Protein Family IF05894

Metagenome Isolate
258 Members
208 Samples
115 Scaffolds
262.66 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_208675|Ga0466707_208675_990_1904
Length
304 aa
Sequence
LIIESKAKRKFIRVNFLFFAKKRIMTRNDFTIRKLEKLMRLLFIGDVVGSLGRTQITEYVPRLKRKYHPQLTIINGENAASGRGITEKIYKKFLQDGADVVTMGNHTWDNRDIFEFIDDAKKLVRPANFPEDTTPGQGIVYIKVNTVEVAVINLQGRTFMNDLDDPFRKIEAMVDEAKKRTPIVFVDFHAETTSEKQAMGWWLDGKASAVVGTHTHVQTNDARILPGGTGYLTDVGMTGPYDGILGMKRDAVINKFITALPNRFEVVEEGRFILSGVVIDIDDVTGKTKKMELVQISDDRPFRE

📊 Sample Types

Isolate 55.4%
Metagenome 44.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 21.4%
Apidae 11.5%
Formicidae 10.9%
Termitidae 9.4%
Blattidae 6.8%
Kalotermitidae 5.2%
Halictidae 4.7%
Scarabaeidae 4.2%
Tenebrionidae 3.6%
Pyralidae 3.1%
Elmidae 3.1%
Bombycidae 1.6%
Drosophilidae 1.6%
Termopsidae 1.0%
Culicidae 1.0%
Rhinotermitidae 1.0%
Passalidae 1.0%
Calliphoridae 0.5%
Vespidae 0.5%
Armadillidiidae 0.5%
Hodotermitidae 0.5%
Dytiscidae 0.5%
Ocypodidae 0.5%
Gomphidae 0.5%
Nephropidae 0.5%
Libellulidae 0.5%
Hydrophilidae 0.5%
Noctuidae 0.5%
Eresidae 0.5%
Cicadellidae 0.5%
Curculionidae 0.5%
Portunidae 0.5%
Penaeidae 0.5%
Euphausiidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 242
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
2 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
3 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
4 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
5 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
6 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
7 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
8 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
9 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
10 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
11 2595698193 Melissococcus plutonius B5 Isolate Apidae
12 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
13 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
14 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
15 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
16 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
17 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
18 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
23 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
24 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
25 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
26 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
27 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
28 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
29 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
33 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
34 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
35 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
36 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
37 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
38 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
39 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
40 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
41 2595698195 Melissococcus plutonius 119 Isolate Apidae
42 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
43 2978778678 Bacillus cereus 25 Isolate Ocypodidae
44 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
45 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
46 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
47 641736255 Paenibacillus larvae larvae BRL-230010 Isolate Unclassified
48 8007223943 Enterococcus sp. MSG2901 Isolate
49 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
50 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
51 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
52 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
53 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
54 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
55 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
56 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
