Protein Family IF05896

Metagenome Isolate
125 Members
46 Samples
115 Scaffolds
338.7 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_210372|Ga0466707_210372_7256_8263
Length
335 aa
Sequence
MNLMQQIIARAQADKQRIVLPEGTEERTLKAADRLLADEVADLVLIGNPPEILRLAAGFKLSHIEKAVILDPKEYDKKEAYANLLFRLRQSKGMTLEKARELAENPLYLACLMIKSGDADGEIAGAHNTTSDVLRPALQIIKTAPGISCVSGAFLMFLPDKQYGEEGVLVFADCAVIPDPTAAEAAQIAIATAQTARNLAGMEPRVAMLSFSTKGSAGLADKMEEATRLARTLAPDLRIDGELQADAALVESVAAAKAPGSDIAGKANVLIFPTLAAGNIAYKLVQRLAKAEAIGPVLQGIAAPVNDLSRGCSVDDVYKMVAIACNQAIGLKTIK

📊 Sample Types

Isolate 8.0%
Metagenome 92.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 28.3%
Termitidae 26.1%
Unclassified 13.0%
Blattidae 8.7%
Rhinotermitidae 6.5%
Termopsidae 6.5%
Passalidae 4.3%
Hydrophilidae 4.3%
Hodotermitidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 121
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
2 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
3 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
10 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
11 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
12 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
13 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
14 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
15 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
16 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
19 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
24 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
25 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
26 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
27 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
28 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
29 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
30 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
31 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
32 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
33 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
34 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
35 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
36 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
37 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
38 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
39 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
40 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
41 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
42 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
43 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
44 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
45 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
46 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_145571 3300042612 Bacteria 4434
2 Ga0466705_365057 3300042612 Bacteria 11803
3 Ga0466711_365295 3300042615 Bacteria 2749
4 Ga0466715_525875 3300042616 Bacteria 7148
5 Ga0466726_048383 3300042619 Bacteria 29520
6 Ga0466726_213518 3300042619 Bacteria 1754
7 Ga0466731_228714 3300042622 Bacteria 2919
8 Ga0466735_064782 3300042624 Bacteria 3430
9 Ga0466707_210372 3300042601 Bacteria 12662
10 Ga0466713_036270 3300042602 Bacteria 36906
