Protein Family IF05909

Metagenome Isolate
104 Members
40 Samples
101 Scaffolds
184.93 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_228494|Ga0466707_228494_328_882
Length
184 aa
Sequence
MIDKDIIENIIKLRENGFEKDKDHFSITRDIFTARLESFITGTGKYLEAAVIGEIGNNTFDHNFIFENMNQKGVYFNFYTEHVILSDYGRGIKESLSQVIPNIQTDFEALEIAFTKNISGRSPEQRGNGLKFVSKTIQENNWNLFFQSGNGNCFINKDGIKYTQSNILISGCLAIINFNGGKKS

📊 Sample Types

Isolate 2.9%
Metagenome 97.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 46.2%
Kalotermitidae 33.3%
Unclassified 10.3%
Termopsidae 7.7%
Rhinotermitidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 99
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
2 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
3 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
18 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
22 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
23 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
26 650716102 Treponema primitia ZAS-2 Isolate Unclassified
27 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
28 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
29 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
34 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
35 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
36 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
37 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
38 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
40 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_217524 3300042612 Bacteria 4878
2 Ga0466735_091383 3300042624 Bacteria 1185
3 AustNasuHG_c1000434 3300000089 Bacteria 14622
4 Ga0072941_1002036 3300005201 Bacteria 1374
5 Ga0123356_10003747 3300010049 Bacteria 15846
6 Ga0123356_10075709 3300010049 Bacteria 3170
7 Ga0466694_070366 3300042594 Bacteria 1483
8 Ga0466699_126032 3300042597 Bacteria 2367
9 Ga0466699_159650 3300042597 Bacteria 5388
10 Ga0466699_290165 3300042597 Bacteria 2761
11 Ga0466711_374414 3300042615 Bacteria 4543
12 Ga0466723_114938 3300042618 Bacteria 9924
13 Ga0466732_450785 3300042656 Bacteria 1803
14 Ga0466703_209752 3300042636 Bacteria 1236
15 Ga0466704_579289 3300042643 Bacteria 2568
16 AustNasuHG_c1004172 3300000089 Bacteria 5193
17 AustNasuHG_c1030611 3300000089 Bacteria 1545
18 JGI24695J34938_10013666 3300002450 Bacteria 4252
19 Ga0072941_1046244 3300005201 Bacteria 4886
20 Ga0123357_10082090 3300009784 Bacteria 4234
21 Ga0466690_148995 3300042590 Bacteria 1809
22 Ga0466690_184732 3300042590 Bacteria 1905
23 Ga0466695_141338 3300042595 Bacteria 4553
24 Ga0466699_354451 3300042597 Bacteria 3332
25 Ga0466719_060797 3300042606 Bacteria 1331
26 Ga0466720_001772 3300042607 Bacteria 5052
27 Ga0466720_030037 3300042607 Bacteria 1468
28 Ga0466703_146962 3300042636 Bacteria 1137
29 AustNasuHG_c1038878 3300000089 Bacteria 1190
30 Ga0466694_385670 3300042594 Bacteria 1275
31 Ga0466699_182313 3300042597 Bacteria 3086
32 Ga0466718_026240 3300042617 Bacteria 37188
33 Ga0466726_059699 3300042619 Bacteria 1035
34 Ga0466707_228494 3300042601 Bacteria 1608
35 Ga0466720_110680 3300042607 Bacteria 1229
