Protein Family IF05910
Metagenome
Isolate
241
Members
94
Samples
201
Scaffolds
347.78
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_228633|Ga0466707_228633_56000_57274
- Length
- 415 aa
- Sequence
- MIESYADKNKQKNDDFSVDDLDDFGNPITDEVGGSFGTHVRMLSPDKESLDFEDTSHDYALRPKRLVDYIGQESVTDNLQVFIEAAKLRGEPLDHVLFYGPPGLGKTTLAGIIAQELGVEIRITSGPAIERAGDLASILTNLSEGDVLFIDEIHRLNRSAEEILYSAMEDFELDMIIGKGPSAKSYRIPLPKFTMIGATTRAGSLSAPLRDRFGVMCKFELYSEDALKSIIARTASLLDAPIDDASLLELASRSRGTPRIANRLLKRVRDFAQVKSDGSIGLDIAKSTLDSLGIDGIGLEKVDRDILKLIIEKFLGGPVGIDTISAAIGEERITIEDVYEPYLLQKGLIHRTPKGRIASQDAYIHLGLEDLLRTSRAYGGASSSDLANVKGSGFEINDGELIIDRGTQISIYDEE
Sample Types
Isolate
16.6%
Metagenome
83.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
34.5%
Termitidae
25.3%
Kalotermitidae
13.8%
Armadillidiidae
3.4%
Drosophilidae
3.4%
Rhinotermitidae
3.4%
Formicidae
2.3%
Passalidae
2.3%
Termopsidae
2.3%
Tenebrionidae
2.3%
Hydrophilidae
1.1%
Scarabaeidae
1.1%
Culicidae
1.1%
Apidae
1.1%
Hodotermitidae
1.1%
Bombycidae
1.1%
Taxonomy
Archaea
0
Bacteria
232
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 2 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 3 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 6 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 7 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 10 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 14 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 15 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 21 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 22 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 23 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 24 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 25 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 26 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 27 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 28 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 29 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 30 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 31 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 32 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 33 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 34 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 35 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 36 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 37 | 2820497731 | Unclassified Firmicutes Lab288P1bin55 | Isolate | Unclassified |
| 38 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 39 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 45 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 46 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 47 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 48 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 49 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 50 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 51 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 52 | 2820537337 | Unclassified Firmicutes Lab288P1bin137 | Isolate | Unclassified |
| 53 | 2820606014 | Unclassified Firmicutes Emb289P1bin49 | Isolate | Unclassified |
| 54 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 55 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 56 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 57 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 58 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 59 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 60 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 61 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 62 | 2820466401 | Unclassified Firmicutes Lab288P3bin111 | Isolate | Unclassified |
| 63 | 2820709481 | Unclassified Firmicutes Co191P1bin30 | Isolate | Unclassified |
| 64 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 65 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 66 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 67 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 68 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 69 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 70 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 71 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 72 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 73 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 74 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 75 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 76 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 77 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 78 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 79 | 2820296961 | Unclassified Firmicutes Th196P3bin102 | Isolate | Unclassified |
