Protein Family IF05894
Metagenome
Isolate
258
Members
208
Samples
115
Scaffolds
262.66
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_208675|Ga0466707_208675_990_1904
- Length
- 304 aa
- Sequence
- LIIESKAKRKFIRVNFLFFAKKRIMTRNDFTIRKLEKLMRLLFIGDVVGSLGRTQITEYVPRLKRKYHPQLTIINGENAASGRGITEKIYKKFLQDGADVVTMGNHTWDNRDIFEFIDDAKKLVRPANFPEDTTPGQGIVYIKVNTVEVAVINLQGRTFMNDLDDPFRKIEAMVDEAKKRTPIVFVDFHAETTSEKQAMGWWLDGKASAVVGTHTHVQTNDARILPGGTGYLTDVGMTGPYDGILGMKRDAVINKFITALPNRFEVVEEGRFILSGVVIDIDDVTGKTKKMELVQISDDRPFRE
Sample Types
Isolate
55.4%
Metagenome
44.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
21.4%
Apidae
11.5%
Formicidae
10.9%
Termitidae
9.4%
Blattidae
6.8%
Kalotermitidae
5.2%
Halictidae
4.7%
Scarabaeidae
4.2%
Tenebrionidae
3.6%
Pyralidae
3.1%
Elmidae
3.1%
Bombycidae
1.6%
Drosophilidae
1.6%
Termopsidae
1.0%
Culicidae
1.0%
Rhinotermitidae
1.0%
Passalidae
1.0%
Calliphoridae
0.5%
Vespidae
0.5%
Armadillidiidae
0.5%
Hodotermitidae
0.5%
Dytiscidae
0.5%
Ocypodidae
0.5%
Gomphidae
0.5%
Nephropidae
0.5%
Libellulidae
0.5%
Hydrophilidae
0.5%
Noctuidae
0.5%
Eresidae
0.5%
Cicadellidae
0.5%
Curculionidae
0.5%
Portunidae
0.5%
Penaeidae
0.5%
Euphausiidae
0.5%
Taxonomy
Archaea
0
Bacteria
242
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 2 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 3 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 4 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 5 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 6 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 7 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 8 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 9 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 10 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 11 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 12 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 13 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 14 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 15 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 16 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 17 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 18 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 23 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 24 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 25 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 26 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 27 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 28 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 29 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 30 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 34 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 35 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 36 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 37 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 38 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 39 | 2956930723 | Bombilactobacillus bombi LV-8.1 | Isolate | Apidae |
| 40 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 41 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 42 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 43 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 44 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 47 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 48 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 49 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 50 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 51 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 52 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 53 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 54 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 55 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 56 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 57 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 58 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 59 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 60 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 61 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 62 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 63 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 64 | 2881902429 | Companilactobacillus metriopterae JCM 31635 | Isolate | Unclassified |
| 65 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 66 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 67 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 68 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 69 | 2820010479 | Unclassified Spirochaetes Th196P4bin55 | Isolate | Unclassified |
