Protein Family IF05892

Metagenome Isolate
173 Members
72 Samples
157 Scaffolds
260.15 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_203571|Ga0466707_203571_33824_34693
Length
289 aa
Sequence
MQAFFTRGFLFSEICVTFVGFFSINKMRSNQTYVKPKKFLGQHFLKDLSVAQRIAETLPLTEKTAVLEIGPGTGVLTQFLLQNPNIDLTVVELDRESVPYLRTHFPALENRIIEGDFLKLDLSAVFKEKFFIIGNYPYNISSQIFFKLLDYREQVPCLTGMIQKEVAERIAAPHGSKTYGILSVLLQAYYNVEYLFTVDERVFDPPPKVKSAVVRLTRNEVEKIDCDEVLFKTVVKTAFNQRRKTLRNSLKSLIDKDNEISRKAIFDKRPEQLSVAQFIELTNIIRSNV

📊 Sample Types

Isolate 9.2%
Metagenome 90.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.8%
Kalotermitidae 19.7%
Unclassified 18.3%
Rhinotermitidae 5.6%
Blattidae 4.2%
Passalidae 4.2%
Termopsidae 4.2%
Hodotermitidae 1.4%
Elmidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 164
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
2 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
3 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
7 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
8 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
9 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
10 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
15 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
16 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
24 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
25 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
26 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
27 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
28 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
29 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
30 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
31 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
32 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
33 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
34 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
35 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
36 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
37 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
40 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
41 2820735654 Unclassified Bacteroidetes Th196P4bin9 Isolate Unclassified
42 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
43 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
44 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
45 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
46 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
47 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
48 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
49 2864836148 Arcicella rosea S00070 Isolate Elmidae
50 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
51 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
52 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
53 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
54 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
55 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
56 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
57 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