57 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
58 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
59 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
60 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
61 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
62 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
63 2864909992 Bacillus velezensis S00166 Isolate Elmidae
64 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
65 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
66 2508501067 Opitutaceae bacterium TAV1 Isolate Unclassified
67 2595698199 Melissococcus plutonius 60 Isolate Apidae
68 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
69 2820010479 Unclassified Spirochaetes Th196P4bin55 Isolate Unclassified
70 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
71 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
72 3300006995 Ant gut microbial communities from Cephalotes angustus, Brazil Metagenome Formicidae
73 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
74 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
75 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
76 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
77 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
78 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
79 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
80 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
81 8007237282 Enterococcus sp. DIV0212c Isolate
82 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
83 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
84 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
85 8066802609 Apilactobacillus timberlakei HV_09 Isolate Halictidae
86 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
87 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
88 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
89 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
90 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
91 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
92 2864895409 Bacillus aerius S00152 Isolate Elmidae
93 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
94 2916858470 Heyndrickxia oleronia Isolate Unclassified
95 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
96 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
97 2940377351 Ereboglobus sp. PH5-5 Isolate Blattidae
98 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
99 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
100 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
101 2595698197 Melissococcus plutonius H6 Isolate Apidae
102 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
103 2820215626 Unclassified Kiritimatiellaeota Nt197P3bin123 Isolate Unclassified
104 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
105 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
106 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
107 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
108 8022725327 Bacillus sp. SN10 Isolate Eresidae
109 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
110 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
111 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
112 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
113 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
114 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
115 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
116 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
117 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
118 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
119 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
120 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
121 2595698198 Melissococcus plutonius L9 Isolate Apidae
122 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
123 2718218463 Candidatus Phytoplasma M3 Isolate Cicadellidae
124 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