11 Ga0466714_114809 3300042603 Bacteria 1721
12 Ga0466722_266178 3300042609 Bacteria 3291
13 Ga0466715_032297 3300042616 Bacteria 33510
14 Ga0466715_212319 3300042616 Bacteria 50715
15 Ga0466726_259504 3300042619 Bacteria 10608
16 Ga0466703_377225 3300042636 Bacteria 1300
17 Ga0466704_096661 3300042643 Bacteria 4524
18 Ga0466704_097641 3300042643 Bacteria 12391
19 Ga0466709_262791 3300042648 Bacteria 5919
20 Ga0466696_033419 3300042596 Bacteria 29709
21 Ga0466696_338446 3300042596 Bacteria 7471
22 Ga0466713_133892 3300042602 Bacteria 2693
23 Ga0466733_021641 3300042659 Bacteria 1383
24 2227491304 2225789004 Bacteria 20472
25 Ga0466711_029466 3300042615 Bacteria 23911
26 Ga0466709_227574 3300042648 Bacteria 4165
27 Ga0466727_232018 3300042655 Bacteria 11620
28 Ga0466727_300785 3300042655 Bacteria 6506
29 Ga0466692_087583 3300042591 Bacteria 1633
30 Ga0466701_047815 3300042598 Bacteria 4449
31 Ga0466714_051455 3300042603 Bacteria 64684
32 Ga0466719_279508 3300042606 Bacteria 17811
33 2227441904 2225789004 Bacteria 25895
34 JGI24702J35022_10004946 3300002462 Bacteria 7858
35 Ga0068305_10063539 3300005083 Bacteria 7219
36 Ga0123353_10277839 3300010167 Bacteria 2575
37 Ga0123353_10841329 3300010167 Bacteria 1259
38 Ga0466703_028614 3300042636 Bacteria 7924
39 Ga0466703_039914 3300042636 Bacteria 11018
40 Ga0466703_117432 3300042636 Bacteria 21621
41 Ga0466703_250543 3300042636 Bacteria 6655
42 Ga0466656_329958 3300042550 Bacteria 10511
43 Ga0466693_335172 3300042592 Bacteria 3445
44 Ga0466696_269250 3300042596 Bacteria 19487
45 Ga0466707_250907 3300042601 Bacteria 1628
46 Ga0466713_155470 3300042602 Bacteria 25745
47 Ga0466719_257068 3300042606 Bacteria 36236
48 Ga0466705_058527 3300042612 Unclassified 6807
49 Ga0466705_267995 3300042612 Bacteria 14205
50 Ga0466733_028446 3300042659 Bacteria 1415
51 JGI24705J35276_12235740 3300002504 Bacteria 6917
52 Ga0123357_10054822 3300009784 Bacteria 5372
53 Ga0466715_033896 3300042616 Bacteria 4415
54 Ga0466715_237264 3300042616 Bacteria 3961
55 Ga0466715_604876 3300042616 Bacteria 36456
56 Ga0466723_074520 3300042618 Bacteria 36085
57 Ga0466723_089568 3300042618 Bacteria 54083
58 Ga0466723_248982 3300042618 Bacteria 4462
59 Ga0466728_448938 3300042620 Bacteria 10195
60 Ga0466704_093536 3300042643 Bacteria 7645
61 Ga0466704_388102 3300042643 Bacteria 9893
62 Ga0466693_424275 3300042592 Bacteria 3340
63 Ga0466706_290038 3300042599 Bacteria 12734
64 Ga0466707_155766 3300042601 Bacteria 11899
65 Ga0466707_163091 3300042601 Bacteria 4348
66 Ga0466716_109340 3300042605 Bacteria 13870
67 Ga0466719_003688 3300042606 Bacteria 5836
68 Ga0466705_074040 3300042612 Bacteria 4422
69 Ga0068305_10052678 3300005083 Bacteria 5310
70 Ga0068305_10163676 3300005083 Unclassified 3505
71 Ga0466723_072995 3300042618 Bacteria 71631
72 Ga0466726_260724 3300042619 Unclassified 1525
73 Ga0466726_368480 3300042619 Bacteria 1901
74 Ga0466726_470728 3300042619 Bacteria 3406
75 Ga0466728_447081 3300042620 Bacteria 2849
76 Ga0466735_078155 3300042624 Bacteria 8952
77 Ga0466704_237712 3300042643 Bacteria 7600
78 Ga0466708_095361 3300042652 Bacteria 44869
79 Ga0466725_402399 3300042654 Bacteria 10607