| 80 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 81 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 82 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 83 | 2820711732 | Unclassified Firmicutes Co191P1bin26 | Isolate | Unclassified |
| 84 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 85 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 86 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 87 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 88 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 89 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 90 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 91 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 92 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 93 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 94 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_098730 | 3300042615 | Bacteria | 8349 |
| 2 | Ga0123355_10039120 | 3300009826 | Bacteria | 7714 |
| 3 | Ga0123355_10264988 | 3300009826 | Bacteria | 2397 |
| 4 | Ga0123355_10303706 | 3300009826 | Bacteria | 2172 |
| 5 | Ga0123356_10027462 | 3300010049 | Bacteria | 5333 |
| 6 | Ga0123356_10185605 | 3300010049 | Bacteria | 2106 |
| 7 | Ga0123353_10052866 | 3300010167 | Bacteria | 6490 |
| 8 | Ga0123353_10106375 | 3300010167 | Bacteria | 4520 |
| 9 | Ga0123353_10150857 | 3300010167 | Bacteria | 3711 |
| 10 | Ga0123353_10355765 | 3300010167 | Bacteria | 2203 |
| 11 | Ga0160454_100023 | 3300012798 | Bacteria | 304777 |
| 12 | Ga0466707_375914 | 3300042601 | Bacteria | 14333 |
| 13 | Ga0466713_053492 | 3300042602 | Bacteria | 12914 |
| 14 | Ga0466713_095410 | 3300042602 | Bacteria | 56118 |
| 15 | Ga0466729_269933 | 3300042621 | Bacteria | 2016 |
| 16 | Ga0466704_038894 | 3300042643 | Bacteria | 5146 |
| 17 | Ga0160458_100179 | 3300012832 | Unclassified | 49781 |
| 18 | Ga0415639_004917 | 3300038395 | Bacteria | 26720 |
| 19 | Ga0466705_271926 | 3300042612 | Bacteria | 148499 |
| 20 | Ga0466715_589871 | 3300042616 | Bacteria | 16320 |
| 21 | 2227501038 | 2225789004 | Bacteria | 3798 |
| 22 | Ga0104045_1074423 | 3300007085 | Bacteria | 3279 |
| 23 | Ga0104048_1002375 | 3300007143 | Bacteria | 9067 |
| 24 | Ga0123357_10181277 | 3300009784 | Bacteria | 2458 |
| 25 | Ga0123357_10184460 | 3300009784 | Bacteria | 2425 |
| 26 | Ga0123356_10045384 | 3300010049 | Bacteria | 4089 |
| 27 | Ga0123356_10183383 | 3300010049 | Bacteria | 2117 |
| 28 | Ga0123356_10298961 | 3300010049 | Bacteria | 1714 |
| 29 | Ga0123356_10341777 | 3300010049 | Bacteria | 1617 |
| 30 | Ga0123356_10401897 | 3300010049 | Bacteria | 1508 |
| 31 | Ga0123353_10000056 | 3300010167 | Bacteria | 127423 |
| 32 | Ga0466707_202459 | 3300042601 | Bacteria | 205011 |
| 33 | Ga0466707_228633 | 3300042601 | Bacteria | 65594 |
| 34 | Ga0466713_009411 | 3300042602 | Bacteria | 34425 |
| 35 | Ga0466713_084078 | 3300042602 | Bacteria | 6249 |
| 36 | Ga0466719_198652 | 3300042606 | Bacteria | 3658 |
| 37 | Ga0466704_183110 | 3300042643 | Unclassified | 15584 |
| 38 | Ga0466724_48085 | 3300042649 | Bacteria | 9642 |
| 39 | Ga0466708_282915 | 3300042652 | Bacteria | 14159 |
| 40 | Ga0466725_372654 | 3300042654 | Bacteria | 18397 |
| 41 | Ga0264413_105678 | 3300024493 | Bacteria | 11183 |
| 42 | Ga0415639_047196 | 3300038395 | Bacteria | 16338 |
| 43 | Ga0466705_381475 | 3300042612 | Bacteria | 18732 |
| 44 | 2227480187 | 2225789004 | Bacteria | 78142 |
| 45 | JGI24695J34938_10000359 | 3300002450 | Bacteria | 45052 |
| 46 | Ga0123355_10004203 | 3300009826 | Bacteria | 20921 |
| 47 | Ga0123355_10030491 | 3300009826 | Bacteria | 8739 |
| 48 | Ga0123356_10020054 | 3300010049 | Bacteria | 6331 |
| 49 | Ga0123356_10029730 | 3300010049 | Bacteria | 5115 |
| 50 | Ga0123356_10031761 | 3300010049 | Bacteria | 4942 |
| 51 | Ga0123356_10033612 | 3300010049 | Bacteria | 4795 |
| 52 | Ga0123356_10105676 | 3300010049 | Bacteria | 2709 |
| 53 | Ga0123356_10115742 | 3300010049 | Bacteria | 2598 |