58 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
59 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
60 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
61 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
62 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
63 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
64 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
65 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
66 2998907766 Penaeicola halotolerans LMIT005 Isolate
67 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
68 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
69 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
70 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
71 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
72 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_078914 3300042659 Bacteria 1818
2 Ga0466705_399901 3300042612 Bacteria 19786
3 Ga0466710_059442 3300042613 Bacteria 2921
4 Ga0466711_479274 3300042615 Bacteria 4105
5 Ga0123356_10199343 3300010049 Bacteria 2040
6 Ga0466656_170227 3300042550 Bacteria 6523
7 Ga0466694_306687 3300042594 Bacteria 1058
8 Ga0466699_263270 3300042597 Bacteria 2912
9 Ga0466701_080033 3300042598 Bacteria 9894
10 Ga0466706_052254 3300042599 Bacteria 103343
11 Ga0466706_165084 3300042599 Bacteria 195712
12 Ga0466706_205853 3300042599 Bacteria 29572
13 Ga0466698_486063 3300042610 Bacteria 3891
14 IMNBL1DRAFT_c0009469 3300000062 Bacteria 4806
15 JGI24696J40584_12908273 3300002834 Bacteria 1235
16 JGI24696J40584_12960314 3300002834 Bacteria 6889
17 Ga0466705_281055 3300042612 Bacteria 4651
18 Ga0466731_247175 3300042622 Bacteria 1788
19 Ga0466703_153148 3300042636 Unclassified 1234
20 Ga0466703_195941 3300042636 Bacteria 9036
21 Ga0466703_224078 3300042636 Bacteria 3064
22 Ga0466709_208437 3300042648 Bacteria 82349
23 Ga0466709_292660 3300042648 Bacteria 19708
24 Ga0466727_196399 3300042655 Unclassified 14093
25 Ga0466711_313429 3300042615 Bacteria 90458
26 Ga0466728_476207 3300042620 Bacteria 2935
27 Ga0123355_10420877 3300009826 Bacteria 1707
28 Ga0123356_10001616 3300010049 Bacteria 24710
29 Ga0123353_10050932 3300010167 Bacteria 6607
30 Ga0123353_11284450 3300010167 Unclassified 952
31 Ga0466657_037970 3300042582 Bacteria 3044
32 Ga0466690_012565 3300042590 Bacteria 4957
33 Ga0466691_010908 3300042593 Bacteria 139266
34 Ga0466694_245546 3300042594 Bacteria 1679
35 Ga0466694_317240 3300042594 Bacteria 2449
36 Ga0466696_010048 3300042596 Bacteria 35433
37 Ga0466696_443536 3300042596 Bacteria 2229
38 Ga0466707_113510 3300042601 Bacteria 5951
39 Ga0466707_203571 3300042601 Bacteria 51511
40 Ga0466713_122628 3300042602 Bacteria 2382
41 Ga0466714_130620 3300042603 Bacteria 2736
42 Ga0466717_115988 3300042604 Bacteria 1174
43 Ga0466719_547610 3300042606 Bacteria 15297
44 IMNBL1DRAFT_c0033869 3300000062 Bacteria 1825
45 IMNBL1DRAFT_c0062532 3300000062 Bacteria 1111
46 Ga0466735_206990 3300042624 Bacteria 4647
47 Ga0466703_258103 3300042636 Bacteria 8306
48 Ga0466724_27156 3300042649 Bacteria 1723
49 Ga0466708_027852 3300042652 Bacteria 35083
50 Ga0466729_158636 3300042621 Bacteria 1402
