Protein Family IF05881

Metagenome Metatranscriptome Isolate
108 Members
38 Samples
103 Scaffolds
187.97 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_191583|Ga0466707_191583_6199_6771
Length
174 aa
Sequence
MMARRIELPLTPELTATLRAGDAVALSGVIYTARDAAHKRFCELLDAGLPLPFDIRGATIYYAGPTPAAPGRVIGSVGPTTSYRMDAYAPRLLRADAVRETGAVYFGAVGGAGALLSECVKSSEVVAFDELGAEAVHRLVVEDFPAVVVIDSGGRNLYEEGRAAYLRSVAELSD

📊 Sample Types

Isolate 4.6%
Metagenome 94.4%
MAG 0.0%
Metatranscriptome 0.9%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 34.2%
Termitidae 28.9%
Rhinotermitidae 13.2%
Unclassified 10.5%
Termopsidae 7.9%
Stratiomyidae 2.6%
Hodotermitidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 107
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
7 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
11 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
12 650716102 Treponema primitia ZAS-2 Isolate Unclassified
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
21 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
22 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
23 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
24 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
27 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
28 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
35 2508501043 Desulfovibrio termitidis HI1 Isolate Rhinotermitidae
36 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
37 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
38 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466735_138815 3300042624 Bacteria 1046
2 Ga0466703_114568 3300042636 Bacteria 5961
3 Ga0466703_197286 3300042636 Bacteria 21097
4 Ga0466703_274241 3300042636 Bacteria 7659
5 Ga0466691_009241 3300042593 Bacteria 2642
6 Ga0466707_210098 3300042601 Bacteria 23096
7 Ga0466711_288555 3300042615 Bacteria 2894
8 Ga0466729_035822 3300042621 Bacteria 1656
9 JGI24702J35022_10000608 3300002462 Bacteria 21719
10 Ga0072940_1363017 3300005200 Bacteria 2005
11 Ga0466733_018973 3300042659 Bacteria 2578
12 Ga0466735_096071 3300042624 Bacteria 4290
13 Ga0466703_174074 3300042636 Bacteria 1013
14 Ga0466704_258918 3300042643 Bacteria 1679
15 Ga0123355_10823889 3300009826 Bacteria 1028
16 Ga0123353_10401705 3300010167 Bacteria 2039
17 Ga0466691_097101 3300042593 Bacteria 3151
18 Ga0466691_102983 3300042593 Bacteria 4197
19 Ga0466696_038136 3300042596 Bacteria 24965
20 Ga0466707_088156 3300042601 Bacteria 5583
21 Ga0466707_204075 3300042601 Bacteria 6141
22 Ga0466719_118836 3300042606 Bacteria 5830
23 Ga0466715_420090 3300042616 Bacteria 1517
24 Ga0466715_580690 3300042616 Bacteria 5860
25 Ga0466728_125333 3300042620 Bacteria 6574
26 Ga0466728_293940 3300042620 Bacteria 3272
27 Ga0466705_108340 3300042612 Bacteria 1344
28 Ga0466705_244617 3300042612 Bacteria 23734
29 Ga0466705_253916 3300042612 Bacteria 32036
30 Ga0466704_218569 3300042643 Bacteria 14079
31 Ga0466709_029656 3300042648 Bacteria 3528
32 Ga0123357_10702157 3300009784 Bacteria 724
33 Ga0456237_0013236 3300041968 Bacteria 1187
34 Ga0466692_185265 3300042591 Bacteria 21279
35 Ga0466706_271751 3300042599 Bacteria 1281
36 Ga0466714_008116 3300042603 Bacteria 1442
37 Ga0466715_489575 3300042616 Bacteria 2098
38 Ga0466726_052739 3300042619 Bacteria 1479