| 54 | Ga0123353_10009874 | 3300010167 | Bacteria | 13233 |
| 55 | Ga0123353_10021511 | 3300010167 | Bacteria | 9684 |
| 56 | Ga0123353_10163185 | 3300010167 | Unclassified | 3545 |
| 57 | Ga0123353_10166514 | 3300010167 | Bacteria | 3503 |
| 58 | Ga0123353_10191820 | 3300010167 | Bacteria | 3224 |
| 59 | Ga0123354_10136832 | 3300010882 | Bacteria | 3057 |
| 60 | Ga0466701_072917 | 3300042598 | Bacteria | 3995 |
| 61 | Ga0466707_041872 | 3300042601 | Bacteria | 7587 |
| 62 | Ga0466707_135212 | 3300042601 | Bacteria | 4570 |
| 63 | Ga0466707_193078 | 3300042601 | Unclassified | 16060 |
| 64 | Ga0466713_017636 | 3300042602 | Bacteria | 3972 |
| 65 | Ga0466714_117080 | 3300042603 | Bacteria | 1705 |
| 66 | Ga0466719_358226 | 3300042606 | Bacteria | 6104 |
| 67 | Ga0466703_028031 | 3300042636 | Bacteria | 4134 |
| 68 | Ga0466703_170876 | 3300042636 | Bacteria | 15506 |
| 69 | Ga0466724_61407 | 3300042649 | Bacteria | 12825 |
| 70 | Ga0466708_012099 | 3300042652 | Bacteria | 3374 |
| 71 | Ga0466725_042126 | 3300042654 | Bacteria | 2674 |
| 72 | Ga0415639_015925 | 3300038395 | Bacteria | 8338 |
| 73 | Ga0415639_049645 | 3300038395 | Bacteria | 3524 |
| 74 | Ga0466693_160411 | 3300042592 | Bacteria | 2569 |
| 75 | Ga0466696_309810 | 3300042596 | Bacteria | 11351 |
| 76 | Ga0466697_120725 | 3300042611 | Bacteria | 3889 |
| 77 | Ga0466733_087638 | 3300042659 | Bacteria | 4995 |
| 78 | Ga0466711_432215 | 3300042615 | Bacteria | 9739 |
| 79 | Ga0466715_362727 | 3300042616 | Bacteria | 24199 |
| 80 | IMNBL1DRAFT_c0000847 | 3300000062 | Bacteria | 24007 |
| 81 | Ga0123355_10006456 | 3300009826 | Bacteria | 17375 |
| 82 | Ga0123355_10109540 | 3300009826 | Bacteria | 4319 |
| 83 | Ga0123355_10305133 | 3300009826 | Bacteria | 2165 |
| 84 | Ga0123356_10009284 | 3300010049 | Bacteria | 9716 |
| 85 | Ga0123356_10070488 | 3300010049 | Bacteria | 3279 |
| 86 | Ga0123356_10131273 | 3300010049 | Bacteria | 2455 |
| 87 | Ga0123356_10205500 | 3300010049 | Bacteria | 2013 |
| 88 | Ga0123356_10362379 | 3300010049 | Bacteria | 1577 |
| 89 | Ga0123356_10508985 | 3300010049 | Bacteria | 1361 |
| 90 | Ga0123353_10036008 | 3300010167 | Bacteria | 7749 |
| 91 | Ga0123353_10048503 | 3300010167 | Bacteria | 6762 |
| 92 | Ga0123353_10112724 | 3300010167 | Bacteria | 4378 |
| 93 | Ga0466719_015454 | 3300042606 | Bacteria | 2364 |
| 94 | Ga0466721_068902 | 3300042608 | Bacteria | 33916 |
| 95 | Ga0466721_365255 | 3300042608 | Bacteria | 1780 |
| 96 | Ga0466721_385725 | 3300042608 | Bacteria | 6058 |
| 97 | Ga0466722_187245 | 3300042609 | Bacteria | 2912 |
| 98 | Ga0466729_251560 | 3300042621 | Bacteria | 19499 |
| 99 | Ga0466729_270201 | 3300042621 | Bacteria | 4939 |
| 100 | Ga0466730_066627 | 3300042625 | Bacteria | 1642 |
| 101 | Ga0466704_144687 | 3300042643 | Bacteria | 21194 |
| 102 | Ga0466704_290717 | 3300042643 | Bacteria | 1851 |
| 103 | Ga0466709_210699 | 3300042648 | Bacteria | 76873 |
| 104 | Ga0466690_146851 | 3300042590 | Bacteria | 110739 |
| 105 | Ga0466705_125845 | 3300042612 | Bacteria | 9297 |
| 106 | Ga0466705_385246 | 3300042612 | Bacteria | 20984 |
| 107 | Ga0562378_0258 | 3300056814 | Bacteria | 120735 |
| 108 | Ga0562377_0850 | 3300056842 | Unclassified | 40600 |
| 109 | Ga0466710_254246 | 3300042613 | Bacteria | 1521 |
| 110 | Ga0466728_373999 | 3300042620 | Bacteria | 5077 |
| 111 | IMNBL1DRAFT_c0001163 | 3300000062 | Bacteria | 20049 |
| 112 | JGI24695J34938_10061952 | 3300002450 | Bacteria | 1591 |
| 113 | JGI24702J35022_10001835 | 3300002462 | Bacteria | 13078 |
| 114 | Ga0123357_10050947 | 3300009784 | Bacteria | 5601 |
| 115 | Ga0123355_10184638 | 3300009826 | Bacteria | 3087 |
| 116 | Ga0123355_10347270 | 3300009826 | Bacteria | 1970 |
| 117 | Ga0123356_10022428 | 3300010049 | Bacteria | 5963 |
| 118 | Ga0123356_10429365 | 3300010049 | Bacteria | 1465 |
| 119 | Ga0123353_10084418 | 3300010167 | Bacteria | 5112 |
| 120 | Ga0123353_10128316 | 3300010167 | Bacteria | 4072 |
| 121 | Ga0123354_10001138 | 3300010882 | Bacteria | 31037 |
| 122 | Ga0466707_243724 | 3300042601 | Bacteria | 73222 |
| 123 | Ga0466713_094570 | 3300042602 | Bacteria | 104024 |
| 124 | Ga0466727_145325 | 3300042655 | Bacteria | 108337 |
| 125 | Ga0160432_100037 | 3300012818 | Bacteria | 189678 |
| 126 | Ga0415639_006216 | 3300038395 | Bacteria | 33213 |
| 127 | Ga0466690_046734 | 3300042590 | Bacteria | 10843 |
