6ohp-assembly1.cif.gz_A Structure of compound 1 (halopemide) bound human Phospholipase D2 catalytic domain 0.72 197 298
IDDescriptionScoreStartEndSuperfamily
af_A3KPE8_315_409_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7907 104 124 3.30.70.330
af_Q18891_10_143_3.40.50.2060 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Sec1/Munc18 (SM) protein, domain 1 0.7628 232 278 3.40.50.2060
af_A4QP72_117_300_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.7246 196 324 3.30.870.10
af_Q2FWG8_323_468_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.7075 202 325 3.30.870.10
af_A0A0P0VJM3_1_103_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.6948 104 123 3.30.200.20
IDDescriptionScoreStartEndGO Terms
AF-A0A378NEC1-F1-model_v4 DNA-binding protein 0.9749 197 326
AF-A0A1F8UHX2-F1-model_v4 Uncharacterized/unreviewed 0.9748 56 133

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.43 0.52 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.