80 Ga0466690_387937 3300042590 Bacteria 8988
81 Ga0466696_196489 3300042596 Bacteria 1950
82 Ga0466713_115337 3300042602 Bacteria 64305
83 Ga0466716_354165 3300042605 Bacteria 8640
84 Ga0466722_053718 3300042609 Bacteria 1738
85 Ga0466705_001839 3300042612 Bacteria 4250
86 Ga0466733_046473 3300042659 Bacteria 56769
87 Ga0466733_130937 3300042659 Bacteria 27936
88 IMNBL1DRAFT_c0006722 3300000062 Unclassified 6224
89 JGI24702J35022_10000812 3300002462 Bacteria 19310
90 JGI24702J35022_10027202 3300002462 Bacteria 3077
91 Ga0466711_171381 3300042615 Bacteria 9311
92 Ga0466711_238407 3300042615 Bacteria 19267
93 Ga0466704_077855 3300042643 Bacteria 18698
94 Ga0466708_034651 3300042652 Bacteria 10222
95 Ga0466708_283509 3300042652 Bacteria 36560
96 Ga0466727_261979 3300042655 Bacteria 2404
97 Ga0466690_120487 3300042590 Bacteria 49787
98 Ga0466706_061089 3300042599 Bacteria 16571
99 Ga0466700_467341 3300042600 Bacteria 1949
100 Ga0466714_001728 3300042603 Bacteria 35313
101 IMNBL1DRAFT_c0001271 3300000062 Bacteria 19012
102 Ga0466703_007800 3300042636 Bacteria 7419
103 Ga0466703_209065 3300042636 Bacteria 24986
104 Ga0466703_350774 3300042636 Bacteria 6452
105 Ga0466704_066134 3300042643 Bacteria 4079
106 Ga0466704_565073 3300042643 Bacteria 2708
107 Ga0466727_220841 3300042655 Bacteria 5091
108 Ga0466727_228319 3300042655 Bacteria 10404
109 Ga0466727_238759 3300042655 Bacteria 22004
110 Ga0466690_088762 3300042590 Bacteria 9583
111 Ga0466690_314971 3300042590 Bacteria 5469
112 Ga0466690_350930 3300042590 Bacteria 4194
113 Ga0466719_308494 3300042606 Bacteria 8627
114 Ga0466719_440367 3300042606 Bacteria 3345
115 Ga0466719_449225 3300042606 Bacteria 5305

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_155766 Ga0466707_155766_3034_4041 317
2 3300042636 Ga0466703_117432 Ga0466703_117432_12967_13974 329
3 3300042636 Ga0466703_209065 Ga0466703_209065_6146_7162 329
4 3300042606 Ga0466719_279508 Ga0466719_279508_16137_17156 330
5 3300042616 Ga0466715_237264 Ga0466715_237264_2550_3542 330
6 iso_pr_bacteria 2820332331 2820333477 330
7 3300042596 Ga0466696_033419 Ga0466696_033419_26565_27560 331
8 3300042599 Ga0466706_061089 Ga0466706_061089_2636_3631 331
9 3300042599 Ga0466706_290038 Ga0466706_290038_9733_10728 331
10 3300042603 Ga0466714_051455 Ga0466714_051455_19476_20474 332
11 3300042659 Ga0466733_028446 Ga0466733_028446_357_1355 332
12 3300042590 Ga0466690_314971 Ga0466690_314971_733_1734 333
13 3300042619 Ga0466726_213518 Ga0466726_213518_117_1133 333
14 3300042619 Ga0466726_260724 Ga0466726_260724_124_1125 333
15 3300042620 Ga0466728_447081 Ga0466728_447081_540_1541 333
16 3300042643 Ga0466704_097641 Ga0466704_097641_2866_3867 333
17 3300042652 Ga0466708_034651 Ga0466708_034651_7180_8181 333
18 3300042655 Ga0466727_238759 Ga0466727_238759_17349_18350 333
19 3300042603 Ga0466714_001728 Ga0466714_001728_4592_5596 334
20 3300042618 Ga0466723_074520 Ga0466723_074520_625_1629 334
21 3300042659 Ga0466733_021641 Ga0466733_021641_51_1055 334
22 3300005083 Ga0068305_10163676 Ga0068305_101636764 335
23 3300010167 Ga0123353_10277839 Ga0123353_102778392 335
24 3300042601 Ga0466707_210372 Ga0466707_210372_7256_8263 335
25 3300042601 Ga0466707_250907 Ga0466707_250907_372_1379 335