| 128 | Ga0466696_064170 | 3300042596 | Bacteria | 3032 |
| 129 | Ga0466705_213682 | 3300042612 | Bacteria | 4433 |
| 130 | Ga0466718_041810 | 3300042617 | Bacteria | 1883 |
| 131 | Ga0466726_157288 | 3300042619 | Bacteria | 9132 |
| 132 | 2227164158 | 2225789004 | Bacteria | 8319 |
| 133 | IMNBL1DRAFT_c0000890 | 3300000062 | Bacteria | 23235 |
| 134 | JGI24702J35022_10158298 | 3300002462 | Bacteria | 1274 |
| 135 | CVPL010W_10000817 | 3300002931 | Bacteria | 59122 |
| 136 | Ga0123357_10266234 | 3300009784 | Bacteria | 1801 |
| 137 | Ga0123356_10000010 | 3300010049 | Bacteria | 220063 |
| 138 | Ga0123356_10002684 | 3300010049 | Bacteria | 18884 |
| 139 | Ga0123356_10047455 | 3300010049 | Bacteria | 3996 |
| 140 | Ga0123356_10066899 | 3300010049 | Bacteria | 3365 |
| 141 | Ga0123356_10246733 | 3300010049 | Bacteria | 1860 |
| 142 | Ga0123356_10323561 | 3300010049 | Bacteria | 1656 |
| 143 | Ga0123356_10503334 | 3300010049 | Bacteria | 1368 |
| 144 | Ga0123353_10001991 | 3300010167 | Bacteria | 25237 |
| 145 | Ga0123353_10076850 | 3300010167 | Bacteria | 5365 |
| 146 | Ga0123353_10441459 | 3300010167 | Bacteria | 1920 |
| 147 | Ga0123353_10563627 | 3300010167 | Bacteria | 1639 |
| 148 | Ga0123353_10610336 | 3300010167 | Bacteria | 1556 |
| 149 | Ga0123354_10068850 | 3300010882 | Bacteria | 5140 |
| 150 | Ga0123354_10101352 | 3300010882 | Bacteria | 3889 |
| 151 | Ga0466707_001650 | 3300042601 | Bacteria | 9325 |
| 152 | Ga0466707_332562 | 3300042601 | Bacteria | 9494 |
| 153 | Ga0466729_206171 | 3300042621 | Bacteria | 17094 |
| 154 | Ga0466725_220046 | 3300042654 | Bacteria | 2130 |
| 155 | Ga0466727_032342 | 3300042655 | Bacteria | 9121 |
| 156 | Ga0466692_135382 | 3300042591 | Bacteria | 6967 |
| 157 | Ga0466733_081613 | 3300042659 | Bacteria | 2372 |
| 158 | Ga0466723_213992 | 3300042618 | Bacteria | 12938 |
| 159 | 2227080765 | 2225789004 | Bacteria | 420563 |
| 160 | 2227386345 | 2225789004 | Bacteria | 27406 |
| 161 | JGI24705J35276_12168697 | 3300002504 | Unclassified | 1278 |
| 162 | Ga0123356_10034630 | 3300010049 | Bacteria | 4719 |
| 163 | Ga0123356_10050240 | 3300010049 | Bacteria | 3881 |
| 164 | Ga0123356_10053862 | 3300010049 | Bacteria | 3745 |
| 165 | Ga0123353_10345949 | 3300010167 | Bacteria | 2243 |
| 166 | Ga0123353_10386796 | 3300010167 | Unclassified | 2089 |
| 167 | Ga0123353_10409035 | 3300010167 | Bacteria | 2016 |
| 168 | Ga0123353_10656703 | 3300010167 | Bacteria | 1483 |
| 169 | Ga0123353_10837011 | 3300010167 | Bacteria | 1264 |
| 170 | Ga0466701_078505 | 3300042598 | Bacteria | 86539 |
| 171 | Ga0466706_140836 | 3300042599 | Bacteria | 3005 |
| 172 | Ga0466719_179138 | 3300042606 | Bacteria | 4170 |
| 173 | Ga0466704_559247 | 3300042643 | Bacteria | 4083 |
| 174 | Ga0466724_24057 | 3300042649 | Bacteria | 30314 |
| 175 | Ga0466725_100373 | 3300042654 | Bacteria | 14067 |
| 176 | Ga0160467_100207 | 3300012829 | Bacteria | 76785 |
| 177 | Ga0160455_103592 | 3300012837 | Unclassified | 2286 |
| 178 | Ga0160445_103820 | 3300012847 | Bacteria | 2910 |
| 179 | Ga0466697_184080 | 3300042611 | Bacteria | 1438 |
| 180 | Ga0466711_432158 | 3300042615 | Bacteria | 11250 |
| 181 | Ga0466723_217114 | 3300042618 | Bacteria | 22855 |
| 182 | Ga0466729_167110 | 3300042621 | Bacteria | 6450 |
| 183 | Ga0104045_1001357 | 3300007085 | Bacteria | 5412 |
| 184 | Ga0123357_10008879 | 3300009784 | Bacteria | 12626 |
| 185 | Ga0123355_10031627 | 3300009826 | Bacteria | 8586 |
| 186 | Ga0123355_10147525 | 3300009826 | Unclassified | 3582 |
| 187 | Ga0123356_10005233 | 3300010049 | Bacteria | 13249 |
| 188 | Ga0123356_10420803 | 3300010049 | Bacteria | 1478 |
| 189 | Ga0123353_10001369 | 3300010167 | Bacteria | 29946 |
| 190 | Ga0123353_10042006 | 3300010167 | Bacteria | 7228 |
| 191 | Ga0123353_10103293 | 3300010167 | Bacteria | 4594 |
| 192 | Ga0123353_10218404 | 3300010167 | Bacteria | 2984 |
| 193 | Ga0123353_10300473 | 3300010167 | Bacteria | 2451 |
| 194 | Ga0466707_175167 | 3300042601 | Bacteria | 3034 |
| 195 | Ga0466707_227821 | 3300042601 | Bacteria | 1449 |
| 196 | Ga0466719_100408 | 3300042606 | Bacteria | 6247 |
| 197 | Ga0466704_325789 | 3300042643 | Bacteria | 17195 |
| 198 | Ga0466725_261721 | 3300042654 | Bacteria | 2464 |
| 199 | Ga0466696_260550 | 3300042596 | Bacteria | 25366 |
| 200 | Ga0466696_346326 | 3300042596 | Bacteria | 2799 |