51 Ga0123357_10276782 3300009784 Bacteria 1742
52 Ga0123356_10092834 3300010049 Bacteria 2879
53 Ga0123353_10000087 3300010167 Bacteria 103477
54 Ga0123353_10124894 3300010167 Bacteria 4136
55 Ga0123353_10778719 3300010167 Bacteria 1325
56 Ga0466656_227132 3300042550 Bacteria 3726
57 Ga0466691_042421 3300042593 Bacteria 2642
58 Ga0466700_230275 3300042600 Bacteria 9161
59 Ga0466713_143155 3300042602 Bacteria 188721
60 Ga0466714_022595 3300042603 Bacteria 225972
61 Ga0466722_031037 3300042609 Bacteria 32845
62 JGI24696J40584_12957662 3300002834 Bacteria 3629
63 Ga0466730_072635 3300042625 Bacteria 2672
64 Ga0466704_145321 3300042643 Bacteria 17421
65 Ga0466704_215098 3300042643 Bacteria 4910
66 Ga0466709_299038 3300042648 Bacteria 23402
67 Ga0466724_43697 3300042649 Bacteria 3008
68 Ga0466733_127180 3300042659 Bacteria 3868
69 Ga0466710_029545 3300042613 Bacteria 2066
70 Ga0466715_290683 3300042616 Bacteria 15704
71 Ga0466715_614578 3300042616 Unclassified 17723
72 Ga0123353_10000454 3300010167 Bacteria 50966
73 Ga0123353_10041882 3300010167 Unclassified 7239
74 Ga0415639_111417 3300038395 Bacteria 2261
75 Ga0466694_005178 3300042594 Bacteria 5595
76 Ga0466694_070624 3300042594 Bacteria 3049
77 Ga0466696_276511 3300042596 Bacteria 1737
78 Ga0466714_033452 3300042603 Bacteria 32073
79 Ga0466722_079607 3300042609 Bacteria 6732
80 Ga0466697_082837 3300042611 Bacteria 1573
81 Ga0466704_060132 3300042643 Bacteria 107799
82 Ga0466732_210914 3300042656 Bacteria 2811
83 Ga0466715_472298 3300042616 Bacteria 24908
84 Ga0466723_329006 3300042618 Bacteria 14408
85 Ga0466726_044086 3300042619 Bacteria 2652
86 Ga0466726_226827 3300042619 Bacteria 12877
87 Ga0466726_357657 3300042619 Bacteria 1132
88 Ga0466728_284998 3300042620 Bacteria 1025
89 Ga0123353_10149655 3300010167 Bacteria 3728
90 Ga0466657_227524 3300042582 Bacteria 11726
91 Ga0466720_190499 3300042607 Bacteria 2863
92 2227661030 2225789004 Unclassified 1948
93 IMNBL1DRAFT_c0041569 3300000062 Bacteria 1542
94 IMNBL1DRAFT_c0049805 3300000062 Bacteria 1333
95 JGI24705J35276_12213318 3300002504 Bacteria 1921
96 JGI24696J40584_12947637 3300002834 Bacteria 1959
97 Ga0068305_10054148 3300005083 Bacteria 8956
98 Ga0466729_288856 3300042621 Bacteria 3178
99 Ga0466732_225136 3300042656 Bacteria 4486
100 Ga0466733_053801 3300042659 Bacteria 13129
101 Ga0466733_062768 3300042659 Bacteria 36272
102 Ga0466723_331915 3300042618 Bacteria 13100
103 Ga0466726_383704 3300042619 Bacteria 3373
104 Ga0123355_10000003 3300009826 Bacteria 224088
105 Ga0123356_10164103 3300010049 Bacteria 2223
106 Ga0123356_10264983 3300010049 Bacteria 1804
107 Ga0123353_10273061 3300010167 Bacteria 2603
108 Ga0123353_10504574 3300010167 Bacteria 1761
109 Ga0466690_157440 3300042590 Bacteria 5692
110 Ga0466692_012515 3300042591 Bacteria 55028
111 Ga0466693_234571 3300042592 Bacteria 1079
112 Ga0466695_050157 3300042595 Bacteria 1992
113 Ga0466696_430048 3300042596 Bacteria 4987
114 Ga0466699_172121 3300042597 Bacteria 1968
115 Ga0466701_001665 3300042598 Bacteria 23764
116 Ga0466701_049985 3300042598 Bacteria 3909
117 Ga0466714_021845 3300042603 Bacteria 9532