| 70 | 2820477775 | Unclassified Firmicutes Lab288P1bin79 | Isolate | Unclassified |
| 71 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 72 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 73 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 74 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 75 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 76 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 77 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 78 | 8001918023 | Bombilactobacillus bombi XV6 | Isolate | Apidae |
| 79 | 8002304686 | Apilactobacillus kunkeei UASWS1867-NN5 | Isolate | Apidae |
| 80 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 81 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 82 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 83 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 84 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 85 | 8066802609 | Apilactobacillus timberlakei HV_09 | Isolate | Halictidae |
| 86 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 87 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 88 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 89 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 90 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 91 | 2851412233 | Bombilactobacillus bombi BI-2.5 | Isolate | Apidae |
| 92 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 93 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 94 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 95 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 96 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 97 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 98 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 99 | 2558860143 | Apilactobacillus kunkeei EFB6 | Isolate | Apidae |
| 100 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 101 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 102 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 103 | 2820215626 | Unclassified Kiritimatiellaeota Nt197P3bin123 | Isolate | Unclassified |
| 104 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 105 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 106 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 107 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 108 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 109 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 110 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 111 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 112 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 113 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 114 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 115 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 116 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 117 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 118 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 119 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 120 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 121 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 122 | 2630968413 | Bombilactobacillus mellifer Bin4 | Isolate | Unclassified |
| 123 | 2718218463 | Candidatus Phytoplasma M3 | Isolate | Cicadellidae |
| 124 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 125 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 126 | 2603880164 | Opitutus sp. | Isolate | Formicidae |
| 127 | 2675903377 | Apilactobacillus kunkeei AR114 | Isolate | Unclassified |
| 128 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 129 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 130 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 131 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 132 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 133 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 134 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 135 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 136 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 137 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 138 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 139 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 140 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 141 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 142 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 143 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 144 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 145 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 146 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 147 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 148 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 149 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 150 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 151 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 152 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 153 | 2820426531 | Unclassified Firmicutes Lab288P3bin45 | Isolate | Unclassified |