| 201 | Ga0466696_460737 | 3300042596 | Bacteria | 5297 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 2225789004 | 2227080765 | 2227448907 | 332 |
| 2 | 3300009784 | Ga0123357_10184460 | Ga0123357_101844602 | 332 |
| 3 | 3300042602 | Ga0466713_095410 | Ga0466713_095410_41121_42119 | 332 |
| 4 | 3300042616 | Ga0466715_362727 | Ga0466715_362727_175_1173 | 332 |
| 5 | 3300042625 | Ga0466730_066627 | Ga0466730_066627_314_1312 | 332 |
| 6 | 3300042648 | Ga0466709_210699 | Ga0466709_210699_22812_23810 | 332 |
| 7 | 3300056814 | Ga0562378_0258 | Ga0562378_0258_115348_116439 | 332 |
| 8 | 3300056842 | Ga0562377_0850 | Ga0562377_0850_6866_7957 | 332 |
| 9 | 3300002462 | JGI24702J35022_10001835 | JGI24702J35022_100018359 | 333 |
| 10 | 3300009826 | Ga0123355_10347270 | Ga0123355_103472702 | 333 |
| 11 | 3300010167 | Ga0123353_10001369 | Ga0123353_100013693 | 333 |
| 12 | 3300038395 | Ga0415639_049645 | Ga0415639_049645_1540_2541 | 333 |
| 13 | 3300042621 | Ga0466729_269933 | Ga0466729_269933_798_1799 | 333 |
| 14 | 3300042659 | Ga0466733_087638 | Ga0466733_087638_347_1348 | 333 |
| 15 | iso_pr_bacteria | 2820481688 | 2820482377 | 333 |
| 16 | iso_pr_bacteria | 2820598593 | 2820599749 | 333 |
| 17 | 3300009826 | Ga0123355_10004203 | Ga0123355_1000420310 | 334 |
| 18 | 3300009826 | Ga0123355_10109540 | Ga0123355_101095403 | 334 |
| 19 | 3300042654 | Ga0466725_372654 | Ga0466725_372654_16073_17077 | 334 |
| 20 | iso_pr_bacteria | 2574180310 | 2576357763 | 334 |
| 21 | iso_pr_bacteria | 2751185832 | 2753508514 | 334 |
| 22 | iso_pr_bacteria | 2820499546 | 2820500745 | 334 |
| 23 | iso_pr_bacteria | 2820537337 | 2820538179 | 334 |
| 24 | iso_pr_bacteria | 2820709481 | 2820710832 | 334 |
| 25 | iso_pr_bacteria | 2852123468 | 2852125762 | 334 |
| 26 | iso_pr_bacteria | 2852337885 | 2852338105 | 334 |
| 27 | iso_pr_bacteria | 2855361764 | 2855363632 | 334 |
| 28 | 3300000062 | IMNBL1DRAFT_c0000890 | IMNBL1DRAFT_00008906 | 335 |
| 29 | 3300009826 | Ga0123355_10147525 | Ga0123355_101475252 | 335 |
| 30 | 3300009826 | Ga0123355_10264988 | Ga0123355_102649882 | 335 |
| 31 | 3300010049 | Ga0123356_10205500 | Ga0123356_102055002 | 335 |
| 32 | 3300038395 | Ga0415639_015925 | Ga0415639_015925_7156_8163 | 335 |
| 33 | 3300042601 | Ga0466707_041872 | Ga0466707_041872_1483_2490 | 335 |
| 34 | 3300042649 | Ga0466724_48085 | Ga0466724_48085_3321_4328 | 335 |
| 35 | 3300009826 | Ga0123355_10006456 | Ga0123355_100064563 | 336 |
| 36 | 3300010049 | Ga0123356_10429365 | Ga0123356_104293652 | 336 |
| 37 | 3300042596 | Ga0466696_309810 | Ga0466696_309810_3550_4560 | 336 |
| 38 | 3300042643 | Ga0466704_290717 | Ga0466704_290717_47_1057 | 336 |
| 39 | 3300042654 | Ga0466725_220046 | Ga0466725_220046_67_1077 | 336 |
| 40 | iso_pr_bacteria | 2827179085 | 2827182723 | 336 |
| 41 | iso_pr_bacteria | 2890957088 | 2890960372 | 336 |
| 42 | 3300010167 | Ga0123353_10837011 | Ga0123353_108370112 | 337 |
| 43 | 3300042598 | Ga0466701_072917 | Ga0466701_072917_1875_2888 | 337 |
| 44 | 3300042615 | Ga0466711_432158 | Ga0466711_432158_3458_4498 | 337 |
| 45 | 3300042654 | Ga0466725_042126 | Ga0466725_042126_161_1174 | 337 |
| 46 | 3300042654 | Ga0466725_100373 | Ga0466725_100373_6253_7266 | 337 |
| 47 | iso_pr_bacteria | 2820296961 | 2820298086 | 337 |
| 48 | iso_pr_bacteria | 2820535361 | 2820535780 | 337 |
| 49 | 3300000062 | IMNBL1DRAFT_c0001163 | IMNBL1DRAFT_000116314 | 338 |
| 50 | 3300009826 | Ga0123355_10039120 | Ga0123355_100391206 | 338 |
| 51 | 3300009826 | Ga0123355_10184638 | Ga0123355_101846383 | 338 |
| 52 | 3300009826 | Ga0123355_10305133 | Ga0123355_103051331 | 338 |
| 53 | 3300010167 | Ga0123353_10166514 | Ga0123353_101665146 | 338 |
| 54 | 3300012798 | Ga0160454_100023 | Ga0160454_100023231 | 338 |
| 55 | iso_pr_bacteria | 2820406809 | 2820408247 | 338 |
| 56 | iso_pr_bacteria | 8064531044 | 8064534654 | 338 |
| 57 | 3300010167 | Ga0123353_10386796 | Ga0123353_103867962 | 339 |
| 58 | 3300010882 | Ga0123354_10001138 | Ga0123354_1000113810 | 339 |
| 59 | 3300010882 | Ga0123354_10136832 | Ga0123354_101368322 | 339 |
| 60 | 3300042602 | Ga0466713_084078 | Ga0466713_084078_3846_4865 | 339 |
| 61 | 3300042598 | Ga0466701_078505 | Ga0466701_078505_84478_85500 | 340 |
| 62 | 3300042601 | Ga0466707_202459 | Ga0466707_202459_14614_15636 | 340 |
| 63 | 3300042613 | Ga0466710_254246 | Ga0466710_254246_223_1245 | 340 |