118 IMNBGM34_c000048 3300000036 Bacteria 33252
119 IMNBL1DRAFT_c0004799 3300000062 Bacteria 7973
120 JGI24705J35276_12192497 3300002504 Bacteria 1488
121 Ga0466697_167565 3300042611 Bacteria 1413
122 Ga0466703_013048 3300042636 Bacteria 4340
123 Ga0466710_010282 3300042613 Bacteria 2160
124 Ga0466723_208279 3300042618 Bacteria 2859
125 Ga0466729_084681 3300042621 Unclassified 1429
126 Ga0123356_10370413 3300010049 Bacteria 1562
127 Ga0123353_10000066 3300010167 Bacteria 114986
128 Ga0123353_10004465 3300010167 Bacteria 18029
129 Ga0123354_10499113 3300010882 Unclassified 950
130 Ga0466657_294673 3300042582 Bacteria 1811
131 Ga0466701_014367 3300042598 Bacteria 4372
132 Ga0466714_013322 3300042603 Bacteria 11665
133 Ga0466716_178418 3300042605 Bacteria 12563
134 Ga0466719_153950 3300042606 Bacteria 3189
135 IMNBL1DRAFT_c0010857 3300000062 Bacteria 4311
136 Ga0466705_296754 3300042612 Bacteria 4225
137 Ga0466731_111621 3300042622 Bacteria 57892
138 Ga0466730_023806 3300042625 Bacteria 2387
139 Ga0466710_097550 3300042613 Bacteria 3185
140 Ga0466710_199024 3300042613 Bacteria 5826
141 Ga0466715_580653 3300042616 Bacteria 5125
142 Ga0123353_10015471 3300010167 Bacteria 11084
143 Ga0123353_11115102 3300010167 Bacteria 1046
144 Ga0466656_115539 3300042550 Bacteria 1436
145 Ga0466657_163901 3300042582 Bacteria 22614
146 Ga0466690_264523 3300042590 Bacteria 5222
147 Ga0466695_382977 3300042595 Bacteria 3269
148 Ga0466695_396119 3300042595 Bacteria 2391
149 Ga0466696_097270 3300042596 Bacteria 8217
150 Ga0466706_144213 3300042599 Bacteria 16196
151 Ga0466713_072434 3300042602 Bacteria 14880
152 Ga0466714_068614 3300042603 Bacteria 5619
153 Ga0466717_016641 3300042604 Bacteria 1567
154 Ga0466717_234935 3300042604 Unclassified 1486
155 JGI24702J35022_10000345 3300002462 Bacteria 27477
156 JGI24696J40584_12961658 3300002834 Bacteria 29846
157 Ga0466702_377914 3300042635 Bacteria 1659

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042649 Ga0466724_43697 Ga0466724_43697_35_754 239
2 3300042659 Ga0466733_062768 Ga0466733_062768_4294_5055 242
3 3300042616 Ga0466715_472298 Ga0466715_472298_5313_6110 247
4 3300042598 Ga0466701_001665 Ga0466701_001665_5512_6288 248
5 3300042550 Ga0466656_115539 Ga0466656_115539_254_1003 249
6 3300042582 Ga0466657_163901 Ga0466657_163901_16883_17632 249
7 3300042607 Ga0466720_190499 Ga0466720_190499_1942_2697 251
8 3300042611 Ga0466697_082837 Ga0466697_082837_565_1320 251
9 3300042613 Ga0466710_010282 Ga0466710_010282_1262_2017 251
10 3300042635 Ga0466702_377914 Ga0466702_377914_137_892 251
11 3300010167 Ga0123353_10015471 Ga0123353_100154718 252
12 3300042582 Ga0466657_294673 Ga0466657_294673_26_784 252
13 3300042595 Ga0466695_396119 Ga0466695_396119_632_1390 252
14 3300042598 Ga0466701_049985 Ga0466701_049985_431_1189 252
15 3300042604 Ga0466717_115988 Ga0466717_115988_278_1036 252
16 3300042604 Ga0466717_234935 Ga0466717_234935_693_1451 252
17 3300042621 Ga0466729_084681 Ga0466729_084681_23_781 252
18 3300042622 Ga0466731_247175 Ga0466731_247175_317_1075 252
19 3300042624 Ga0466735_206990 Ga0466735_206990_3810_4607 252