36 Ga0466727_142246 3300042655 Bacteria 4021
37 Ga0466727_346167 3300042655 Bacteria 1990
38 AustNasuHG_c1000793 3300000089 Unclassified 11306
39 AustNasuHG_c1057019 3300000089 Bacteria 782
40 JGI24698J34947_10157751 3300002449 Bacteria 934
41 JGI24696J40584_12850358 3300002834 Bacteria 979
42 Ga0466699_220319 3300042597 Bacteria 6448
43 Ga0466718_158603 3300042617 Bacteria 6249
44 Ga0466719_110706 3300042606 Bacteria 1233
45 Ga0466720_031375 3300042607 Bacteria 1031
46 Ga0466727_296807 3300042655 Bacteria 1370
47 Ga0466690_136734 3300042590 Bacteria 2424
48 Ga0466699_061551 3300042597 Bacteria 3991
49 Ga0466699_097544 3300042597 Bacteria 2833
50 Ga0466699_374590 3300042597 Unclassified 2164
51 Ga0466705_506687 3300042612 Bacteria 4904
52 Ga0466715_236216 3300042616 Bacteria 1619
53 Ga0466718_026131 3300042617 Bacteria 1071
54 Ga0466723_011137 3300042618 Bacteria 7967
55 Ga0466723_052655 3300042618 Bacteria 4529
56 Ga0466722_196854 3300042609 Bacteria 4870
57 Ga0466733_217185 3300042659 Unclassified 1111
58 Ga0466702_199105 3300042635 Bacteria 1727
59 Ga0466703_150698 3300042636 Bacteria 2683
60 Ga0466727_059442 3300042655 Bacteria 2779
61 Ga0466727_306007 3300042655 Bacteria 1342
62 AustNasuHG_c1012318 3300000089 Bacteria 2952
63 JGI24702J35022_10077214 3300002462 Bacteria 1801
64 Ga0123357_10390634 3300009784 Bacteria 1279
65 Ga0123353_10980631 3300010167 Bacteria 1138
66 Ga0123353_11872983 3300010167 Unclassified 741
67 Ga0466723_100648 3300042618 Bacteria 2382
68 Ga0466726_371740 3300042619 Bacteria 1476
69 Ga0466726_374836 3300042619 Bacteria 1002
70 Ga0466726_394928 3300042619 Bacteria 1080
71 Ga0466728_011218 3300042620 Bacteria 6040
72 Ga0466707_138136 3300042601 Bacteria 1831
73 Ga0466732_118369 3300042656 Bacteria 1193
74 AustNasuHG_c1009489 3300000089 Bacteria 3415
75 JGI24698J34947_10026507 3300002449 Bacteria 3079
76 Ga0072940_1183899 3300005200 Bacteria 1028
77 Ga0072941_1106777 3300005201 Bacteria 1370
78 Ga0123357_10329534 3300009784 Bacteria 1494
79 Ga0123356_10381055 3300010049 Bacteria 1543
80 Ga0123356_11709364 3300010049 Bacteria 781
81 Ga0466696_074401 3300042596 Bacteria 1202
82 Ga0466699_338698 3300042597 Bacteria 62334
83 Ga0466699_363902 3300042597 Bacteria 3833
84 Ga0466718_078627 3300042617 Bacteria 5896
85 Ga0466718_083734 3300042617 Bacteria 14036
86 Ga0466718_115533 3300042617 Bacteria 1375
87 Ga0466726_284108 3300042619 Bacteria 2358
88 Ga0466707_235155 3300042601 Bacteria 1455
89 Ga0466720_113496 3300042607 Bacteria 1362
90 Ga0466733_023989 3300042659 Bacteria 3809
91 Ga0466704_571398 3300042643 Bacteria 3987
92 Ga0466709_130119 3300042648 Unclassified 1106
93 Ga0466708_398007 3300042652 Bacteria 1936
94 JGI24698J34947_10033321 3300002449 Bacteria 2703
95 Ga0074263_116590 3300005485 Bacteria 2561
96 Ga0123357_10653016 3300009784 Bacteria 777
97 Ga0123356_10058885 3300010049 Bacteria 3583
98 Ga0123356_10649597 3300010049 Bacteria 1222
99 Ga0466690_360226 3300042590 Bacteria 1370
100 Ga0466707_062045 3300042601 Bacteria 1069
101 Ga0466716_053459 3300042605 Bacteria 5839

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042648 Ga0466709_130119 Ga0466709_130119_425_988 162