| 154 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 155 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 156 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 157 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 158 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 159 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 160 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 161 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 162 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 163 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 164 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 165 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 166 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 167 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 168 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 169 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 170 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 171 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 172 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 173 | 2820369699 | Unclassified Firmicutes Nt197P3bin103 | Isolate | Unclassified |
| 174 | 2687453757 | Opitutus sp. Cag34 | Isolate | Unclassified |
| 175 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 176 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 177 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 178 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 179 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 180 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 181 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 182 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 183 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 184 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 185 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 186 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 187 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 188 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 189 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 190 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 191 | 2877522083 | Apilactobacillus bombintestini BHWM-4 | Isolate | Apidae |
| 192 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 193 | 2819998259 | Unclassified Spirochaetes Nc150P4bin23 | Isolate | Unclassified |
| 194 | 2820323050 | Unclassified Firmicutes Nt197P3bin84 | Isolate | Unclassified |
| 195 | 2820565217 | Unclassified Firmicutes Emb289P3bin51 | Isolate | Unclassified |
| 196 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 197 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 198 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 199 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 200 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 201 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 202 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 203 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 204 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 205 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 206 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 207 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 208 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0015 | 3300056842 | Bacteria | 1211570 |
| 2 | Ga0562377_0125 | 3300056842 | Unclassified | 229183 |
| 3 | Ga0466701_004506 | 3300042598 | Bacteria | 2184 |
| 4 | Ga0466706_193513 | 3300042599 | Bacteria | 2585 |
| 5 | Ga0466707_290136 | 3300042601 | Bacteria | 242153 |
| 6 | Ga0123356_10001957 | 3300010049 | Bacteria | 22299 |
| 7 | Ga0123356_10751703 | 3300010049 | Bacteria | 1145 |
| 8 | Ga0466734_154610 | 3300042623 | Bacteria | 1626 |
| 9 | IMNBL1DRAFT_c0044480 | 3300000062 | Bacteria | 1459 |
| 10 | Ga0063521_1000113 | 3300003973 | Bacteria | 64023 |