125 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
126 2603880164 Opitutus sp. Isolate Formicidae
127 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
128 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
129 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
130 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
131 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
132 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
133 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
134 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
135 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
136 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
137 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
138 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
139 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
140 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
141 8114555646 Enterococcus sp. DIV1094 Isolate
142 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
143 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
144 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
145 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
146 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
147 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
148 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
149 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
150 2627853628 Melissococcus plutonius 82 Isolate Apidae
151 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
152 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
153 2820426531 Unclassified Firmicutes Lab288P3bin45 Isolate Unclassified
154 2969145278 Bacillus cereus 29 Isolate Portunidae
155 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
156 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
157 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
158 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
159 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
160 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
161 8064008355 Heyndrickxia oleronia Isolate Unclassified
162 8082023105 Niallia sp. Man26 Isolate Penaeidae
163 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
164 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
165 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
166 2537562000 Bacillus cereus HD73 Isolate Pyralidae
167 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
168 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
169 2706794701 Opitutaceae bacterium TSB47 Isolate Rhinotermitidae
170 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
171 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
172 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
173 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
174 2687453757 Opitutus sp. Cag34 Isolate Unclassified
175 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
176 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
177 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
178 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
179 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
180 8108568626 Enterococcus sp. DIV1094 Isolate
181 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
182 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
183 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
184 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
185 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
186 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
187 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
188 2864801025 Bacillus aerius S00042 Isolate Elmidae
189 2940239174 Ereboglobus sp. PH5-10 Isolate Blattidae
190 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
191 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
192 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
193 2819998259 Unclassified Spirochaetes Nc150P4bin23 Isolate Unclassified