2 3300005201 Ga0072941_1002036 Ga0072941_10020362 173
3 3300009784 Ga0123357_10653016 Ga0123357_106530161 178
4 3300042643 Ga0466704_571398 Ga0466704_571398_388_930 180
5 3300005201 Ga0072941_1106777 Ga0072941_11067772 181
6 3300042617 Ga0466718_083734 Ga0466718_083734_201_746 181
7 3300010167 Ga0123353_11872983 Ga0123353_118729831 182
8 3300042594 Ga0466694_385670 Ga0466694_385670_533_1084 183
9 3300042607 Ga0466720_001772 Ga0466720_001772_3381_3932 183
10 3300042607 Ga0466720_031375 Ga0466720_031375_48_599 183
11 3300042609 Ga0466722_196854 Ga0466722_196854_3958_4509 183
12 3300042617 Ga0466718_026240 Ga0466718_026240_15258_15809 183
13 3300042617 Ga0466718_078627 Ga0466718_078627_3686_4237 183
14 3300042655 Ga0466727_296807 Ga0466727_296807_509_1060 183
15 3300042655 Ga0466727_306007 Ga0466727_306007_129_680 183
16 3300042659 Ga0466733_217185 Ga0466733_217185_407_958 183
17 3300010167 Ga0123353_10980631 Ga0123353_109806311 184
18 3300042590 Ga0466690_184732 Ga0466690_184732_1055_1609 184
19 3300042594 Ga0466694_070366 Ga0466694_070366_429_983 184
20 3300042595 Ga0466695_141338 Ga0466695_141338_3004_3558 184
21 3300042596 Ga0466696_074401 Ga0466696_074401_386_940 184
22 3300042597 Ga0466699_061551 Ga0466699_061551_2163_2717 184
23 3300042597 Ga0466699_097544 Ga0466699_097544_1544_2098 184
24 3300042597 Ga0466699_126032 Ga0466699_126032_800_1354 184
25 3300042597 Ga0466699_159650 Ga0466699_159650_2435_2989 184
26 3300042597 Ga0466699_182313 Ga0466699_182313_782_1336 184
27 3300042597 Ga0466699_220319 Ga0466699_220319_4561_5115 184
28 3300042597 Ga0466699_290165 Ga0466699_290165_403_957 184
29 3300042597 Ga0466699_338698 Ga0466699_338698_48123_48677 184
30 3300042597 Ga0466699_354451 Ga0466699_354451_1108_1662 184
31 3300042597 Ga0466699_363902 Ga0466699_363902_1530_2084 184
32 3300042597 Ga0466699_374590 Ga0466699_374590_593_1147 184
33 3300042601 Ga0466707_062045 Ga0466707_062045_163_717 184
34 3300042601 Ga0466707_228494 Ga0466707_228494_328_882 184
35 3300042601 Ga0466707_235155 Ga0466707_235155_676_1230 184
36 3300042605 Ga0466716_053459 Ga0466716_053459_4903_5457 184
37 3300042606 Ga0466719_060797 Ga0466719_060797_369_923 184
38 3300042606 Ga0466719_110706 Ga0466719_110706_531_1085 184
39 3300042607 Ga0466720_030037 Ga0466720_030037_527_1081 184
40 3300042607 Ga0466720_110680 Ga0466720_110680_107_661 184
41 3300042612 Ga0466705_217524 Ga0466705_217524_1029_1583 184
42 3300042612 Ga0466705_506687 Ga0466705_506687_470_1024 184
43 3300042615 Ga0466711_374414 Ga0466711_374414_2506_3060 184
44 3300042617 Ga0466718_026131 Ga0466718_026131_183_737 184
45 3300042617 Ga0466718_158603 Ga0466718_158603_1533_2087 184
46 3300042618 Ga0466723_011137 Ga0466723_011137_6282_6836 184
47 3300042618 Ga0466723_052655 Ga0466723_052655_3545_4099 184
48 3300042618 Ga0466723_100648 Ga0466723_100648_1351_1905 184
49 3300042619 Ga0466726_059699 Ga0466726_059699_37_591 184
50 3300042620 Ga0466728_011218 Ga0466728_011218_3528_4082 184
51 3300042624 Ga0466735_091383 Ga0466735_091383_331_885 184
52 3300042635 Ga0466702_199105 Ga0466702_199105_463_1017 184