| 11 | Ga0102737_1000026 | 3300007142 | Unclassified | 42067 |
| 12 | Ga0530661_000001 | 3300056564 | Bacteria | 684835 |
| 13 | Ga0562375_0408 | 3300056856 | Unclassified | 95350 |
| 14 | Ga0562374_0387 | 3300057007 | Bacteria | 80582 |
| 15 | Ga0562374_0414 | 3300057007 | Bacteria | 75597 |
| 16 | Ga0160467_100277 | 3300012829 | Bacteria | 60023 |
| 17 | Ga0466691_063737 | 3300042593 | Bacteria | 4065 |
| 18 | Ga0466699_246878 | 3300042597 | Bacteria | 1056 |
| 19 | Ga0466705_497786 | 3300042612 | Bacteria | 3011 |
| 20 | Ga0466723_075120 | 3300042618 | Unclassified | 7924 |
| 21 | Ga0123354_10227681 | 3300010882 | Bacteria | 1959 |
| 22 | Ga0160464_100450 | 3300012805 | Bacteria | 30731 |
| 23 | Ga0466730_031875 | 3300042625 | Unclassified | 5555 |
| 24 | Ga0466704_412583 | 3300042643 | Bacteria | 2086 |
| 25 | Ga0466724_28917 | 3300042649 | Bacteria | 19936 |
| 26 | CVPL010W_10000615 | 3300002931 | Unclassified | 52736 |
| 27 | CVPL010L_1000219 | 3300002932 | Bacteria | 36026 |
| 28 | Ga0102737_1001419 | 3300007142 | Unclassified | 6687 |
| 29 | Ga0103264_1015614 | 3300007188 | Bacteria | 3722 |
| 30 | Ga0562374_0043 | 3300057007 | Bacteria | 619745 |
| 31 | Ga0160470_100221 | 3300012813 | Bacteria | 45830 |
| 32 | Ga0466707_052067 | 3300042601 | Bacteria | 23021 |
| 33 | Ga0103266_1000044 | 3300007067 | Bacteria | 89495 |
| 34 | Ga0103260_1000014 | 3300007139 | Bacteria | 144579 |
| 35 | Ga0102738_1000007 | 3300007141 | Bacteria | 181972 |
| 36 | Ga0466696_023199 | 3300042596 | Bacteria | 4542 |
| 37 | Ga0466715_181736 | 3300042616 | Bacteria | 16690 |
| 38 | Ga0466701_063665 | 3300042598 | Bacteria | 121183 |
| 39 | Ga0123353_10006321 | 3300010167 | Bacteria | 15757 |
| 40 | Ga0123354_10045733 | 3300010882 | Bacteria | 6694 |
| 41 | Ga0466703_140616 | 3300042636 | Bacteria | 140725 |
| 42 | Ga0466704_381127 | 3300042643 | Bacteria | 10522 |
| 43 | 2212577964 | 2209111004 | Bacteria | 14042 |
| 44 | Ga0103264_1000002 | 3300007188 | Bacteria | 175283 |
| 45 | Ga0562379_0080 | 3300056790 | Bacteria | 355260 |
| 46 | Ga0562375_2386 | 3300056856 | Unclassified | 21240 |
| 47 | Ga0562374_2309 | 3300057007 | Bacteria | 17297 |
| 48 | Ga0466690_154542 | 3300042590 | Bacteria | 4723 |
| 49 | Ga0466693_174245 | 3300042592 | Bacteria | 1500 |
| 50 | Ga0466696_494919 | 3300042596 | Bacteria | 2487 |
| 51 | Ga0466719_232323 | 3300042606 | Bacteria | 4754 |
| 52 | Ga0123356_10026042 | 3300010049 | Bacteria | 5497 |
| 53 | Ga0123356_10450039 | 3300010049 | Bacteria | 1436 |
| 54 | Ga0123353_10112143 | 3300010167 | Bacteria | 4391 |
| 55 | Ga0123354_10037585 | 3300010882 | Bacteria | 7534 |
| 56 | Ga0466731_374433 | 3300042622 | Bacteria | 1080 |
| 57 | Ga0466704_045229 | 3300042643 | Bacteria | 2687 |
| 58 | Ga0466704_169276 | 3300042643 | Unclassified | 3172 |
| 59 | Ga0102733_100004 | 3300006995 | Bacteria | 97031 |
| 60 | Ga0102734_1000008 | 3300007129 | Bacteria | 101019 |
| 61 | Ga0102734_1000084 | 3300007129 | Bacteria | 29145 |
| 62 | Ga0102738_1000011 | 3300007141 | Bacteria | 105735 |
| 63 | Ga0562377_0158 | 3300056842 | Bacteria | 193446 |
| 64 | Ga0562375_0023 | 3300056856 | Bacteria | 872828 |
| 65 | Ga0562375_4121 | 3300056856 | Unclassified | 11796 |
| 66 | Ga0466690_064203 | 3300042590 | Bacteria | 3562 |
| 67 | Ga0466694_279800 | 3300042594 | Bacteria | 1436 |
| 68 | Ga0466726_458655 | 3300042619 | Bacteria | 1192 |
| 69 | Ga0466706_042500 | 3300042599 | Bacteria | 2166 |
| 70 | Ga0466706_194198 | 3300042599 | Bacteria | 1734 |
| 71 | Ga0466707_208675 | 3300042601 | Bacteria | 2033 |
| 72 | Ga0466707_219885 | 3300042601 | Bacteria | 7683 |
| 73 | Ga0466717_303618 | 3300042604 | Bacteria | 23665 |
| 74 | Ga0123355_10007748 | 3300009826 | Bacteria | 16144 |
| 75 | Ga0123353_10384459 | 3300010167 | Bacteria | 2097 |
| 76 | Ga0160454_100018 | 3300012798 | Bacteria | 326271 |
| 77 | IMNBL1DRAFT_c0025968 | 3300000062 | Bacteria | 2235 |
| 78 | JGI24702J35022_10001719 | 3300002462 | Bacteria | 13580 |
| 79 | Ga0068302_10028201 | 3300005071 | Bacteria | 9030 |
| 80 | Ga0102736_1000106 | 3300007052 | Bacteria | 26068 |
| 81 | Ga0103265_1000355 | 3300007068 | Unclassified | 21034 |
| 82 | Ga0102735_1000030 | 3300007080 | Bacteria | 73717 |
| 83 | Ga0102734_1000770 | 3300007129 | Bacteria | 8616 |
| 84 | Ga0102740_1003945 | 3300007140 | Bacteria | 3046 |
| 85 | Ga0103268_1001540 | 3300007192 | Unclassified | 10722 |
| 86 | Ga0466733_094152 | 3300042659 | Bacteria | 7017 |
| 87 | Ga0562378_0065 | 3300056814 | Bacteria | 305440 |
| 88 | Ga0562375_0018 | 3300056856 | Bacteria | 940838 |