194 2820323050 Unclassified Firmicutes Nt197P3bin84 Isolate Unclassified
195 2820565217 Unclassified Firmicutes Emb289P3bin51 Isolate Unclassified
196 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
197 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
198 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
199 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
200 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
201 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
202 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
203 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
204 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
205 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
206 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
207 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
208 8077780672 Enterococcus sp. PLM3 Isolate Formicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562377_0015 3300056842 Bacteria 1211570
2 Ga0562377_0125 3300056842 Unclassified 229183
3 Ga0466701_004506 3300042598 Bacteria 2184
4 Ga0466706_193513 3300042599 Bacteria 2585
5 Ga0466707_290136 3300042601 Bacteria 242153
6 Ga0123356_10001957 3300010049 Bacteria 22299
7 Ga0123356_10751703 3300010049 Bacteria 1145
8 Ga0466734_154610 3300042623 Bacteria 1626
9 IMNBL1DRAFT_c0044480 3300000062 Bacteria 1459
10 Ga0063521_1000113 3300003973 Bacteria 64023
11 Ga0102737_1000026 3300007142 Unclassified 42067
12 Ga0530661_000001 3300056564 Bacteria 684835
13 Ga0562375_0408 3300056856 Unclassified 95350
14 Ga0562374_0387 3300057007 Bacteria 80582
15 Ga0562374_0414 3300057007 Bacteria 75597
16 Ga0160467_100277 3300012829 Bacteria 60023
17 Ga0466691_063737 3300042593 Bacteria 4065
18 Ga0466699_246878 3300042597 Bacteria 1056
19 Ga0466705_497786 3300042612 Bacteria 3011
20 Ga0466723_075120 3300042618 Unclassified 7924
21 Ga0123354_10227681 3300010882 Bacteria 1959
22 Ga0160464_100450 3300012805 Bacteria 30731
23 Ga0466730_031875 3300042625 Unclassified 5555
24 Ga0466704_412583 3300042643 Bacteria 2086
25 Ga0466724_28917 3300042649 Bacteria 19936
26 CVPL010W_10000615 3300002931 Unclassified 52736
27 CVPL010L_1000219 3300002932 Bacteria 36026
28 Ga0102737_1001419 3300007142 Unclassified 6687
29 Ga0103264_1015614 3300007188 Bacteria 3722
30 Ga0562374_0043 3300057007 Bacteria 619745
31 Ga0160470_100221 3300012813 Bacteria 45830
32 Ga0466707_052067 3300042601 Bacteria 23021
33 Ga0103266_1000044 3300007067 Bacteria 89495
34 Ga0103260_1000014 3300007139 Bacteria 144579
35 Ga0102738_1000007 3300007141 Bacteria 181972
36 Ga0466696_023199 3300042596 Bacteria 4542
37 Ga0466715_181736 3300042616 Bacteria 16690
38 Ga0466701_063665 3300042598 Bacteria 121183
39 Ga0123353_10006321 3300010167 Bacteria 15757
40 Ga0123354_10045733 3300010882 Bacteria 6694
41 Ga0466703_140616 3300042636 Bacteria 140725
42 Ga0466704_381127 3300042643 Bacteria 10522
43 2212577964 2209111004 Bacteria 14042
44 Ga0103264_1000002 3300007188 Bacteria 175283
45 Ga0562379_0080 3300056790 Bacteria 355260
46 Ga0562375_2386 3300056856 Unclassified 21240
47 Ga0562374_2309 3300057007 Bacteria 17297
48 Ga0466690_154542 3300042590 Bacteria 4723
49 Ga0466693_174245 3300042592 Bacteria 1500
50 Ga0466696_494919 3300042596 Bacteria 2487
51 Ga0466719_232323 3300042606 Bacteria 4754
52 Ga0123356_10026042 3300010049 Bacteria 5497
53 Ga0123356_10450039 3300010049 Bacteria 1436
54 Ga0123353_10112143 3300010167 Bacteria 4391
55 Ga0123354_10037585 3300010882 Bacteria 7534
56 Ga0466731_374433 3300042622 Bacteria 1080
57 Ga0466704_045229 3300042643 Bacteria 2687
58 Ga0466704_169276 3300042643 Unclassified 3172
59 Ga0102733_100004 3300006995 Bacteria 97031
60 Ga0102734_1000008 3300007129 Bacteria 101019
61 Ga0102734_1000084 3300007129 Bacteria 29145
62 Ga0102738_1000011 3300007141 Bacteria 105735
63 Ga0562377_0158 3300056842 Bacteria 193446
64 Ga0562375_0023 3300056856 Bacteria 872828
65 Ga0562375_4121 3300056856 Unclassified 11796
66 Ga0466690_064203 3300042590 Bacteria 3562