| 64 | 3300042649 | Ga0466724_24057 | Ga0466724_24057_21359_22381 | 340 |
| 65 | 3300042649 | Ga0466724_61407 | Ga0466724_61407_9962_10984 | 340 |
| 66 | iso_pr_bacteria | 2579779088 | 2582238150 | 340 |
| 67 | iso_pr_bacteria | 2873776654 | 2873781440 | 340 |
| 68 | iso_pr_bacteria | 2896321640 | 2896322960 | 340 |
| 69 | iso_pr_bacteria | 2896330536 | 2896331331 | 340 |
| 70 | iso_pr_bacteria | 2896350215 | 2896351508 | 340 |
| 71 | iso_pr_bacteria | 2898741527 | 2898742497 | 340 |
| 72 | 3300002931 | CVPL010W_10000817 | CVPL010W_1000081713 | 341 |
| 73 | 3300007085 | Ga0104045_1001357 | Ga0104045_10013575 | 341 |
| 74 | 3300007085 | Ga0104045_1074423 | Ga0104045_10744233 | 341 |
| 75 | 3300007143 | Ga0104048_1002375 | Ga0104048_10023753 | 341 |
| 76 | 3300012818 | Ga0160432_100037 | Ga0160432_10003733 | 341 |
| 77 | 3300012829 | Ga0160467_100207 | Ga0160467_1002076 | 341 |
| 78 | 3300010167 | Ga0123353_10441459 | Ga0123353_104414592 | 342 |
| 79 | 3300042601 | Ga0466707_001650 | Ga0466707_001650_4203_5231 | 342 |
| 80 | 3300042601 | Ga0466707_243724 | Ga0466707_243724_45331_46359 | 342 |
| 81 | 3300042643 | Ga0466704_325789 | Ga0466704_325789_4186_5214 | 342 |
| 82 | iso_pr_bacteria | 2820432912 | 2820435261 | 342 |
| 83 | iso_pr_bacteria | 2820530790 | 2820533085 | 342 |
| 84 | 2225789004 | 2227164158 | 2227575854 | 343 |
| 85 | 2225789004 | 2227480187 | 2227939240 | 343 |
| 86 | 3300010049 | Ga0123356_10022428 | Ga0123356_100224286 | 343 |
| 87 | 3300012832 | Ga0160458_100179 | Ga0160458_10017931 | 343 |
| 88 | 3300012837 | Ga0160455_103592 | Ga0160455_1035922 | 343 |
| 89 | 3300012847 | Ga0160445_103820 | Ga0160445_1038201 | 343 |
| 90 | 3300024493 | Ga0264413_105678 | Ga0264413_1056782 | 343 |
| 91 | 3300042608 | Ga0466721_068902 | Ga0466721_068902_16885_17916 | 343 |
| 92 | 3300042617 | Ga0466718_041810 | Ga0466718_041810_467_1498 | 343 |
| 93 | 3300042636 | Ga0466703_028031 | Ga0466703_028031_709_1926 | 343 |
| 94 | iso_pr_bacteria | 2820497731 | 2820498073 | 343 |
| 95 | 3300000062 | IMNBL1DRAFT_c0000847 | IMNBL1DRAFT_00008476 | 344 |
| 96 | 3300010049 | Ga0123356_10070488 | Ga0123356_100704883 | 345 |
| 97 | 3300038395 | Ga0415639_047196 | Ga0415639_047196_8429_9466 | 345 |
| 98 | 3300002462 | JGI24702J35022_10158298 | JGI24702J35022_101582981 | 346 |
| 99 | 3300010049 | Ga0123356_10362379 | Ga0123356_103623792 | 346 |
| 100 | 3300010167 | Ga0123353_10218404 | Ga0123353_102184043 | 346 |
| 101 | 3300042608 | Ga0466721_365255 | Ga0466721_365255_583_1623 | 346 |
| 102 | 3300042612 | Ga0466705_381475 | Ga0466705_381475_16242_17282 | 346 |
| 103 | iso_pr_bacteria | 2820711732 | 2820712260 | 346 |
| 104 | iso_pr_bacteria | 2989309576 | 2989311887 | 346 |
| 105 | 3300010049 | Ga0123356_10033612 | Ga0123356_100336123 | 347 |
| 106 | 3300042643 | Ga0466704_559247 | Ga0466704_559247_1943_2986 | 347 |
| 107 | iso_pr_bacteria | 2590828840 | 2593255214 | 347 |
| 108 | iso_pr_bacteria | 2593339124 | 2595062765 | 347 |
| 109 | 3300010049 | Ga0123356_10508985 | Ga0123356_105089852 | 348 |
| 110 | 3300042606 | Ga0466719_179138 | Ga0466719_179138_79_1125 | 348 |
| 111 | 3300042615 | Ga0466711_432215 | Ga0466711_432215_1328_2374 | 348 |
| 112 | iso_pr_bacteria | 2820606014 | 2820606715 | 348 |
| 113 | 3300009826 | Ga0123355_10031627 | Ga0123355_100316276 | 349 |
| 114 | 3300038395 | Ga0415639_004917 | Ga0415639_004917_6984_8033 | 349 |
| 115 | 3300042601 | Ga0466707_375914 | Ga0466707_375914_470_1519 | 349 |
| 116 | 3300042602 | Ga0466713_009411 | Ga0466713_009411_6338_7387 | 349 |
| 117 | 3300042606 | Ga0466719_100408 | Ga0466719_100408_1548_2681 | 349 |
| 118 | 3300042611 | Ga0466697_120725 | Ga0466697_120725_570_1619 | 349 |
| 119 | 3300042621 | Ga0466729_251560 | Ga0466729_251560_18275_19324 | 349 |
| 120 | iso_pr_bacteria | 2820464928 | 2820465831 | 349 |
| 121 | 3300010049 | Ga0123356_10115742 | Ga0123356_101157423 | 350 |
| 122 | 3300010049 | Ga0123356_10183383 | Ga0123356_101833834 | 350 |
| 123 | 3300010167 | Ga0123353_10009874 | Ga0123353_1000987410 | 350 |
| 124 | 3300010167 | Ga0123353_10084418 | Ga0123353_100844186 | 350 |
| 125 | 3300042592 | Ga0466693_160411 | Ga0466693_160411_488_1540 | 350 |
| 126 | 3300042599 | Ga0466706_140836 | Ga0466706_140836_556_1608 | 350 |
| 127 | 3300042618 | Ga0466723_217114 | Ga0466723_217114_12698_13750 | 350 |