20 iso_pr_bacteria 2820735654 2820735822 252
21 3300002462 JGI24702J35022_10000345 JGI24702J35022_100003458 253
22 3300002504 JGI24705J35276_12192497 JGI24705J35276_121924971 253
23 3300002504 JGI24705J35276_12213318 JGI24705J35276_122133182 253
24 3300009826 Ga0123355_10000003 Ga0123355_10000003129 253
25 3300009826 Ga0123355_10420877 Ga0123355_104208772 253
26 3300010167 Ga0123353_10124894 Ga0123353_101248943 253
27 3300042592 Ga0466693_234571 Ga0466693_234571_100_861 253
28 3300042594 Ga0466694_005178 Ga0466694_005178_4697_5458 253
29 3300042594 Ga0466694_070624 Ga0466694_070624_188_949 253
30 3300042595 Ga0466695_050157 Ga0466695_050157_113_874 253
31 3300042598 Ga0466701_080033 Ga0466701_080033_1146_1907 253
32 3300042613 Ga0466710_059442 Ga0466710_059442_368_1129 253
33 iso_pr_bacteria 2820753519 2820755021 253
34 iso_pr_bacteria 2820755292 2820756762 253
35 iso_pr_bacteria 2820770630 2820771148 253
36 iso_pr_bacteria 2820792843 2820793022 253
37 iso_pr_bacteria 2820795054 2820796129 253
38 3300002834 JGI24696J40584_12908273 JGI24696J40584_129082732 254
39 3300002834 JGI24696J40584_12957662 JGI24696J40584_129576623 254
40 3300010167 Ga0123353_10000087 Ga0123353_1000008743 254
41 3300042616 Ga0466715_580653 Ga0466715_580653_2837_3601 254
42 3300042655 Ga0466727_196399 Ga0466727_196399_5788_6552 254
43 iso_pr_bacteria 2820746860 2820748469 254
44 iso_pr_bacteria 2820783511 2820783968 254
45 3300000062 IMNBL1DRAFT_c0033869 IMNBL1DRAFT_00338693 255
46 3300010049 Ga0123356_10001616 Ga0123356_100016168 255
47 3300010049 Ga0123356_10370413 Ga0123356_103704132 255
48 3300042582 Ga0466657_037970 Ga0466657_037970_904_1671 255
49 3300042594 Ga0466694_306687 Ga0466694_306687_175_942 255
50 3300042610 Ga0466698_486063 Ga0466698_486063_2674_3441 255
51 3300042619 Ga0466726_383704 Ga0466726_383704_2416_3183 255
52 3300042622 Ga0466731_111621 Ga0466731_111621_10505_11272 255
53 3300042643 Ga0466704_215098 Ga0466704_215098_3823_4590 255
54 3300042648 Ga0466709_292660 Ga0466709_292660_16877_17644 255
55 3300042659 Ga0466733_127180 Ga0466733_127180_1019_1786 255
56 2225789004 2227661030 2228261714 256
57 3300000062 IMNBL1DRAFT_c0062532 IMNBL1DRAFT_00625322 256
58 3300005083 Ga0068305_10054148 Ga0068305_100541483 256
59 3300010167 Ga0123353_10050932 Ga0123353_100509323 256
60 3300010167 Ga0123353_10149655 Ga0123353_101496552 256
61 3300010882 Ga0123354_10499113 Ga0123354_104991132 256
62 3300042596 Ga0466696_010048 Ga0466696_010048_32346_33116 256
63 3300042606 Ga0466719_547610 Ga0466719_547610_13372_14142 256
64 3300042609 Ga0466722_031037 Ga0466722_031037_5065_5835 256
65 3300042615 Ga0466711_479274 Ga0466711_479274_3086_3856 256
66 3300042619 Ga0466726_226827 Ga0466726_226827_8650_9420 256
67 3300042619 Ga0466726_357657 Ga0466726_357657_180_989 256
68 3300042636 Ga0466703_224078 Ga0466703_224078_868_1638 256
69 3300042643 Ga0466704_060132 Ga0466704_060132_93646_94416 256
70 3300000062 IMNBL1DRAFT_c0004799 IMNBL1DRAFT_00047996 257
71 3300010167 Ga0123353_10004465 Ga0123353_1000446515 257
72 3300042590 Ga0466690_012565 Ga0466690_012565_2312_3085 257
73 3300042594 Ga0466694_317240 Ga0466694_317240_730_1503 257