67 Ga0466694_279800 3300042594 Bacteria 1436
68 Ga0466726_458655 3300042619 Bacteria 1192
69 Ga0466706_042500 3300042599 Bacteria 2166
70 Ga0466706_194198 3300042599 Bacteria 1734
71 Ga0466707_208675 3300042601 Bacteria 2033
72 Ga0466707_219885 3300042601 Bacteria 7683
73 Ga0466717_303618 3300042604 Bacteria 23665
74 Ga0123355_10007748 3300009826 Bacteria 16144
75 Ga0123353_10384459 3300010167 Bacteria 2097
76 Ga0160454_100018 3300012798 Bacteria 326271
77 IMNBL1DRAFT_c0025968 3300000062 Bacteria 2235
78 JGI24702J35022_10001719 3300002462 Bacteria 13580
79 Ga0068302_10028201 3300005071 Bacteria 9030
80 Ga0102736_1000106 3300007052 Bacteria 26068
81 Ga0103265_1000355 3300007068 Unclassified 21034
82 Ga0102735_1000030 3300007080 Bacteria 73717
83 Ga0102734_1000770 3300007129 Bacteria 8616
84 Ga0102740_1003945 3300007140 Bacteria 3046
85 Ga0103268_1001540 3300007192 Unclassified 10722
86 Ga0466733_094152 3300042659 Bacteria 7017
87 Ga0562378_0065 3300056814 Bacteria 305440
88 Ga0562375_0018 3300056856 Bacteria 940838
89 Ga0562375_0036 3300056856 Bacteria 609533
90 Ga0562375_2061 3300056856 Bacteria 23875
91 Ga0160441_100198 3300012825 Bacteria 61024
92 Ga0466705_431417 3300042612 Bacteria 4673
93 Ga0466710_429343 3300042613 Bacteria 1196
94 Ga0466723_325627 3300042618 Bacteria 23501
95 Ga0466713_019720 3300042602 Bacteria 7410
96 Ga0466717_064403 3300042604 Bacteria 1576
97 Ga0123353_10321112 3300010167 Bacteria 2350
98 Ga0466734_148746 3300042623 Bacteria 1236
99 Ga0466704_400434 3300042643 Unclassified 4020
100 Ga0103261_1000031 3300007083 Bacteria 447718
101 Ga0103267_1000185 3300007190 Unclassified 24474
102 Ga0562377_0062 3300056842 Bacteria 463693
103 Ga0562375_0091 3300056856 Bacteria 283318
104 Ga0466711_174949 3300042615 Bacteria 1965
105 Ga0466723_147657 3300042618 Bacteria 3647
106 Ga0466706_075785 3300042599 Bacteria 15657
107 Ga0466713_121316 3300042602 Bacteria 3774
108 Ga0466722_105906 3300042609 Unclassified 2199
109 Ga0466697_002273 3300042611 Bacteria 11478
110 Ga0123353_10894662 3300010167 Bacteria 1210
111 2227091917 2225789004 Bacteria 9842
112 IMNBL1DRAFT_c0000049 3300000062 Bacteria 112752
113 CVPL005L_10013363 3300002938 Unclassified 5853
114 Ga0103263_100075 3300007042 Bacteria 55291
115 Ga0103267_1000518 3300007190 Bacteria 12186

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009826 Ga0123355_10007748 Ga0123355_1000774815 234
2 3300042636 Ga0466703_140616 Ga0466703_140616_19165_19875 236
3 iso_pr_bacteria 2523231078 2523495179 243
4 iso_pr_bacteria 2849099867 2849102601 243
5 iso_pr_bacteria 2849104611 2849107358 243
6 iso_pr_bacteria 2850744690 2850746801 243
7 iso_pr_bacteria 641736255 641741629 243
8 iso_pr_bacteria 2940221333 2940222212 244
9 iso_pr_bacteria 2940380068 2940382587 244
10 iso_pr_bacteria 2940386776 2940389105 244
11 iso_pr_bacteria 2940393498 2940395821 244
12 iso_pr_bacteria 2940400224 2940402556 244
13 iso_pr_bacteria 2940406939 2940409084 244
14 iso_pr_bacteria 2940413413 2940415800 244
15 iso_pr_bacteria 2940419646 2940422356 244
16 iso_pr_bacteria 2940425923 2940428709 244
17 3300042622 Ga0466731_374433 Ga0466731_374433_19_756 245
18 3300012829 Ga0160467_100277 Ga0160467_10027735 250
19 3300000062 IMNBL1DRAFT_c0000049 IMNBL1DRAFT_000004936 252
20 3300007129 Ga0102734_1000008 Ga0102734_100000852 252
21 iso_pr_bacteria 2718218463 2721569878 253
22 3300012825 Ga0160441_100198 Ga0160441_10019842 254
23 3300042599 Ga0466706_042500 Ga0466706_042500_1171_1935 254
24 3300042599 Ga0466706_075785 Ga0466706_075785_7030_7797 255
25 iso_pr_bacteria 2820477775 2820479614 256
26 3300042599 Ga0466706_193513 Ga0466706_193513_1696_2469 257
27 3300042659 Ga0466733_094152 Ga0466733_094152_2787_3560 257
28 3300056842 Ga0562377_0062 Ga0562377_0062_10859_11632 257
29 iso_pr_bacteria 646311952 646429712 257
30 3300042592 Ga0466693_174245 Ga0466693_174245_455_1231 258
31 3300042597 Ga0466699_246878 Ga0466699_246878_230_1006 258
32 3300042623 Ga0466734_148746 Ga0466734_148746_262_1038 258