| 89 | Ga0562375_0036 | 3300056856 | Bacteria | 609533 |
| 90 | Ga0562375_2061 | 3300056856 | Bacteria | 23875 |
| 91 | Ga0160441_100198 | 3300012825 | Bacteria | 61024 |
| 92 | Ga0466705_431417 | 3300042612 | Bacteria | 4673 |
| 93 | Ga0466710_429343 | 3300042613 | Bacteria | 1196 |
| 94 | Ga0466723_325627 | 3300042618 | Bacteria | 23501 |
| 95 | Ga0466713_019720 | 3300042602 | Bacteria | 7410 |
| 96 | Ga0466717_064403 | 3300042604 | Bacteria | 1576 |
| 97 | Ga0123353_10321112 | 3300010167 | Bacteria | 2350 |
| 98 | Ga0466734_148746 | 3300042623 | Bacteria | 1236 |
| 99 | Ga0466704_400434 | 3300042643 | Unclassified | 4020 |
| 100 | Ga0103261_1000031 | 3300007083 | Bacteria | 447718 |
| 101 | Ga0103267_1000185 | 3300007190 | Unclassified | 24474 |
| 102 | Ga0562377_0062 | 3300056842 | Bacteria | 463693 |
| 103 | Ga0562375_0091 | 3300056856 | Bacteria | 283318 |
| 104 | Ga0466711_174949 | 3300042615 | Bacteria | 1965 |
| 105 | Ga0466723_147657 | 3300042618 | Bacteria | 3647 |
| 106 | Ga0466706_075785 | 3300042599 | Bacteria | 15657 |
| 107 | Ga0466713_121316 | 3300042602 | Bacteria | 3774 |
| 108 | Ga0466722_105906 | 3300042609 | Unclassified | 2199 |
| 109 | Ga0466697_002273 | 3300042611 | Bacteria | 11478 |
| 110 | Ga0123353_10894662 | 3300010167 | Bacteria | 1210 |
| 111 | 2227091917 | 2225789004 | Bacteria | 9842 |
| 112 | IMNBL1DRAFT_c0000049 | 3300000062 | Bacteria | 112752 |
| 113 | CVPL005L_10013363 | 3300002938 | Unclassified | 5853 |
| 114 | Ga0103263_100075 | 3300007042 | Bacteria | 55291 |
| 115 | Ga0103267_1000518 | 3300007190 | Bacteria | 12186 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300009826 | Ga0123355_10007748 | Ga0123355_1000774815 | 234 |
| 2 | 3300042636 | Ga0466703_140616 | Ga0466703_140616_19165_19875 | 236 |
| 3 | iso_pr_bacteria | 2523231078 | 2523495179 | 243 |
| 4 | iso_pr_bacteria | 2849099867 | 2849102601 | 243 |
| 5 | iso_pr_bacteria | 2849104611 | 2849107358 | 243 |
| 6 | iso_pr_bacteria | 2850744690 | 2850746801 | 243 |
| 7 | iso_pr_bacteria | 641736255 | 641741629 | 243 |
| 8 | iso_pr_bacteria | 2940221333 | 2940222212 | 244 |
| 9 | iso_pr_bacteria | 2940380068 | 2940382587 | 244 |
| 10 | iso_pr_bacteria | 2940386776 | 2940389105 | 244 |
| 11 | iso_pr_bacteria | 2940393498 | 2940395821 | 244 |
| 12 | iso_pr_bacteria | 2940400224 | 2940402556 | 244 |
| 13 | iso_pr_bacteria | 2940406939 | 2940409084 | 244 |
| 14 | iso_pr_bacteria | 2940413413 | 2940415800 | 244 |
| 15 | iso_pr_bacteria | 2940419646 | 2940422356 | 244 |
| 16 | iso_pr_bacteria | 2940425923 | 2940428709 | 244 |
| 17 | 3300042622 | Ga0466731_374433 | Ga0466731_374433_19_756 | 245 |
| 18 | 3300012829 | Ga0160467_100277 | Ga0160467_10027735 | 250 |
| 19 | 3300000062 | IMNBL1DRAFT_c0000049 | IMNBL1DRAFT_000004936 | 252 |
| 20 | 3300007129 | Ga0102734_1000008 | Ga0102734_100000852 | 252 |
| 21 | iso_pr_bacteria | 2718218463 | 2721569878 | 253 |
| 22 | 3300012825 | Ga0160441_100198 | Ga0160441_10019842 | 254 |
| 23 | 3300042599 | Ga0466706_042500 | Ga0466706_042500_1171_1935 | 254 |
| 24 | 3300042599 | Ga0466706_075785 | Ga0466706_075785_7030_7797 | 255 |
| 25 | iso_pr_bacteria | 2820477775 | 2820479614 | 256 |
| 26 | 3300042599 | Ga0466706_193513 | Ga0466706_193513_1696_2469 | 257 |
| 27 | 3300042659 | Ga0466733_094152 | Ga0466733_094152_2787_3560 | 257 |
| 28 | 3300056842 | Ga0562377_0062 | Ga0562377_0062_10859_11632 | 257 |
| 29 | iso_pr_bacteria | 646311952 | 646429712 | 257 |
| 30 | 3300042592 | Ga0466693_174245 | Ga0466693_174245_455_1231 | 258 |
| 31 | 3300042597 | Ga0466699_246878 | Ga0466699_246878_230_1006 | 258 |
| 32 | 3300042623 | Ga0466734_148746 | Ga0466734_148746_262_1038 | 258 |
| 33 | iso_pr_bacteria | 2819998259 | 2819998658 | 258 |
| 34 | iso_pr_bacteria | 2820010479 | 2820011112 | 258 |
| 35 | iso_pr_bacteria | 2820215626 | 2820217323 | 258 |
| 36 | 3300002462 | JGI24702J35022_10001719 | JGI24702J35022_100017193 | 259 |
| 37 | 3300010049 | Ga0123356_10751703 | Ga0123356_107517032 | 259 |
| 38 | 3300010167 | Ga0123353_10112143 | Ga0123353_101121433 | 259 |
| 39 | 3300010167 | Ga0123353_10894662 | Ga0123353_108946622 | 259 |
| 40 | 3300010882 | Ga0123354_10045733 | Ga0123354_100457333 | 259 |
| 41 | 3300010882 | Ga0123354_10227681 | Ga0123354_102276812 | 259 |
| 42 | 3300042604 | Ga0466717_303618 | Ga0466717_303618_20392_21171 | 259 |
| 43 | 3300042615 | Ga0466711_174949 | Ga0466711_174949_552_1331 | 259 |
| 44 | 3300042616 | Ga0466715_181736 | Ga0466715_181736_2490_3269 | 259 |
| 45 | 3300042618 | Ga0466723_147657 | Ga0466723_147657_2376_3155 | 259 |