| 128 | 3300042621 | Ga0466729_270201 | Ga0466729_270201_559_1611 | 350 |
| 129 | 3300042652 | Ga0466708_282915 | Ga0466708_282915_5582_6634 | 350 |
| 130 | iso_pr_bacteria | 2820647881 | 2820647981 | 350 |
| 131 | 2225789004 | 2227386345 | 2227831139 | 351 |
| 132 | 3300010049 | Ga0123356_10047455 | Ga0123356_100474555 | 351 |
| 133 | 3300042601 | Ga0466707_193078 | Ga0466707_193078_1590_2684 | 351 |
| 134 | 3300042602 | Ga0466713_017636 | Ga0466713_017636_1696_2751 | 351 |
| 135 | 3300042602 | Ga0466713_094570 | Ga0466713_094570_70871_71926 | 351 |
| 136 | 3300042606 | Ga0466719_198652 | Ga0466719_198652_824_1879 | 351 |
| 137 | 3300042612 | Ga0466705_125845 | Ga0466705_125845_3261_4316 | 351 |
| 138 | 3300042612 | Ga0466705_213682 | Ga0466705_213682_1542_2597 | 351 |
| 139 | 3300042643 | Ga0466704_144687 | Ga0466704_144687_3039_4094 | 351 |
| 140 | iso_pr_bacteria | 2820442516 | 2820444437 | 351 |
| 141 | iso_pr_bacteria | 2820466401 | 2820466972 | 351 |
| 142 | iso_pr_bacteria | 2820661146 | 2820661598 | 351 |
| 143 | iso_pr_bacteria | 2820690275 | 2820690636 | 351 |
| 144 | 3300002450 | JGI24695J34938_10000359 | JGI24695J34938_1000035938 | 352 |
| 145 | 3300002504 | JGI24705J35276_12168697 | JGI24705J35276_121686972 | 352 |
| 146 | 3300009784 | Ga0123357_10008879 | Ga0123357_100088794 | 352 |
| 147 | 3300009826 | Ga0123355_10030491 | Ga0123355_100304912 | 352 |
| 148 | 3300010049 | Ga0123356_10000010 | Ga0123356_1000001029 | 352 |
| 149 | 3300010049 | Ga0123356_10002684 | Ga0123356_100026844 | 352 |
| 150 | 3300010049 | Ga0123356_10009284 | Ga0123356_100092849 | 352 |
| 151 | 3300010049 | Ga0123356_10020054 | Ga0123356_100200542 | 352 |
| 152 | 3300010049 | Ga0123356_10029730 | Ga0123356_100297303 | 352 |
| 153 | 3300010049 | Ga0123356_10031761 | Ga0123356_100317612 | 352 |
| 154 | 3300010049 | Ga0123356_10034630 | Ga0123356_100346306 | 352 |
| 155 | 3300010049 | Ga0123356_10045384 | Ga0123356_100453842 | 352 |
| 156 | 3300010049 | Ga0123356_10053862 | Ga0123356_100538622 | 352 |
| 157 | 3300010049 | Ga0123356_10066899 | Ga0123356_100668994 | 352 |
| 158 | 3300010049 | Ga0123356_10105676 | Ga0123356_101056762 | 352 |
| 159 | 3300010049 | Ga0123356_10246733 | Ga0123356_102467331 | 352 |
| 160 | 3300010049 | Ga0123356_10298961 | Ga0123356_102989612 | 352 |
| 161 | 3300010049 | Ga0123356_10323561 | Ga0123356_103235612 | 352 |
| 162 | 3300010049 | Ga0123356_10401897 | Ga0123356_104018972 | 352 |
| 163 | 3300010049 | Ga0123356_10420803 | Ga0123356_104208032 | 352 |
| 164 | 3300010049 | Ga0123356_10503334 | Ga0123356_105033342 | 352 |
| 165 | 3300010167 | Ga0123353_10000056 | Ga0123353_1000005644 | 352 |
| 166 | 3300010167 | Ga0123353_10001991 | Ga0123353_1000199118 | 352 |
| 167 | 3300010167 | Ga0123353_10052866 | Ga0123353_100528664 | 352 |
| 168 | 3300010167 | Ga0123353_10106375 | Ga0123353_101063753 | 352 |
| 169 | 3300010167 | Ga0123353_10163185 | Ga0123353_101631852 | 352 |
| 170 | 3300010167 | Ga0123353_10300473 | Ga0123353_103004732 | 352 |
| 171 | 3300010167 | Ga0123353_10656703 | Ga0123353_106567031 | 352 |
| 172 | 3300038395 | Ga0415639_006216 | Ga0415639_006216_2856_3914 | 352 |
| 173 | 3300042596 | Ga0466696_346326 | Ga0466696_346326_531_1589 | 352 |
| 174 | 3300042596 | Ga0466696_460737 | Ga0466696_460737_3554_4612 | 352 |
| 175 | 3300042602 | Ga0466713_053492 | Ga0466713_053492_6848_7921 | 352 |
| 176 | 3300042618 | Ga0466723_213992 | Ga0466723_213992_6637_7695 | 352 |
| 177 | 3300042636 | Ga0466703_170876 | Ga0466703_170876_11244_12302 | 352 |
| 178 | 3300042655 | Ga0466727_032342 | Ga0466727_032342_6438_7496 | 352 |
| 179 | iso_pr_bacteria | 2820587002 | 2820587339 | 352 |
| 180 | 3300009784 | Ga0123357_10181277 | Ga0123357_101812772 | 353 |
| 181 | 3300010049 | Ga0123356_10050240 | Ga0123356_100502403 | 353 |
| 182 | 3300010167 | Ga0123353_10355765 | Ga0123353_103557652 | 353 |
| 183 | 3300042590 | Ga0466690_146851 | Ga0466690_146851_80644_81705 | 353 |
| 184 | 3300042596 | Ga0466696_064170 | Ga0466696_064170_1896_2957 | 353 |
| 185 | 3300042603 | Ga0466714_117080 | Ga0466714_117080_84_1145 | 353 |
| 186 | 3300042606 | Ga0466719_015454 | Ga0466719_015454_808_1869 | 353 |
| 187 | 3300042611 | Ga0466697_184080 | Ga0466697_184080_108_1169 | 353 |
| 188 | 3300042621 | Ga0466729_206171 | Ga0466729_206171_14545_15606 | 353 |