53 3300042636 Ga0466703_146962 Ga0466703_146962_536_1090 184
54 3300042636 Ga0466703_150698 Ga0466703_150698_233_787 184
55 3300042636 Ga0466703_209752 Ga0466703_209752_290_844 184
56 3300042643 Ga0466704_579289 Ga0466704_579289_805_1359 184
57 3300042652 Ga0466708_398007 Ga0466708_398007_970_1524 184
58 3300042655 Ga0466727_142246 Ga0466727_142246_533_1087 184
59 3300042655 Ga0466727_346167 Ga0466727_346167_1210_1764 184
60 3300042656 Ga0466732_118369 Ga0466732_118369_229_783 184
61 3300042656 Ga0466732_450785 Ga0466732_450785_99_653 184
62 iso_pr_bacteria 2781125635 2781279089 184
63 iso_pr_bacteria 650716099 650877825 184
64 iso_pr_bacteria 650716102 650882847 184
65 3300000089 AustNasuHG_c1000434 AustNasuHG_10004347 185
66 3300000089 AustNasuHG_c1000793 AustNasuHG_100079311 185
67 3300000089 AustNasuHG_c1004172 AustNasuHG_10041724 185
68 3300000089 AustNasuHG_c1012318 AustNasuHG_10123183 185
69 3300000089 AustNasuHG_c1030611 AustNasuHG_10306112 185
70 3300000089 AustNasuHG_c1038878 AustNasuHG_10388781 185
71 3300000089 AustNasuHG_c1057019 AustNasuHG_10570192 185
72 3300002449 JGI24698J34947_10026507 JGI24698J34947_100265073 185
73 3300002449 JGI24698J34947_10033321 JGI24698J34947_100333212 185
74 3300002450 JGI24695J34938_10013666 JGI24695J34938_100136664 185
75 3300002462 JGI24702J35022_10077214 JGI24702J35022_100772142 185
76 3300002834 JGI24696J40584_12850358 JGI24696J40584_128503582 185
77 3300005200 Ga0072940_1183899 Ga0072940_11838992 185
78 3300005201 Ga0072941_1046244 Ga0072941_10462443 185
79 3300005485 Ga0074263_116590 Ga0074263_1165903 185
80 3300009784 Ga0123357_10082090 Ga0123357_100820902 185
81 3300009784 Ga0123357_10329534 Ga0123357_103295343 185
82 3300010049 Ga0123356_10003747 Ga0123356_1000374713 185
83 3300010049 Ga0123356_10058885 Ga0123356_100588856 185
84 3300010049 Ga0123356_10075709 Ga0123356_100757093 185
85 3300010049 Ga0123356_10381055 Ga0123356_103810552 185
86 3300010049 Ga0123356_11709364 Ga0123356_117093642 185
87 3300042590 Ga0466690_360226 Ga0466690_360226_477_1034 185
88 3300042619 Ga0466726_374836 Ga0466726_374836_348_905 185
89 3300042655 Ga0466727_059442 Ga0466727_059442_2109_2666 185
90 3300042659 Ga0466733_023989 Ga0466733_023989_878_1435 185
91 3300042618 Ga0466723_114938 Ga0466723_114938_8660_9220 186
92 3300042619 Ga0466726_284108 Ga0466726_284108_1641_2201 186
93 3300042619 Ga0466726_371740 Ga0466726_371740_555_1115 186
94 3300042619 Ga0466726_394928 Ga0466726_394928_285_845 186
95 3300000089 AustNasuHG_c1009489 AustNasuHG_10094893 187
96 3300042601 Ga0466707_138136 Ga0466707_138136_462_1025 187
97 3300042590 Ga0466690_148995 Ga0466690_148995_861_1427 188
98 3300002449 JGI24698J34947_10157751 JGI24698J34947_101577512 190
99 3300010049 Ga0123356_10649597 Ga0123356_106495972 190
100 3300042617 Ga0466718_115533 Ga0466718_115533_21_593 190
101 3300009784 Ga0123357_10390634 Ga0123357_103906341 192
102 3300042616 Ga0466715_236216 Ga0466715_236216_397_984 195
103 3300042607 Ga0466720_113496 Ga0466720_113496_136_780 214
104 3300042590 Ga0466690_136734 Ga0466690_136734_1587_2279 230

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.