| 46 | iso_pr_bacteria | 2595698190 | 2596205235 | 259 |
| 47 | iso_pr_bacteria | 2595698193 | 2596210642 | 259 |
| 48 | iso_pr_bacteria | 2595698194 | 2596213721 | 259 |
| 49 | iso_pr_bacteria | 2595698195 | 2596214333 | 259 |
| 50 | iso_pr_bacteria | 2595698196 | 2596216146 | 259 |
| 51 | iso_pr_bacteria | 2595698197 | 2596217986 | 259 |
| 52 | iso_pr_bacteria | 2595698198 | 2596219813 | 259 |
| 53 | iso_pr_bacteria | 2595698199 | 2596221629 | 259 |
| 54 | iso_pr_bacteria | 2627853628 | 2628279955 | 259 |
| 55 | iso_pr_bacteria | 2820369699 | 2820369745 | 259 |
| 56 | iso_pr_bacteria | 650716050 | 650844535 | 259 |
| 57 | 3300042596 | Ga0466696_494919 | Ga0466696_494919_597_1379 | 260 |
| 58 | 3300042601 | Ga0466707_219885 | Ga0466707_219885_5689_6471 | 260 |
| 59 | 3300042604 | Ga0466717_064403 | Ga0466717_064403_560_1342 | 260 |
| 60 | 3300042606 | Ga0466719_232323 | Ga0466719_232323_2033_2815 | 260 |
| 61 | 3300042609 | Ga0466722_105906 | Ga0466722_105906_92_874 | 260 |
| 62 | 3300042612 | Ga0466705_431417 | Ga0466705_431417_764_1546 | 260 |
| 63 | 3300042643 | Ga0466704_045229 | Ga0466704_045229_621_1403 | 260 |
| 64 | 3300042643 | Ga0466704_169276 | Ga0466704_169276_464_1246 | 260 |
| 65 | 3300042643 | Ga0466704_381127 | Ga0466704_381127_6787_7569 | 260 |
| 66 | iso_pr_bacteria | 2603880164 | 2606011867 | 260 |
| 67 | iso_pr_bacteria | 2687453757 | 2690049520 | 260 |
| 68 | iso_pr_bacteria | 2706794701 | 2708046562 | 260 |
| 69 | iso_pr_bacteria | 2820565217 | 2820565953 | 260 |
| 70 | iso_pr_bacteria | 2940239174 | 2940239311 | 260 |
| 71 | 3300002931 | CVPL010W_10000615 | CVPL010W_1000061532 | 261 |
| 72 | 3300002938 | CVPL005L_10013363 | CVPL005L_100133633 | 261 |
| 73 | 3300006995 | Ga0102733_100004 | Ga0102733_1000049 | 261 |
| 74 | 3300007067 | Ga0103266_1000044 | Ga0103266_100004416 | 261 |
| 75 | 3300007068 | Ga0103265_1000355 | Ga0103265_10003555 | 261 |
| 76 | 3300007080 | Ga0102735_1000030 | Ga0102735_100003025 | 261 |
| 77 | 3300007083 | Ga0103261_1000031 | Ga0103261_100003182 | 261 |
| 78 | 3300007129 | Ga0102734_1000084 | Ga0102734_100008423 | 261 |
| 79 | 3300007139 | Ga0103260_1000014 | Ga0103260_100001437 | 261 |
| 80 | 3300007142 | Ga0102737_1000026 | Ga0102737_100002641 | 261 |
| 81 | 3300007142 | Ga0102737_1001419 | Ga0102737_10014196 | 261 |
| 82 | 3300007188 | Ga0103264_1015614 | Ga0103264_10156143 | 261 |
| 83 | 3300007190 | Ga0103267_1000185 | Ga0103267_10001851 | 261 |
| 84 | 3300007192 | Ga0103268_1001540 | Ga0103268_100154012 | 261 |
| 85 | 3300010049 | Ga0123356_10026042 | Ga0123356_100260424 | 261 |
| 86 | 3300010049 | Ga0123356_10450039 | Ga0123356_104500392 | 261 |
| 87 | 3300010882 | Ga0123354_10037585 | Ga0123354_100375854 | 261 |
| 88 | 3300042594 | Ga0466694_279800 | Ga0466694_279800_218_1003 | 261 |
| 89 | 3300042601 | Ga0466707_290136 | Ga0466707_290136_114645_115430 | 261 |
| 90 | 3300042611 | Ga0466697_002273 | Ga0466697_002273_4799_5584 | 261 |
| 91 | 3300042613 | Ga0466710_429343 | Ga0466710_429343_22_807 | 261 |
| 92 | iso_pr_bacteria | 2630968413 | 2631702654 | 261 |
| 93 | iso_pr_bacteria | 2758568557 | 2760422064 | 261 |
| 94 | iso_pr_bacteria | 2758568559 | 2760425939 | 261 |
| 95 | iso_pr_bacteria | 2758568560 | 2760427871 | 261 |
| 96 | iso_pr_bacteria | 2758568561 | 2760428972 | 261 |
| 97 | iso_pr_bacteria | 2808606958 | 2811757625 | 261 |
| 98 | iso_pr_bacteria | 2820323050 | 2820323794 | 261 |
| 99 | iso_pr_bacteria | 2851412233 | 2851412465 | 261 |
| 100 | iso_pr_bacteria | 2956926959 | 2956927007 | 261 |
| 101 | iso_pr_bacteria | 2956928875 | 2956930688 | 261 |
| 102 | iso_pr_bacteria | 2956930723 | 2956931723 | 261 |
| 103 | iso_pr_bacteria | 8001918023 | 8001918307 | 261 |
| 104 | 3300010049 | Ga0123356_10001957 | Ga0123356_100019579 | 262 |
| 105 | iso_pr_bacteria | 2820426531 | 2820426556 | 262 |
| 106 | 3300010167 | Ga0123353_10006321 | Ga0123353_1000632113 | 263 |
| 107 | 2209111004 | 2212577964 | 2212422315 | 264 |
| 108 | 3300042599 | Ga0466706_194198 | Ga0466706_194198_29_823 | 264 |
| 109 | 3300042625 | Ga0466730_031875 | Ga0466730_031875_4728_5522 | 264 |
| 110 | 3300056842 | Ga0562377_0158 | Ga0562377_0158_12380_13174 | 264 |
| 111 | 3300056856 | Ga0562375_0023 | Ga0562375_0023_245507_246301 | 264 |
| 112 | 3300057007 | Ga0562374_0043 | Ga0562374_0043_128097_128891 | 264 |
| 113 | iso_pr_bacteria | 2537562000 | 2539434744 | 264 |
| 114 | iso_pr_bacteria | 2563367190 | 2565791318 | 264 |
| 115 | iso_pr_bacteria | 2791355481 | 2794423948 | 264 |
| 116 | iso_pr_bacteria | 2822232166 | 2822233103 | 264 |