| 189 | 3300042643 | Ga0466704_038894 | Ga0466704_038894_3421_4482 | 353 |
| 190 | iso_pr_bacteria | 2820282995 | 2820284113 | 353 |
| 191 | 3300010049 | Ga0123356_10341777 | Ga0123356_103417771 | 354 |
| 192 | 3300010167 | Ga0123353_10563627 | Ga0123353_105636272 | 354 |
| 193 | 3300042590 | Ga0466690_046734 | Ga0466690_046734_6071_7135 | 354 |
| 194 | 3300042601 | Ga0466707_227821 | Ga0466707_227821_37_1101 | 354 |
| 195 | 3300042601 | Ga0466707_332562 | Ga0466707_332562_337_1401 | 354 |
| 196 | 3300010167 | Ga0123353_10610336 | Ga0123353_106103361 | 355 |
| 197 | 3300042596 | Ga0466696_260550 | Ga0466696_260550_23773_24840 | 355 |
| 198 | 3300042606 | Ga0466719_358226 | Ga0466719_358226_388_1455 | 355 |
| 199 | 3300042612 | Ga0466705_271926 | Ga0466705_271926_20240_21307 | 355 |
| 200 | 3300042612 | Ga0466705_385246 | Ga0466705_385246_18226_19293 | 355 |
| 201 | 3300042619 | Ga0466726_157288 | Ga0466726_157288_3479_4546 | 355 |
| 202 | 3300042620 | Ga0466728_373999 | Ga0466728_373999_630_1697 | 355 |
| 203 | 3300042643 | Ga0466704_183110 | Ga0466704_183110_7776_8843 | 355 |
| 204 | 3300010049 | Ga0123356_10005233 | Ga0123356_100052339 | 356 |
| 205 | 3300010167 | Ga0123353_10021511 | Ga0123353_100215114 | 356 |
| 206 | 3300010167 | Ga0123353_10048503 | Ga0123353_100485038 | 356 |
| 207 | 3300010167 | Ga0123353_10076850 | Ga0123353_100768506 | 356 |
| 208 | 3300010167 | Ga0123353_10112724 | Ga0123353_101127244 | 356 |
| 209 | 3300010167 | Ga0123353_10128316 | Ga0123353_101283164 | 356 |
| 210 | 3300010167 | Ga0123353_10150857 | Ga0123353_101508572 | 356 |
| 211 | 3300010167 | Ga0123353_10191820 | Ga0123353_101918203 | 356 |
| 212 | 3300010167 | Ga0123353_10345949 | Ga0123353_103459491 | 356 |
| 213 | 3300010167 | Ga0123353_10409035 | Ga0123353_104090353 | 356 |
| 214 | 3300042652 | Ga0466708_012099 | Ga0466708_012099_826_1896 | 356 |
| 215 | 3300010049 | Ga0123356_10027462 | Ga0123356_100274623 | 357 |
| 216 | 3300042608 | Ga0466721_385725 | Ga0466721_385725_334_1407 | 357 |
| 217 | 3300042616 | Ga0466715_589871 | Ga0466715_589871_9476_10549 | 357 |
| 218 | 3300009826 | Ga0123355_10303706 | Ga0123355_103037061 | 358 |
| 219 | 3300042615 | Ga0466711_098730 | Ga0466711_098730_5221_6297 | 358 |
| 220 | 3300010167 | Ga0123353_10103293 | Ga0123353_101032936 | 359 |
| 221 | 3300042655 | Ga0466727_145325 | Ga0466727_145325_18117_19298 | 359 |
| 222 | 3300002450 | JGI24695J34938_10061952 | JGI24695J34938_100619521 | 360 |
| 223 | 3300042621 | Ga0466729_167110 | Ga0466729_167110_2873_3955 | 360 |
| 224 | 3300042654 | Ga0466725_261721 | Ga0466725_261721_828_1928 | 360 |
| 225 | 3300042659 | Ga0466733_081613 | Ga0466733_081613_155_1237 | 360 |
| 226 | 3300010882 | Ga0123354_10101352 | Ga0123354_101013524 | 361 |
| 227 | 3300010049 | Ga0123356_10131273 | Ga0123356_101312732 | 362 |
| 228 | 3300010049 | Ga0123356_10185605 | Ga0123356_101856052 | 362 |
| 229 | 3300010167 | Ga0123353_10036008 | Ga0123353_100360086 | 362 |
| 230 | 3300010167 | Ga0123353_10042006 | Ga0123353_100420068 | 362 |
| 231 | iso_pr_bacteria | 2820357977 | 2820358832 | 364 |
| 232 | 3300009784 | Ga0123357_10266234 | Ga0123357_102662342 | 366 |
| 233 | 3300042591 | Ga0466692_135382 | Ga0466692_135382_652_1758 | 368 |
| 234 | 3300042601 | Ga0466707_135212 | Ga0466707_135212_2164_3276 | 370 |
| 235 | 3300010882 | Ga0123354_10068850 | Ga0123354_100688505 | 372 |
| 236 | 3300042601 | Ga0466707_175167 | Ga0466707_175167_1359_2477 | 372 |
| 237 | 3300042609 | Ga0466722_187245 | Ga0466722_187245_1779_2897 | 372 |
| 238 | 3300009784 | Ga0123357_10050947 | Ga0123357_100509473 | 377 |
| 239 | 2225789004 | 2227501038 | 2227983780 | 392 |
| 240 | iso_pr_bacteria | 2820412446 | 2820413790 | 401 |
| 241 | 3300042601 | Ga0466707_228633 | Ga0466707_228633_56000_57274 | 415 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF17864 | AAA_lid_4 | RuvB AAA lid domain | 222 | 295 | 0.99 |
| PF05496 | RuvB_N | Holliday junction DNA helicase RuvB P-loop domain | 61 | 218 | 0.99 |
| PF05491 | RuvB_C | RuvB C-terminal winged helix domain | 298 | 366 | 0.98 |
| PF00004 | AAA | ATPase family associated with various cellular activities (AAA) | 96 | 220 | 0.96 |
| PF07728 | AAA_5 | AAA domain (dynein-related subfamily) | 95 | 213 | 0.9 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.78 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.