39 Ga0466703_094735 3300042636 Bacteria 23319
40 Ga0466703_137337 3300042636 Bacteria 3180
41 Ga0466704_344304 3300042643 Bacteria 5917
42 Ga0466704_470499 3300042643 Bacteria 1878
43 Ga0466727_327654 3300042655 Bacteria 1346
44 Ga0123356_10667602 3300010049 Bacteria 1207
45 Ga0466690_151426 3300042590 Bacteria 5501
46 Ga0466692_038896 3300042591 Bacteria 28476
47 Ga0466692_161449 3300042591 Bacteria 10345
48 Ga0466691_220622 3300042593 Bacteria 26319
49 Ga0466707_115598 3300042601 Bacteria 1271
50 Ga0466707_191583 3300042601 Bacteria 10281
51 Ga0466707_206150 3300042601 Bacteria 3167
52 Ga0466717_016128 3300042604 Bacteria 1511
53 Ga0466716_334140 3300042605 Bacteria 1306
54 Ga0466720_067906 3300042607 Bacteria 18249
55 Ga0466723_055980 3300042618 Bacteria 15225
56 Ga0466705_180766 3300042612 Bacteria 1904
57 Ga0466705_367434 3300042612 Bacteria 38777
58 Ga0466733_116478 3300042659 Bacteria 1693
59 Ga0466703_011664 3300042636 Bacteria 9112
60 Ga0466703_083751 3300042636 Unclassified 2542
61 Ga0466709_346744 3300042648 Bacteria 3100
62 Ga0123357_10465583 3300009784 Bacteria 1082
63 Ga0255809_1015635 3300022820 Bacteria 1295
64 Ga0466690_197520 3300042590 Bacteria 6571
65 Ga0466690_431370 3300042590 Bacteria 1203
66 Ga0466691_194674 3300042593 Bacteria 5253
67 Ga0466696_305521 3300042596 Bacteria 23613
68 Ga0466696_446926 3300042596 Bacteria 40059
69 Ga0466706_003346 3300042599 Bacteria 1265
70 Ga0466707_025376 3300042601 Bacteria 1023
71 Ga0466711_347463 3300042615 Bacteria 7887
72 Ga0466726_448489 3300042619 Bacteria 4860
73 Ga0466703_253233 3300042636 Bacteria 2601
74 Ga0123355_10454242 3300009826 Bacteria 1612
75 Ga0466722_044244 3300042609 Bacteria 4116
76 Ga0466722_063049 3300042609 Bacteria 8114
77 Ga0466705_484536 3300042612 Bacteria 3551
78 Ga0466711_160989 3300042615 Bacteria 1852
79 Ga0466723_138267 3300042618 Bacteria 4230
80 Ga0466723_238871 3300042618 Bacteria 2040
81 Ga0466726_392595 3300042619 Bacteria 2490
82 Ga0466704_164622 3300042643 Bacteria 6539
83 Ga0466704_565468 3300042643 Bacteria 2387
84 Ga0466727_133968 3300042655 Bacteria 3112
85 Ga0123355_11058415 3300009826 Bacteria 851
86 Ga0466690_057769 3300042590 Bacteria 1660
87 Ga0466707_169266 3300042601 Bacteria 1404
88 Ga0466722_019618 3300042609 Bacteria 14260
89 Ga0466711_352913 3300042615 Bacteria 3219
90 Ga0466715_362802 3300042616 Bacteria 2498
91 Ga0466715_441505 3300042616 Bacteria 13792
92 Ga0466726_171295 3300042619 Bacteria 2450
93 Ga0466726_376914 3300042619 Bacteria 1077
94 Ga0466729_207463 3300042621 Bacteria 64397
95 Ga0466703_020388 3300042636 Bacteria 11755
96 Ga0466703_137551 3300042636 Bacteria 3674
97 Ga0123353_10045611 3300010167 Bacteria 6958
98 Ga0466691_061642 3300042593 Bacteria 11271
99 Ga0466696_035678 3300042596 Bacteria 1208
100 Ga0466722_072402 3300042609 Bacteria 1507
101 Ga0466711_431539 3300042615 Bacteria 2737
102 Ga0466723_317041 3300042618 Bacteria 1933
103 Ga0466728_385290 3300042620 Bacteria 44462

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009826 Ga0123355_10454242 Ga0123355_104542422 174
2 3300009826 Ga0123355_10823889 Ga0123355_108238892 174
3 3300042601 Ga0466707_191583 Ga0466707_191583_6199_6771 174
4 3300042621 Ga0466729_207463 Ga0466729_207463_59529_60056 175