| 117 | iso_pr_bacteria | 2822450720 | 2822451786 | 264 |
| 118 | iso_pr_bacteria | 2827179085 | 2827184866 | 264 |
| 119 | iso_pr_bacteria | 2852431164 | 2852431346 | 264 |
| 120 | iso_pr_bacteria | 2864782175 | 2864784690 | 264 |
| 121 | iso_pr_bacteria | 2864801025 | 2864802888 | 264 |
| 122 | iso_pr_bacteria | 2864895409 | 2864896621 | 264 |
| 123 | iso_pr_bacteria | 2864909992 | 2864910878 | 264 |
| 124 | iso_pr_bacteria | 2912849059 | 2912852856 | 264 |
| 125 | iso_pr_bacteria | 2916873227 | 2916880488 | 264 |
| 126 | iso_pr_bacteria | 2940377351 | 2940377630 | 264 |
| 127 | iso_pr_bacteria | 2969145278 | 2969149624 | 264 |
| 128 | iso_pr_bacteria | 2971438493 | 2971440029 | 264 |
| 129 | iso_pr_bacteria | 2978778678 | 2978779461 | 264 |
| 130 | iso_pr_bacteria | 643886085 | 644681066 | 264 |
| 131 | iso_pr_bacteria | 643886087 | 644668789 | 264 |
| 132 | iso_pr_bacteria | 643886090 | 644662685 | 264 |
| 133 | iso_pr_bacteria | 643886091 | 644649744 | 264 |
| 134 | iso_pr_bacteria | 8018750880 | 8018754674 | 264 |
| 135 | iso_pr_bacteria | 8018754795 | 8018758595 | 264 |
| 136 | iso_pr_bacteria | 8022725327 | 8022726331 | 264 |
| 137 | iso_pr_bacteria | 8022781829 | 8022785829 | 264 |
| 138 | iso_pr_bacteria | 8043041867 | 8043042999 | 264 |
| 139 | iso_pr_bacteria | 8061039349 | 8061044106 | 264 |
| 140 | iso_pr_bacteria | 8061045771 | 8061046570 | 264 |
| 141 | iso_pr_bacteria | 8061100935 | 8061102172 | 264 |
| 142 | 3300003973 | Ga0063521_1000113 | Ga0063521_100011345 | 265 |
| 143 | 3300012813 | Ga0160470_100221 | Ga0160470_10022137 | 265 |
| 144 | 3300042602 | Ga0466713_121316 | Ga0466713_121316_2375_3172 | 265 |
| 145 | 3300056790 | Ga0562379_0080 | Ga0562379_0080_49450_50247 | 265 |
| 146 | 3300056814 | Ga0562378_0065 | Ga0562378_0065_195043_195840 | 265 |
| 147 | 3300056842 | Ga0562377_0015 | Ga0562377_0015_349046_349843 | 265 |
| 148 | 3300056842 | Ga0562377_0125 | Ga0562377_0125_98556_99353 | 265 |
| 149 | 3300056856 | Ga0562375_0018 | Ga0562375_0018_150729_151526 | 265 |
| 150 | 3300056856 | Ga0562375_0036 | Ga0562375_0036_391435_392232 | 265 |
| 151 | 3300056856 | Ga0562375_0091 | Ga0562375_0091_154721_155518 | 265 |
| 152 | 3300056856 | Ga0562375_0408 | Ga0562375_0408_56602_57399 | 265 |
| 153 | 3300056856 | Ga0562375_2061 | Ga0562375_2061_10482_11279 | 265 |
| 154 | 3300056856 | Ga0562375_2386 | Ga0562375_2386_20220_21017 | 265 |
| 155 | 3300056856 | Ga0562375_4121 | Ga0562375_4121_1226_2023 | 265 |
| 156 | 3300057007 | Ga0562374_0387 | Ga0562374_0387_56721_57518 | 265 |
| 157 | 3300057007 | Ga0562374_0414 | Ga0562374_0414_26687_27484 | 265 |
| 158 | 3300057007 | Ga0562374_2309 | Ga0562374_2309_14626_15423 | 265 |
| 159 | iso_pr_bacteria | 2524614537 | 2524833738 | 265 |
| 160 | iso_pr_bacteria | 2731957677 | 2732685627 | 265 |
| 161 | iso_pr_bacteria | 2740892556 | 2743948302 | 265 |
| 162 | iso_pr_bacteria | 2751185832 | 2753508633 | 265 |
| 163 | iso_pr_bacteria | 2775507073 | 2777016061 | 265 |
| 164 | iso_pr_bacteria | 2825804107 | 2825805259 | 265 |
| 165 | iso_pr_bacteria | 2843246524 | 2843250161 | 265 |
| 166 | iso_pr_bacteria | 2852123468 | 2852123476 | 265 |
| 167 | iso_pr_bacteria | 2855361764 | 2855362289 | 265 |
| 168 | iso_pr_bacteria | 2864816158 | 2864820140 | 265 |
| 169 | iso_pr_bacteria | 2864981449 | 2864982550 | 265 |
| 170 | iso_pr_bacteria | 2890957088 | 2890958793 | 265 |
| 171 | iso_pr_bacteria | 2900804455 | 2900805310 | 265 |
| 172 | iso_pr_bacteria | 2940218408 | 2940219029 | 265 |
| 173 | iso_pr_bacteria | 2940261461 | 2940262223 | 265 |
| 174 | iso_pr_bacteria | 647533136 | 647745953 | 265 |
| 175 | iso_pr_bacteria | 8002519755 | 8002521955 | 265 |
| 176 | iso_pr_bacteria | 8007211731 | 8007212764 | 265 |
| 177 | iso_pr_bacteria | 8007215774 | 8007220094 | 265 |
| 178 | iso_pr_bacteria | 8007220153 | 8007221129 | 265 |
| 179 | iso_pr_bacteria | 8007223943 | 8007224736 | 265 |
| 180 | iso_pr_bacteria | 8007237282 | 8007237560 | 265 |
| 181 | iso_pr_bacteria | 8012939035 | 8012942183 | 265 |
| 182 | iso_pr_bacteria | 8018794549 | 8018795053 | 265 |
| 183 | iso_pr_bacteria | 8018798118 | 8018798354 | 265 |
| 184 | iso_pr_bacteria | 8018802046 | 8018803147 | 265 |
| 185 | iso_pr_bacteria | 8038268975 | 8038272131 | 265 |
| 186 | iso_pr_bacteria | 8077780672 | 8077783326 | 265 |
| 187 | iso_pr_bacteria | 8082023105 | 8082024658 | 265 |
| 188 | iso_pr_bacteria | 8108568626 | 8108570035 | 265 |
| 189 | iso_pr_bacteria | 8108576847 | 8108578548 | 265 |
| 190 | iso_pr_bacteria | 8114537524 | 8114540041 | 265 |
| 191 | iso_pr_bacteria | 8114541043 | 8114543275 | 265 |
