Protein Family IF05874

Metagenome Isolate
133 Members
45 Samples
130 Scaffolds
180.51 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_179776|Ga0466707_179776_2880_3470
Length
196 aa
Sequence
MRIISGKYKSRRFDVPKSFKARPTTDFAKENIFNVVANLIDLDDAVALDLFAGTGSISFELLSRGCREVVCIEKDSAHYAFIKKVKAELSAENLTTLKTDAFRFIESAGQTFDFIFADPPYALKDLPRIPELVLSHGLLNPEGVFVMEHPKEYDFSHLPYFSQRRIYGAVNFSVFIPIQPALFSRDSSPLPIFRRK

📊 Sample Types

Isolate 2.3%
Metagenome 97.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.6%
Kalotermitidae 30.2%
Unclassified 14.0%
Termopsidae 9.3%
Rhinotermitidae 7.0%
Passalidae 4.7%
Hodotermitidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 128
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
2 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
3 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
12 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
13 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
14 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
15 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
16 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
17 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
18 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
22 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
25 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
26 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
27 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
28 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
29 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
30 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
31 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
32 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
33 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
34 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
35 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
36 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
37 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
38 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
39 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
40 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
41 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
42 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
43 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
44 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466692_008888 3300042591 Bacteria 27213
2 Ga0466692_191579 3300042591 Bacteria 2033
3 Ga0466696_498571 3300042596 Bacteria 2162
4 Ga0466707_400240 3300042601 Bacteria 1575
5 Ga0466713_061789 3300042602 Bacteria 88378
6 Ga0466735_149260 3300042624 Bacteria 1661
7 Ga0466703_407425 3300042636 Bacteria 4629
8 Ga0466704_478384 3300042643 Bacteria 27201
9 Ga0466727_033053 3300042655 Bacteria 32312
10 Ga0466727_192398 3300042655 Bacteria 2746
11 IMNBL1DRAFT_c0012771 3300000062 Bacteria 3817
12 JGI24702J35022_10028582 3300002462 Bacteria 2995
13 Ga0123357_10179001 3300009784 Bacteria 2482
14 Ga0123357_10404300 3300009784 Bacteria 1238
15 Ga0123356_10055837 3300010049 Bacteria 3678
16 Ga0466690_233246 3300042590 Bacteria 10576
17 Ga0466694_116893 3300042594 Bacteria 5011
18 Ga0466700_002689 3300042600 Bacteria 3362
19 Ga0466700_145866 3300042600 Bacteria 2128
20 Ga0466700_269640 3300042600 Bacteria 2373
21 Ga0466716_289360 3300042605 Unclassified 3356
22 Ga0466722_038834 3300042609 Bacteria 2831
23 Ga0466722_230401 3300042609 Bacteria 7477
24 Ga0466711_067449 3300042615 Bacteria 8197
25 Ga0466715_076420 3300042616 Bacteria 5040
26 Ga0466723_059303 3300042618 Bacteria 8252
27 Ga0466723_132747 3300042618 Bacteria 21573
28 Ga0466734_035703 3300042623 Bacteria 1728
29 Ga0466703_266607 3300042636 Bacteria 7383
30 2227268305 2225789004 Unclassified 1284
31 Ga0068302_10124951 3300005071 Bacteria 4115
32 Ga0123357_10103711 3300009784 Bacteria 3656
33 Ga0466690_233716 3300042590 Bacteria 2208