33 iso_pr_bacteria 2819998259 2819998658 258
34 iso_pr_bacteria 2820010479 2820011112 258
35 iso_pr_bacteria 2820215626 2820217323 258
36 3300002462 JGI24702J35022_10001719 JGI24702J35022_100017193 259
37 3300010049 Ga0123356_10751703 Ga0123356_107517032 259
38 3300010167 Ga0123353_10112143 Ga0123353_101121433 259
39 3300010167 Ga0123353_10894662 Ga0123353_108946622 259
40 3300010882 Ga0123354_10045733 Ga0123354_100457333 259
41 3300010882 Ga0123354_10227681 Ga0123354_102276812 259
42 3300042604 Ga0466717_303618 Ga0466717_303618_20392_21171 259
43 3300042615 Ga0466711_174949 Ga0466711_174949_552_1331 259
44 3300042616 Ga0466715_181736 Ga0466715_181736_2490_3269 259
45 3300042618 Ga0466723_147657 Ga0466723_147657_2376_3155 259
46 iso_pr_bacteria 2595698190 2596205235 259
47 iso_pr_bacteria 2595698193 2596210642 259
48 iso_pr_bacteria 2595698194 2596213721 259
49 iso_pr_bacteria 2595698195 2596214333 259
50 iso_pr_bacteria 2595698196 2596216146 259
51 iso_pr_bacteria 2595698197 2596217986 259
52 iso_pr_bacteria 2595698198 2596219813 259
53 iso_pr_bacteria 2595698199 2596221629 259
54 iso_pr_bacteria 2627853628 2628279955 259
55 iso_pr_bacteria 2820369699 2820369745 259
56 iso_pr_bacteria 650716050 650844535 259
57 3300042596 Ga0466696_494919 Ga0466696_494919_597_1379 260
58 3300042601 Ga0466707_219885 Ga0466707_219885_5689_6471 260
59 3300042604 Ga0466717_064403 Ga0466717_064403_560_1342 260
60 3300042606 Ga0466719_232323 Ga0466719_232323_2033_2815 260
61 3300042609 Ga0466722_105906 Ga0466722_105906_92_874 260
62 3300042612 Ga0466705_431417 Ga0466705_431417_764_1546 260
63 3300042643 Ga0466704_045229 Ga0466704_045229_621_1403 260
64 3300042643 Ga0466704_169276 Ga0466704_169276_464_1246 260
65 3300042643 Ga0466704_381127 Ga0466704_381127_6787_7569 260
66 iso_pr_bacteria 2603880164 2606011867 260
67 iso_pr_bacteria 2687453757 2690049520 260
68 iso_pr_bacteria 2706794701 2708046562 260
69 iso_pr_bacteria 2820565217 2820565953 260
70 iso_pr_bacteria 2940239174 2940239311 260
71 3300002931 CVPL010W_10000615 CVPL010W_1000061532 261
72 3300002938 CVPL005L_10013363 CVPL005L_100133633 261
73 3300006995 Ga0102733_100004 Ga0102733_1000049 261
74 3300007067 Ga0103266_1000044 Ga0103266_100004416 261
75 3300007068 Ga0103265_1000355 Ga0103265_10003555 261
76 3300007080 Ga0102735_1000030 Ga0102735_100003025 261
77 3300007083 Ga0103261_1000031 Ga0103261_100003182 261
78 3300007129 Ga0102734_1000084 Ga0102734_100008423 261
79 3300007139 Ga0103260_1000014 Ga0103260_100001437 261
80 3300007142 Ga0102737_1000026 Ga0102737_100002641 261
81 3300007142 Ga0102737_1001419 Ga0102737_10014196 261
82 3300007188 Ga0103264_1015614 Ga0103264_10156143 261
83 3300007190 Ga0103267_1000185 Ga0103267_10001851 261
84 3300007192 Ga0103268_1001540 Ga0103268_100154012 261
85 3300010049 Ga0123356_10026042 Ga0123356_100260424 261
86 3300010049 Ga0123356_10450039 Ga0123356_104500392 261
87 3300010882 Ga0123354_10037585 Ga0123354_100375854 261
88 3300042594 Ga0466694_279800 Ga0466694_279800_218_1003 261
89 3300042601 Ga0466707_290136 Ga0466707_290136_114645_115430 261
90 3300042611 Ga0466697_002273 Ga0466697_002273_4799_5584 261
91 3300042613 Ga0466710_429343 Ga0466710_429343_22_807 261
92 iso_pr_bacteria 2630968413 2631702654 261
93 iso_pr_bacteria 2758568557 2760422064 261
94 iso_pr_bacteria 2758568559 2760425939 261
95 iso_pr_bacteria 2758568560 2760427871 261
96 iso_pr_bacteria 2758568561 2760428972 261
97 iso_pr_bacteria 2808606958 2811757625 261
98 iso_pr_bacteria 2820323050 2820323794 261
99 iso_pr_bacteria 2851412233 2851412465 261
100 iso_pr_bacteria 2956926959 2956927007 261
101 iso_pr_bacteria 2956928875 2956930688 261
102 iso_pr_bacteria 2956930723 2956931723 261
103 iso_pr_bacteria 8001918023 8001918307 261
104 3300010049 Ga0123356_10001957 Ga0123356_100019579 262
105 iso_pr_bacteria 2820426531 2820426556 262
106 3300010167 Ga0123353_10006321 Ga0123353_1000632113 263
107 2209111004 2212577964 2212422315 264
108 3300042599 Ga0466706_194198 Ga0466706_194198_29_823 264