| 192 | iso_pr_bacteria | 8114544644 | 8114547571 | 265 |
| 193 | iso_pr_bacteria | 8114549044 | 8114550745 | 265 |
| 194 | iso_pr_bacteria | 8114555646 | 8114557055 | 265 |
| 195 | 3300002932 | CVPL010L_1000219 | CVPL010L_100021934 | 266 |
| 196 | 3300007141 | Ga0102738_1000007 | Ga0102738_100000751 | 266 |
| 197 | 3300012805 | Ga0160464_100450 | Ga0160464_10045016 | 266 |
| 198 | 3300042598 | Ga0466701_004506 | Ga0466701_004506_229_1029 | 266 |
| 199 | 3300042601 | Ga0466707_052067 | Ga0466707_052067_5749_6549 | 266 |
| 200 | 3300042623 | Ga0466734_154610 | Ga0466734_154610_202_1002 | 266 |
| 201 | 3300042649 | Ga0466724_28917 | Ga0466724_28917_3057_3857 | 266 |
| 202 | 3300056564 | Ga0530661_000001 | Ga0530661_000001_305354_306154 | 266 |
| 203 | iso_pr_bacteria | 2558860143 | 2559001005 | 266 |
| 204 | iso_pr_bacteria | 2675903377 | 2677724065 | 266 |
| 205 | iso_pr_bacteria | 2834951433 | 2834952737 | 266 |
| 206 | iso_pr_bacteria | 2857493320 | 2857496818 | 266 |
| 207 | iso_pr_bacteria | 2857493320 | 2857496872 | 266 |
| 208 | iso_pr_bacteria | 2857498920 | 2857502116 | 266 |
| 209 | iso_pr_bacteria | 2873581347 | 2873582147 | 266 |
| 210 | iso_pr_bacteria | 2873584433 | 2873584786 | 266 |
| 211 | iso_pr_bacteria | 2877522083 | 2877522990 | 266 |
| 212 | iso_pr_bacteria | 2881375749 | 2881377422 | 266 |
| 213 | iso_pr_bacteria | 2916858470 | 2916861085 | 266 |
| 214 | iso_pr_bacteria | 8002299145 | 8002303410 | 266 |
| 215 | iso_pr_bacteria | 8002304686 | 8002305584 | 266 |
| 216 | iso_pr_bacteria | 8064008355 | 8064011648 | 266 |
| 217 | 3300007141 | Ga0102738_1000011 | Ga0102738_100001169 | 267 |
| 218 | iso_pr_bacteria | 2881902429 | 2881903514 | 267 |
| 219 | iso_pr_bacteria | 2923762712 | 2923763660 | 267 |
| 220 | iso_pr_bacteria | 2936628749 | 2936630188 | 267 |
| 221 | iso_pr_bacteria | 8066790652 | 8066791915 | 267 |
| 222 | iso_pr_bacteria | 8066792404 | 8066793744 | 267 |
| 223 | iso_pr_bacteria | 8066794103 | 8066795098 | 267 |
| 224 | iso_pr_bacteria | 8066795793 | 8066797169 | 267 |
| 225 | iso_pr_bacteria | 8066797744 | 8066799082 | 267 |
| 226 | iso_pr_bacteria | 8066799369 | 8066800565 | 267 |
| 227 | iso_pr_bacteria | 8066802609 | 8066803802 | 267 |
| 228 | 3300007042 | Ga0103263_100075 | Ga0103263_10007540 | 268 |
| 229 | 3300007052 | Ga0102736_1000106 | Ga0102736_100010617 | 268 |
| 230 | 3300042596 | Ga0466696_023199 | Ga0466696_023199_143_949 | 268 |
| 231 | iso_pr_bacteria | 2622736579 | 2623392400 | 268 |
| 232 | 2225789004 | 2227091917 | 2227471249 | 269 |
| 233 | 3300042590 | Ga0466690_154542 | Ga0466690_154542_2608_3417 | 269 |
| 234 | 3300042618 | Ga0466723_075120 | Ga0466723_075120_3357_4166 | 269 |
| 235 | 3300000062 | IMNBL1DRAFT_c0025968 | IMNBL1DRAFT_00259681 | 270 |
| 236 | 3300007140 | Ga0102740_1003945 | Ga0102740_10039452 | 270 |
| 237 | 3300042593 | Ga0466691_063737 | Ga0466691_063737_2597_3409 | 270 |
| 238 | 3300042602 | Ga0466713_019720 | Ga0466713_019720_3503_4315 | 270 |
| 239 | 3300042643 | Ga0466704_412583 | Ga0466704_412583_110_922 | 270 |
| 240 | iso_pr_bacteria | 2508501067 | 2508839100 | 270 |
| 241 | iso_pr_bacteria | 2517572100 | 2517755668 | 270 |
| 242 | iso_pr_bacteria | 2639763185 | 2642347451 | 270 |
| 243 | iso_pr_bacteria | 2639763186 | 2642353093 | 270 |
| 244 | 3300007129 | Ga0102734_1000770 | Ga0102734_10007703 | 271 |
| 245 | 3300007188 | Ga0103264_1000002 | Ga0103264_100000220 | 271 |
| 246 | 3300007190 | Ga0103267_1000518 | Ga0103267_10005188 | 272 |
| 247 | 3300042619 | Ga0466726_458655 | Ga0466726_458655_217_1035 | 272 |
| 248 | 3300005071 | Ga0068302_10028201 | Ga0068302_100282013 | 273 |
| 249 | 3300010167 | Ga0123353_10384459 | Ga0123353_103844592 | 273 |
| 250 | 3300042590 | Ga0466690_064203 | Ga0466690_064203_1934_2758 | 274 |
| 251 | 3300042618 | Ga0466723_325627 | Ga0466723_325627_18583_19407 | 274 |
| 252 | 3300042643 | Ga0466704_400434 | Ga0466704_400434_803_1630 | 275 |
| 253 | 3300042612 | Ga0466705_497786 | Ga0466705_497786_1430_2260 | 276 |
| 254 | 3300010167 | Ga0123353_10321112 | Ga0123353_103211123 | 278 |
| 255 | 3300000062 | IMNBL1DRAFT_c0044480 | IMNBL1DRAFT_00444802 | 284 |
| 256 | 3300012798 | Ga0160454_100018 | Ga0160454_100018148 | 288 |
| 257 | 3300042598 | Ga0466701_063665 | Ga0466701_063665_9432_10304 | 290 |
| 258 | 3300042601 | Ga0466707_208675 | Ga0466707_208675_990_1904 | 304 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00149 | GO:0016787 | hydrolase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.87 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.