74 3300042603 Ga0466714_068614 Ga0466714_068614_513_1286 257
75 3300042609 Ga0466722_079607 Ga0466722_079607_5403_6176 257
76 3300042613 Ga0466710_029545 Ga0466710_029545_502_1275 257
77 3300042618 Ga0466723_329006 Ga0466723_329006_11434_12207 257
78 3300042620 Ga0466728_476207 Ga0466728_476207_308_1081 257
79 iso_pr_bacteria 2820750388 2820750680 257
80 3300042590 Ga0466690_264523 Ga0466690_264523_3783_4559 258
81 3300042597 Ga0466699_172121 Ga0466699_172121_1143_1919 258
82 3300042600 Ga0466700_230275 Ga0466700_230275_141_917 258
83 3300042636 Ga0466703_013048 Ga0466703_013048_200_976 258
84 3300042636 Ga0466703_153148 Ga0466703_153148_140_916 258
85 3300042643 Ga0466704_145321 Ga0466704_145321_12034_12810 258
86 3300009784 Ga0123357_10276782 Ga0123357_102767822 259
87 3300010167 Ga0123353_10041882 Ga0123353_100418822 259
88 3300010167 Ga0123353_10778719 Ga0123353_107787191 259
89 3300042550 Ga0466656_170227 Ga0466656_170227_3522_4301 259
90 3300042599 Ga0466706_144213 Ga0466706_144213_4288_5067 259
91 3300042599 Ga0466706_165084 Ga0466706_165084_75597_76376 259
92 3300042603 Ga0466714_022595 Ga0466714_022595_189026_189805 259
93 3300042605 Ga0466716_178418 Ga0466716_178418_9189_9968 259
94 3300042618 Ga0466723_331915 Ga0466723_331915_9298_10077 259
95 3300042648 Ga0466709_299038 Ga0466709_299038_7825_8604 259
96 3300042656 Ga0466732_225136 Ga0466732_225136_3127_3906 259
97 3300010167 Ga0123353_10504574 Ga0123353_105045742 260
98 3300042596 Ga0466696_430048 Ga0466696_430048_2060_2842 260
99 3300042612 Ga0466705_296754 Ga0466705_296754_2795_3577 260
100 3300042613 Ga0466710_097550 Ga0466710_097550_2218_3000 260
101 3300042613 Ga0466710_199024 Ga0466710_199024_2738_3520 260
102 3300042649 Ga0466724_27156 Ga0466724_27156_884_1666 260
103 iso_pr_bacteria 2864836148 2864837594 260
104 3300010049 Ga0123356_10092834 Ga0123356_100928342 261
105 3300010049 Ga0123356_10164103 Ga0123356_101641032 261
106 3300042594 Ga0466694_245546 Ga0466694_245546_528_1313 261
107 3300042595 Ga0466695_382977 Ga0466695_382977_694_1479 261
108 3300042599 Ga0466706_052254 Ga0466706_052254_44573_45358 261
109 3300042601 Ga0466707_113510 Ga0466707_113510_782_1567 261
110 3300042603 Ga0466714_013322 Ga0466714_013322_3642_4427 261
111 3300042612 Ga0466705_399901 Ga0466705_399901_5520_6305 261
112 3300042621 Ga0466729_158636 Ga0466729_158636_300_1085 261
113 3300042625 Ga0466730_023806 Ga0466730_023806_364_1149 261
114 3300042652 Ga0466708_027852 Ga0466708_027852_29142_29927 261
115 3300002834 JGI24696J40584_12947637 JGI24696J40584_129476372 262
116 3300042590 Ga0466690_157440 Ga0466690_157440_3011_3799 262
117 3300042593 Ga0466691_042421 Ga0466691_042421_1557_2345 262
118 3300042599 Ga0466706_205853 Ga0466706_205853_2852_3640 262
119 3300042603 Ga0466714_021845 Ga0466714_021845_4269_5057 262
120 3300042615 Ga0466711_313429 Ga0466711_313429_18389_19177 262
121 3300042616 Ga0466715_290683 Ga0466715_290683_10899_11687 262
122 3300000062 IMNBL1DRAFT_c0009469 IMNBL1DRAFT_00094695 263
123 3300000062 IMNBL1DRAFT_c0010857 IMNBL1DRAFT_00108572 263
124 3300010049 Ga0123356_10264983 Ga0123356_102649832 263