109 3300042625 Ga0466730_031875 Ga0466730_031875_4728_5522 264
110 3300056842 Ga0562377_0158 Ga0562377_0158_12380_13174 264
111 3300056856 Ga0562375_0023 Ga0562375_0023_245507_246301 264
112 3300057007 Ga0562374_0043 Ga0562374_0043_128097_128891 264
113 iso_pr_bacteria 2537562000 2539434744 264
114 iso_pr_bacteria 2563367190 2565791318 264
115 iso_pr_bacteria 2791355481 2794423948 264
116 iso_pr_bacteria 2822232166 2822233103 264
117 iso_pr_bacteria 2822450720 2822451786 264
118 iso_pr_bacteria 2827179085 2827184866 264
119 iso_pr_bacteria 2852431164 2852431346 264
120 iso_pr_bacteria 2864782175 2864784690 264
121 iso_pr_bacteria 2864801025 2864802888 264
122 iso_pr_bacteria 2864895409 2864896621 264
123 iso_pr_bacteria 2864909992 2864910878 264
124 iso_pr_bacteria 2912849059 2912852856 264
125 iso_pr_bacteria 2916873227 2916880488 264
126 iso_pr_bacteria 2940377351 2940377630 264
127 iso_pr_bacteria 2969145278 2969149624 264
128 iso_pr_bacteria 2971438493 2971440029 264
129 iso_pr_bacteria 2978778678 2978779461 264
130 iso_pr_bacteria 643886085 644681066 264
131 iso_pr_bacteria 643886087 644668789 264
132 iso_pr_bacteria 643886090 644662685 264
133 iso_pr_bacteria 643886091 644649744 264
134 iso_pr_bacteria 8018750880 8018754674 264
135 iso_pr_bacteria 8018754795 8018758595 264
136 iso_pr_bacteria 8022725327 8022726331 264
137 iso_pr_bacteria 8022781829 8022785829 264
138 iso_pr_bacteria 8043041867 8043042999 264
139 iso_pr_bacteria 8061039349 8061044106 264
140 iso_pr_bacteria 8061045771 8061046570 264
141 iso_pr_bacteria 8061100935 8061102172 264
142 3300003973 Ga0063521_1000113 Ga0063521_100011345 265
143 3300012813 Ga0160470_100221 Ga0160470_10022137 265
144 3300042602 Ga0466713_121316 Ga0466713_121316_2375_3172 265
145 3300056790 Ga0562379_0080 Ga0562379_0080_49450_50247 265
146 3300056814 Ga0562378_0065 Ga0562378_0065_195043_195840 265
147 3300056842 Ga0562377_0015 Ga0562377_0015_349046_349843 265
148 3300056842 Ga0562377_0125 Ga0562377_0125_98556_99353 265
149 3300056856 Ga0562375_0018 Ga0562375_0018_150729_151526 265
150 3300056856 Ga0562375_0036 Ga0562375_0036_391435_392232 265
151 3300056856 Ga0562375_0091 Ga0562375_0091_154721_155518 265
152 3300056856 Ga0562375_0408 Ga0562375_0408_56602_57399 265
153 3300056856 Ga0562375_2061 Ga0562375_2061_10482_11279 265
154 3300056856 Ga0562375_2386 Ga0562375_2386_20220_21017 265
155 3300056856 Ga0562375_4121 Ga0562375_4121_1226_2023 265
156 3300057007 Ga0562374_0387 Ga0562374_0387_56721_57518 265
157 3300057007 Ga0562374_0414 Ga0562374_0414_26687_27484 265
158 3300057007 Ga0562374_2309 Ga0562374_2309_14626_15423 265
159 iso_pr_bacteria 2524614537 2524833738 265
160 iso_pr_bacteria 2731957677 2732685627 265
161 iso_pr_bacteria 2740892556 2743948302 265
162 iso_pr_bacteria 2751185832 2753508633 265
163 iso_pr_bacteria 2775507073 2777016061 265
164 iso_pr_bacteria 2825804107 2825805259 265
165 iso_pr_bacteria 2843246524 2843250161 265
166 iso_pr_bacteria 2852123468 2852123476 265
167 iso_pr_bacteria 2855361764 2855362289 265
168 iso_pr_bacteria 2864816158 2864820140 265
169 iso_pr_bacteria 2864981449 2864982550 265
170 iso_pr_bacteria 2890957088 2890958793 265
171 iso_pr_bacteria 2900804455 2900805310 265
172 iso_pr_bacteria 2940218408 2940219029 265
173 iso_pr_bacteria 2940261461 2940262223 265
174 iso_pr_bacteria 647533136 647745953 265
175 iso_pr_bacteria 8002519755 8002521955 265
176 iso_pr_bacteria 8007211731 8007212764 265
177 iso_pr_bacteria 8007215774 8007220094 265
178 iso_pr_bacteria 8007220153 8007221129 265
179 iso_pr_bacteria 8007223943 8007224736 265
180 iso_pr_bacteria 8007237282 8007237560 265
181 iso_pr_bacteria 8012939035 8012942183 265
182 iso_pr_bacteria 8018794549 8018795053 265
183 iso_pr_bacteria 8018798118 8018798354 265
184 iso_pr_bacteria 8018802046 8018803147 265
185 iso_pr_bacteria 8038268975 8038272131 265
186 iso_pr_bacteria 8077780672 8077783326 265
187 iso_pr_bacteria 8082023105 8082024658 265
188 iso_pr_bacteria 8108568626 8108570035 265