26 3300042609 Ga0466722_266178 Ga0466722_266178_216_1223 335
27 3300042615 Ga0466711_029466 Ga0466711_029466_3338_4345 335
28 3300042616 Ga0466715_033896 Ga0466715_033896_549_1556 335
29 3300042616 Ga0466715_525875 Ga0466715_525875_2457_3464 335
30 iso_pr_bacteria 2820751898 2820751970 335
31 3300005083 Ga0068305_10063539 Ga0068305_100635396 336
32 3300042550 Ga0466656_329958 Ga0466656_329958_6033_7043 336
33 3300042590 Ga0466690_088762 Ga0466690_088762_2207_3217 336
34 3300042602 Ga0466713_133892 Ga0466713_133892_346_1356 336
35 3300042602 Ga0466713_155470 Ga0466713_155470_12094_13104 336
36 3300042606 Ga0466719_449225 Ga0466719_449225_2343_3353 336
37 3300042612 Ga0466705_001839 Ga0466705_001839_1593_2603 336
38 3300042612 Ga0466705_145571 Ga0466705_145571_2558_3568 336
39 3300042612 Ga0466705_267995 Ga0466705_267995_4765_5775 336
40 3300042616 Ga0466715_212319 Ga0466715_212319_31560_32570 336
41 3300042616 Ga0466715_604876 Ga0466715_604876_11764_12774 336
42 3300042619 Ga0466726_470728 Ga0466726_470728_1978_2988 336
43 3300042620 Ga0466728_448938 Ga0466728_448938_7548_8558 336
44 3300042624 Ga0466735_078155 Ga0466735_078155_6174_7184 336
45 3300042636 Ga0466703_377225 Ga0466703_377225_55_1065 336
46 3300042643 Ga0466704_066134 Ga0466704_066134_750_1760 336
47 3300042643 Ga0466704_237712 Ga0466704_237712_4709_5719 336
48 3300042654 Ga0466725_402399 Ga0466725_402399_5073_6083 336
49 3300042655 Ga0466727_220841 Ga0466727_220841_3969_4979 336
50 3300042655 Ga0466727_228319 Ga0466727_228319_5467_6477 336
51 iso_pr_bacteria 2695420317 2695484327 336
52 iso_pr_bacteria 2873600114 2873601469 336
53 iso_pr_bacteria 2873610414 2873611828 336
54 iso_pr_bacteria 2910949487 2910952172 336
55 iso_pr_bacteria 2940193328 2940194758 336
56 iso_pr_bacteria 2940336608 2940338035 336
57 iso_pr_bacteria 8100157865 8100159469 336
58 2225789004 2227491304 2227963569 337
59 3300042590 Ga0466690_120487 Ga0466690_120487_40397_41410 337
60 3300042596 Ga0466696_196489 Ga0466696_196489_533_1546 337
61 3300042596 Ga0466696_269250 Ga0466696_269250_9798_10811 337
62 3300042605 Ga0466716_109340 Ga0466716_109340_9129_10142 337
63 3300042606 Ga0466719_308494 Ga0466719_308494_2004_3017 337
64 3300042612 Ga0466705_058527 Ga0466705_058527_3612_4625 337
65 3300042612 Ga0466705_074040 Ga0466705_074040_1120_2133 337
66 3300042612 Ga0466705_365057 Ga0466705_365057_9145_10158 337
67 3300042618 Ga0466723_072995 Ga0466723_072995_25447_26460 337
68 3300042619 Ga0466726_048383 Ga0466726_048383_21508_22521 337
69 3300042636 Ga0466703_039914 Ga0466703_039914_2075_3088 337
70 3300042643 Ga0466704_096661 Ga0466704_096661_3419_4432 337
71 3300042643 Ga0466704_565073 Ga0466704_565073_1339_2352 337
72 3300042648 Ga0466709_227574 Ga0466709_227574_1059_2072 337
73 3300042648 Ga0466709_262791 Ga0466709_262791_4755_5768 337
74 3300042652 Ga0466708_283509 Ga0466708_283509_27286_28299 337
75 3300042655 Ga0466727_232018 Ga0466727_232018_1825_2838 337
76 3300000062 IMNBL1DRAFT_c0001271 IMNBL1DRAFT_000127114 338
77 3300000062 IMNBL1DRAFT_c0006722 IMNBL1DRAFT_00067225 338
78 3300042590 Ga0466690_350930 Ga0466690_350930_2189_3205 338
79 3300042592 Ga0466693_335172 Ga0466693_335172_934_1950 338