125 3300010167 Ga0123353_10000066 Ga0123353_1000006676 263
126 3300042550 Ga0466656_227132 Ga0466656_227132_903_1694 263
127 3300042618 Ga0466723_208279 Ga0466723_208279_460_1251 263
128 3300002834 JGI24696J40584_12961658 JGI24696J40584_1296165826 264
129 iso_pr_bacteria 2998907766 2998908073 264
130 3300010167 Ga0123353_11284450 Ga0123353_112844502 265
131 3300042602 Ga0466713_072434 Ga0466713_072434_10648_11445 265
132 3300042606 Ga0466719_153950 Ga0466719_153950_1353_2150 265
133 3300042619 Ga0466726_044086 Ga0466726_044086_1721_2518 265
134 3300042621 Ga0466729_288856 Ga0466729_288856_2365_3162 265
135 3300042656 Ga0466732_210914 Ga0466732_210914_322_1119 265
136 3300042659 Ga0466733_078914 Ga0466733_078914_187_984 265
137 iso_pr_bacteria 2910942425 2910945118 265
138 3300042602 Ga0466713_143155 Ga0466713_143155_16081_16881 266
139 3300042603 Ga0466714_130620 Ga0466714_130620_1269_2069 266
140 3300042612 Ga0466705_281055 Ga0466705_281055_3734_4534 266
141 3300042616 Ga0466715_614578 Ga0466715_614578_6458_7258 266
142 3300042625 Ga0466730_072635 Ga0466730_072635_354_1154 266
143 3300042636 Ga0466703_195941 Ga0466703_195941_6784_7584 266
144 3300042648 Ga0466709_208437 Ga0466709_208437_29779_30579 266
145 iso_pr_bacteria 8100166142 8100168667 266
146 3300010167 Ga0123353_10273061 Ga0123353_102730613 267
147 3300042582 Ga0466657_227524 Ga0466657_227524_3915_4718 267
148 3300042591 Ga0466692_012515 Ga0466692_012515_45814_46617 267
149 3300042604 Ga0466717_016641 Ga0466717_016641_363_1166 267
150 iso_pr_bacteria 2940336608 2940338723 267
151 3300042596 Ga0466696_276511 Ga0466696_276511_810_1616 268
152 3300042603 Ga0466714_033452 Ga0466714_033452_29598_30404 268
153 3300042659 Ga0466733_053801 Ga0466733_053801_11822_12628 268
154 iso_pr_bacteria 2910959314 2910961122 268
155 3300042596 Ga0466696_443536 Ga0466696_443536_431_1243 270
156 3300000062 IMNBL1DRAFT_c0041569 IMNBL1DRAFT_00415692 272
157 3300042596 Ga0466696_097270 Ga0466696_097270_5967_6785 272
158 3300042598 Ga0466701_014367 Ga0466701_014367_3235_4053 272
159 3300042602 Ga0466713_122628 Ga0466713_122628_606_1427 273
160 3300000036 IMNBGM34_c000048 IMNBGM34_00004810 274
161 3300038395 Ga0415639_111417 Ga0415639_111417_1396_2220 274
162 3300010167 Ga0123353_11115102 Ga0123353_111151021 275
163 iso_pr_bacteria 2820788205 2820788941 276
164 3300010049 Ga0123356_10199343 Ga0123356_101993432 277
165 3300042593 Ga0466691_010908 Ga0466691_010908_84701_85540 279
166 3300002834 JGI24696J40584_12960314 JGI24696J40584_129603147 280
167 3300010167 Ga0123353_10000454 Ga0123353_100004544 280
168 3300042620 Ga0466728_284998 Ga0466728_284998_64_912 282
169 3300042597 Ga0466699_263270 Ga0466699_263270_884_1735 283
170 3300042611 Ga0466697_167565 Ga0466697_167565_240_1097 285
171 3300042636 Ga0466703_258103 Ga0466703_258103_6020_6877 285
172 3300000062 IMNBL1DRAFT_c0049805 IMNBL1DRAFT_00498052 289
173 3300042601 Ga0466707_203571 Ga0466707_203571_33824_34693 289

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00398 RrnaAD Ribosomal RNA adenine dimethylase 36 285 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.