189 iso_pr_bacteria 8108576847 8108578548 265
190 iso_pr_bacteria 8114537524 8114540041 265
191 iso_pr_bacteria 8114541043 8114543275 265
192 iso_pr_bacteria 8114544644 8114547571 265
193 iso_pr_bacteria 8114549044 8114550745 265
194 iso_pr_bacteria 8114555646 8114557055 265
195 3300002932 CVPL010L_1000219 CVPL010L_100021934 266
196 3300007141 Ga0102738_1000007 Ga0102738_100000751 266
197 3300012805 Ga0160464_100450 Ga0160464_10045016 266
198 3300042598 Ga0466701_004506 Ga0466701_004506_229_1029 266
199 3300042601 Ga0466707_052067 Ga0466707_052067_5749_6549 266
200 3300042623 Ga0466734_154610 Ga0466734_154610_202_1002 266
201 3300042649 Ga0466724_28917 Ga0466724_28917_3057_3857 266
202 3300056564 Ga0530661_000001 Ga0530661_000001_305354_306154 266
203 iso_pr_bacteria 2558860143 2559001005 266
204 iso_pr_bacteria 2675903377 2677724065 266
205 iso_pr_bacteria 2834951433 2834952737 266
206 iso_pr_bacteria 2857493320 2857496818 266
207 iso_pr_bacteria 2857493320 2857496872 266
208 iso_pr_bacteria 2857498920 2857502116 266
209 iso_pr_bacteria 2873581347 2873582147 266
210 iso_pr_bacteria 2873584433 2873584786 266
211 iso_pr_bacteria 2877522083 2877522990 266
212 iso_pr_bacteria 2881375749 2881377422 266
213 iso_pr_bacteria 2916858470 2916861085 266
214 iso_pr_bacteria 8002299145 8002303410 266
215 iso_pr_bacteria 8002304686 8002305584 266
216 iso_pr_bacteria 8064008355 8064011648 266
217 3300007141 Ga0102738_1000011 Ga0102738_100001169 267
218 iso_pr_bacteria 2881902429 2881903514 267
219 iso_pr_bacteria 2923762712 2923763660 267
220 iso_pr_bacteria 2936628749 2936630188 267
221 iso_pr_bacteria 8066790652 8066791915 267
222 iso_pr_bacteria 8066792404 8066793744 267
223 iso_pr_bacteria 8066794103 8066795098 267
224 iso_pr_bacteria 8066795793 8066797169 267
225 iso_pr_bacteria 8066797744 8066799082 267
226 iso_pr_bacteria 8066799369 8066800565 267
227 iso_pr_bacteria 8066802609 8066803802 267
228 3300007042 Ga0103263_100075 Ga0103263_10007540 268
229 3300007052 Ga0102736_1000106 Ga0102736_100010617 268
230 3300042596 Ga0466696_023199 Ga0466696_023199_143_949 268
231 iso_pr_bacteria 2622736579 2623392400 268
232 2225789004 2227091917 2227471249 269
233 3300042590 Ga0466690_154542 Ga0466690_154542_2608_3417 269
234 3300042618 Ga0466723_075120 Ga0466723_075120_3357_4166 269
235 3300000062 IMNBL1DRAFT_c0025968 IMNBL1DRAFT_00259681 270
236 3300007140 Ga0102740_1003945 Ga0102740_10039452 270
237 3300042593 Ga0466691_063737 Ga0466691_063737_2597_3409 270
238 3300042602 Ga0466713_019720 Ga0466713_019720_3503_4315 270
239 3300042643 Ga0466704_412583 Ga0466704_412583_110_922 270
240 iso_pr_bacteria 2508501067 2508839100 270
241 iso_pr_bacteria 2517572100 2517755668 270
242 iso_pr_bacteria 2639763185 2642347451 270
243 iso_pr_bacteria 2639763186 2642353093 270
244 3300007129 Ga0102734_1000770 Ga0102734_10007703 271
245 3300007188 Ga0103264_1000002 Ga0103264_100000220 271
246 3300007190 Ga0103267_1000518 Ga0103267_10005188 272
247 3300042619 Ga0466726_458655 Ga0466726_458655_217_1035 272
248 3300005071 Ga0068302_10028201 Ga0068302_100282013 273
249 3300010167 Ga0123353_10384459 Ga0123353_103844592 273
250 3300042590 Ga0466690_064203 Ga0466690_064203_1934_2758 274
251 3300042618 Ga0466723_325627 Ga0466723_325627_18583_19407 274
252 3300042643 Ga0466704_400434 Ga0466704_400434_803_1630 275
253 3300042612 Ga0466705_497786 Ga0466705_497786_1430_2260 276
254 3300010167 Ga0123353_10321112 Ga0123353_103211123 278
255 3300000062 IMNBL1DRAFT_c0044480 IMNBL1DRAFT_00444802 284
256 3300012798 Ga0160454_100018 Ga0160454_100018148 288
257 3300042598 Ga0466701_063665 Ga0466701_063665_9432_10304 290
258 3300042601 Ga0466707_208675 Ga0466707_208675_990_1904 304

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13277 YmdB YmdB-like protein 42 292 0.98
PF00149 Metallophos Calcineurin-like phosphoesterase 39 217 0.8

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00149 GO:0016787 hydrolase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.