5 iso_pr_bacteria 2508501043 2508701666 175
6 3300042643 Ga0466704_470499 Ga0466704_470499_325_861 178
7 3300042619 Ga0466726_448489 Ga0466726_448489_845_1387 180
8 3300042593 Ga0466691_009241 Ga0466691_009241_115_660 181
9 3300042601 Ga0466707_206150 Ga0466707_206150_1197_1757 181
10 3300042643 Ga0466704_218569 Ga0466704_218569_1451_1996 181
11 3300041968 Ga0456237_0013236 Ga0456237_0013236_272_820 182
12 3300042607 Ga0466720_067906 Ga0466720_067906_6208_6759 183
13 3300005200 Ga0072940_1363017 Ga0072940_13630172 184
14 3300010049 Ga0123356_10667602 Ga0123356_106676022 184
15 3300042590 Ga0466690_197520 Ga0466690_197520_5672_6226 184
16 3300042596 Ga0466696_035678 Ga0466696_035678_527_1081 184
17 3300042601 Ga0466707_210098 Ga0466707_210098_4873_5427 184
18 3300042606 Ga0466719_118836 Ga0466719_118836_2773_3327 184
19 3300042612 Ga0466705_367434 Ga0466705_367434_17717_18271 184
20 3300042616 Ga0466715_362802 Ga0466715_362802_1516_2070 184
21 3300042616 Ga0466715_489575 Ga0466715_489575_1343_1897 184
22 3300042619 Ga0466726_171295 Ga0466726_171295_1476_2030 184
23 3300042620 Ga0466728_293940 Ga0466728_293940_779_1333 184
24 3300042621 Ga0466729_035822 Ga0466729_035822_136_690 184
25 3300042636 Ga0466703_274241 Ga0466703_274241_1179_1733 184
26 3300022820 Ga0255809_1015635 Ga0255809_10156353 185
27 3300042591 Ga0466692_161449 Ga0466692_161449_8966_9523 185
28 3300042591 Ga0466692_185265 Ga0466692_185265_4499_5056 185
29 3300042599 Ga0466706_003346 Ga0466706_003346_44_601 185
30 3300042604 Ga0466717_016128 Ga0466717_016128_338_895 185
31 3300042612 Ga0466705_244617 Ga0466705_244617_5057_5614 185
32 3300042655 Ga0466727_327654 Ga0466727_327654_555_1112 185
33 3300009784 Ga0123357_10465583 Ga0123357_104655832 186
34 3300009784 Ga0123357_10702157 Ga0123357_107021571 186
35 3300042593 Ga0466691_097101 Ga0466691_097101_1069_1629 186
36 3300042593 Ga0466691_194674 Ga0466691_194674_4154_4714 186
37 3300042593 Ga0466691_220622 Ga0466691_220622_19627_20187 186
38 3300042601 Ga0466707_025376 Ga0466707_025376_255_815 186
39 3300042612 Ga0466705_253916 Ga0466705_253916_19896_20456 186
40 3300042615 Ga0466711_160989 Ga0466711_160989_1032_1592 186
41 3300042615 Ga0466711_431539 Ga0466711_431539_2034_2594 186
42 3300042618 Ga0466723_138267 Ga0466723_138267_1058_1618 186
43 3300042618 Ga0466723_238871 Ga0466723_238871_169_729 186
44 3300042620 Ga0466728_125333 Ga0466728_125333_5141_5701 186
45 3300042624 Ga0466735_096071 Ga0466735_096071_2748_3308 186
46 3300042659 Ga0466733_018973 Ga0466733_018973_1994_2554 186
47 3300042659 Ga0466733_116478 Ga0466733_116478_1120_1680 186
48 3300042590 Ga0466690_431370 Ga0466690_431370_162_725 187
49 3300042593 Ga0466691_061642 Ga0466691_061642_7287_7850 187
50 3300042603 Ga0466714_008116 Ga0466714_008116_650_1213 187
51 3300042609 Ga0466722_019618 Ga0466722_019618_12454_13017 187
52 3300042609 Ga0466722_072402 Ga0466722_072402_221_784 187
53 3300042612 Ga0466705_108340 Ga0466705_108340_204_767 187
54 3300042615 Ga0466711_347463 Ga0466711_347463_1261_1824 187
55 3300042619 Ga0466726_052739 Ga0466726_052739_380_943 187
56 iso_pr_bacteria 8030337018 8030337570 187
57 3300042593 Ga0466691_102983 Ga0466691_102983_1309_1875 188
58 3300042601 Ga0466707_088156 Ga0466707_088156_323_889 188