80 3300042592 Ga0466693_424275 Ga0466693_424275_1396_2412 338
81 3300042598 Ga0466701_047815 Ga0466701_047815_1325_2341 338
82 3300042602 Ga0466713_115337 Ga0466713_115337_59328_60344 338
83 3300042606 Ga0466719_257068 Ga0466719_257068_23366_24382 338
84 3300042615 Ga0466711_171381 Ga0466711_171381_4457_5473 338
85 3300042619 Ga0466726_259504 Ga0466726_259504_5779_6795 338
86 3300042636 Ga0466703_007800 Ga0466703_007800_4710_5726 338
87 3300042643 Ga0466704_077855 Ga0466704_077855_5052_6068 338
88 3300042659 Ga0466733_046473 Ga0466733_046473_3554_4570 338
89 3300002504 JGI24705J35276_12235740 JGI24705J35276_122357403 339
90 3300010167 Ga0123353_10841329 Ga0123353_108413292 339
91 3300042590 Ga0466690_387937 Ga0466690_387937_6530_7549 339
92 3300042602 Ga0466713_036270 Ga0466713_036270_11969_12988 339
93 3300042624 Ga0466735_064782 Ga0466735_064782_590_1609 339
94 3300042636 Ga0466703_028614 Ga0466703_028614_819_1838 339
95 3300042652 Ga0466708_095361 Ga0466708_095361_28692_29711 339
96 3300042655 Ga0466727_300785 Ga0466727_300785_3919_4938 339
97 iso_pr_bacteria 2940202316 2940202496 339
98 2225789004 2227441904 2227880120 340
99 3300002462 JGI24702J35022_10000812 JGI24702J35022_100008129 340
100 3300002462 JGI24702J35022_10027202 JGI24702J35022_100272023 340
101 3300005083 Ga0068305_10052678 Ga0068305_100526783 340
102 3300042609 Ga0466722_053718 Ga0466722_053718_266_1288 340
103 3300042616 Ga0466715_032297 Ga0466715_032297_26584_27606 340
104 3300042600 Ga0466700_467341 Ga0466700_467341_297_1322 341
105 3300042603 Ga0466714_114809 Ga0466714_114809_303_1328 341
106 3300042622 Ga0466731_228714 Ga0466731_228714_1187_2212 341
107 3300042636 Ga0466703_350774 Ga0466703_350774_2371_3396 341
108 3300042591 Ga0466692_087583 Ga0466692_087583_345_1373 342
109 3300042615 Ga0466711_365295 Ga0466711_365295_1433_2461 342
110 3300042618 Ga0466723_248982 Ga0466723_248982_1626_2654 342
111 3300042619 Ga0466726_368480 Ga0466726_368480_428_1456 342
112 3300042659 Ga0466733_130937 Ga0466733_130937_8749_9777 342
113 3300042618 Ga0466723_089568 Ga0466723_089568_52306_53340 344
114 3300002462 JGI24702J35022_10004946 JGI24702J35022_100049465 345
115 3300042615 Ga0466711_238407 Ga0466711_238407_15710_16747 345
116 3300042606 Ga0466719_003688 Ga0466719_003688_837_1877 346
117 3300042596 Ga0466696_338446 Ga0466696_338446_331_1386 351
118 3300042601 Ga0466707_163091 Ga0466707_163091_695_1756 353
119 3300042636 Ga0466703_250543 Ga0466703_250543_4810_5886 358
120 3300042643 Ga0466704_093536 Ga0466704_093536_5734_6816 360
121 3300042655 Ga0466727_261979 Ga0466727_261979_622_1707 361
122 3300042605 Ga0466716_354165 Ga0466716_354165_1676_2764 362
123 3300009784 Ga0123357_10054822 Ga0123357_100548222 368
124 3300042643 Ga0466704_388102 Ga0466704_388102_1442_2593 383
125 3300042606 Ga0466719_440367 Ga0466719_440367_1010_2194 394

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01515 PTA_PTB Phosphate acetyl/butaryl transferase 3 325 0.98

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01515 GO:0016746 acyltransferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.93 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.