59 3300042612 Ga0466705_180766 Ga0466705_180766_780_1346 188
60 3300042618 Ga0466723_055980 Ga0466723_055980_7001_7567 188
61 3300042636 Ga0466703_114568 Ga0466703_114568_2291_2857 188
62 3300042643 Ga0466704_258918 Ga0466704_258918_182_748 188
63 3300009826 Ga0123355_11058415 Ga0123355_110584152 189
64 3300010167 Ga0123353_10401705 Ga0123353_104017051 189
65 3300042601 Ga0466707_204075 Ga0466707_204075_5501_6070 189
66 3300042612 Ga0466705_484536 Ga0466705_484536_1240_1809 189
67 3300042620 Ga0466728_385290 Ga0466728_385290_12491_13060 189
68 3300042636 Ga0466703_253233 Ga0466703_253233_713_1282 189
69 3300042648 Ga0466709_029656 Ga0466709_029656_1221_1790 189
70 3300042648 Ga0466709_346744 Ga0466709_346744_1100_1669 189
71 iso_pr_bacteria 2820223845 2820225018 189
72 3300002462 JGI24702J35022_10000608 JGI24702J35022_100006084 190
73 3300010167 Ga0123353_10045611 Ga0123353_100456113 190
74 3300042596 Ga0466696_446926 Ga0466696_446926_38521_39093 190
75 3300042624 Ga0466735_138815 Ga0466735_138815_446_1018 190
76 3300042636 Ga0466703_011664 Ga0466703_011664_1536_2108 190
77 3300042636 Ga0466703_020388 Ga0466703_020388_7515_8087 190
78 3300042636 Ga0466703_197286 Ga0466703_197286_9004_9576 190
79 3300042643 Ga0466704_164622 Ga0466704_164622_3691_4263 190
80 3300042643 Ga0466704_565468 Ga0466704_565468_1276_1848 190
81 3300042655 Ga0466727_133968 Ga0466727_133968_2084_2656 190
82 iso_pr_bacteria 650716102 650883365 190
83 3300042601 Ga0466707_115598 Ga0466707_115598_131_706 191
84 3300042601 Ga0466707_169266 Ga0466707_169266_264_839 191
85 3300042616 Ga0466715_420090 Ga0466715_420090_470_1045 191
86 3300042609 Ga0466722_044244 Ga0466722_044244_2197_2775 192
87 3300042609 Ga0466722_063049 Ga0466722_063049_4671_5249 192
88 3300042615 Ga0466711_352913 Ga0466711_352913_1391_1969 192
89 3300042616 Ga0466715_580690 Ga0466715_580690_424_1002 192
90 3300042618 Ga0466723_317041 Ga0466723_317041_1299_1877 192
91 3300042619 Ga0466726_392595 Ga0466726_392595_1757_2335 192
92 3300042636 Ga0466703_137551 Ga0466703_137551_1356_1934 192
93 3300042590 Ga0466690_151426 Ga0466690_151426_958_1539 193
94 3300042596 Ga0466696_038136 Ga0466696_038136_7757_8338 193
95 3300042599 Ga0466706_271751 Ga0466706_271751_651_1232 193
96 3300042619 Ga0466726_376914 Ga0466726_376914_195_776 193
97 3300042636 Ga0466703_094735 Ga0466703_094735_12932_13513 193
98 iso_pr_bacteria 2820602899 2820605778 193
99 3300042616 Ga0466715_441505 Ga0466715_441505_3849_4433 194
100 3300042596 Ga0466696_305521 Ga0466696_305521_19595_20182 195
101 3300042615 Ga0466711_288555 Ga0466711_288555_1606_2193 195
102 3300042636 Ga0466703_174074 Ga0466703_174074_315_908 197
103 3300042636 Ga0466703_083751 Ga0466703_083751_1251_1847 198
104 3300042643 Ga0466704_344304 Ga0466704_344304_2238_2837 199
105 3300042590 Ga0466690_057769 Ga0466690_057769_677_1285 202
106 3300042591 Ga0466692_038896 Ga0466692_038896_20797_21411 204
107 3300042636 Ga0466703_137337 Ga0466703_137337_1663_2295 210
108 3300042605 Ga0466716_334140 Ga0466716_334140_24_671 215

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF05683 Fumerase_C Fumarase C-terminus 96 160 0.97

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF05683 GO:0016836 hydro-lyase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.