34 Ga0466696_178899 3300042596 Bacteria 5412
35 Ga0466707_014815 3300042601 Bacteria 5344
36 Ga0466707_194378 3300042601 Bacteria 1198
37 Ga0466707_377121 3300042601 Bacteria 2953
38 Ga0466716_288764 3300042605 Bacteria 43815
39 Ga0466722_132071 3300042609 Bacteria 17043
40 Ga0466711_137465 3300042615 Bacteria 3533
41 Ga0466715_109794 3300042616 Bacteria 37807
42 Ga0466705_170791 3300042612 Bacteria 4459
43 Ga0466734_119028 3300042623 Bacteria 2623
44 Ga0466735_097693 3300042624 Bacteria 3246
45 Ga0466704_413379 3300042643 Bacteria 23876
46 Ga0466727_291286 3300042655 Bacteria 4125
47 Ga0466727_301768 3300042655 Bacteria 5397
48 2227486883 2225789004 Bacteria 4215
49 Ga0123357_10005752 3300009784 Bacteria 14935
50 Ga0265387_1012996 3300024582 Bacteria 1158
51 Ga0466690_335757 3300042590 Bacteria 13497
52 Ga0466696_030088 3300042596 Bacteria 9675
53 Ga0466696_248458 3300042596 Bacteria 8958
54 Ga0466696_284879 3300042596 Bacteria 7866
55 Ga0466729_062936 3300042621 Bacteria 14359
56 Ga0466735_102269 3300042624 Bacteria 4486
57 Ga0466725_000375 3300042654 Bacteria 23344
58 Ga0466727_196437 3300042655 Bacteria 12378
59 JGI24702J35022_10014413 3300002462 Bacteria 4362
60 Ga0123357_10004943 3300009784 Bacteria 15821
61 Ga0466696_299299 3300042596 Bacteria 2062
62 Ga0466707_038585 3300042601 Bacteria 11421
63 Ga0466707_094824 3300042601 Bacteria 30684
64 Ga0466716_491259 3300042605 Bacteria 15138
65 Ga0466723_038290 3300042618 Bacteria 2294
66 Ga0466726_178424 3300042619 Bacteria 7902
67 Ga0466729_193243 3300042621 Bacteria 1629
68 Ga0466705_127316 3300042612 Bacteria 13532
69 2227463519 2225789004 Bacteria 25632
70 IMNBL1DRAFT_c0002844 3300000062 Unclassified 11642
71 JGI24695J34938_10240258 3300002450 Bacteria 765
72 JGI24702J35022_10002093 3300002462 Bacteria 12321
73 JGI24696J40584_12921462 3300002834 Bacteria 1353
74 Ga0072941_1134452 3300005201 Bacteria 1697
75 Ga0466733_016781 3300042659 Bacteria 12104
76 Ga0123354_10055732 3300010882 Bacteria 5911
77 Ga0466701_011753 3300042598 Bacteria 6664
78 Ga0466706_165086 3300042599 Bacteria 15452
79 Ga0466707_410729 3300042601 Bacteria 18453
80 Ga0466713_055966 3300042602 Bacteria 71857
81 Ga0466713_140075 3300042602 Bacteria 6499
82 Ga0466716_250561 3300042605 Bacteria 4073
83 Ga0466698_136679 3300042610 Bacteria 1401
84 Ga0466723_196459 3300042618 Bacteria 12816
85 Ga0466726_442609 3300042619 Bacteria 14068
86 Ga0466729_083382 3300042621 Bacteria 8078
87 Ga0466735_116668 3300042624 Bacteria 13149
88 Ga0466735_153548 3300042624 Bacteria 1553
89 Ga0466704_451688 3300042643 Bacteria 10862
90 IMNBL1DRAFT_c0004470 3300000062 Bacteria 8411
91 Ga0068302_10024942 3300005071 Unclassified 3966
92 Ga0123354_10021249 3300010882 Bacteria 10227
93 Ga0466690_120762 3300042590 Bacteria 8697
94 Ga0466696_024621 3300042596 Unclassified 10848
95 Ga0466696_039610 3300042596 Bacteria 13665
96 Ga0466700_390206 3300042600 Bacteria 53046
97 Ga0466707_179776 3300042601 Bacteria 8282
98 Ga0466719_261383 3300042606 Bacteria 3358
99 Ga0466728_141606 3300042620 Bacteria 1209
100 Ga0466735_023623 3300042624 Bacteria 3381
101 Ga0466703_176953 3300042636 Bacteria 5176
102 Ga0466704_121319 3300042643 Bacteria 43299
103 Ga0466709_376736 3300042648 Bacteria 1197
104 Ga0466708_435851 3300042652 Bacteria 53327
105 2227211073 2225789004 Bacteria 1414
106 2227494071 2225789004 Bacteria 20234
107 JGI24702J35022_10025037 3300002462 Bacteria 3222
108 Ga0123356_13114657 3300010049 Bacteria 578
109 Ga0123354_10000907 3300010882 Bacteria 33208
110 Ga0466656_202107 3300042550 Bacteria 9413
111 Ga0466696_057108 3300042596 Bacteria 10259
112 Ga0466701_091620 3300042598 Bacteria 2894
113 Ga0466707_176524 3300042601 Bacteria 6495
114 Ga0466707_222979 3300042601 Bacteria 1756
115 Ga0466711_020407 3300042615 Bacteria 13395
116 Ga0466711_199160 3300042615 Bacteria 9042
117 Ga0466723_028830 3300042618 Bacteria 17760
118 Ga0466728_005517 3300042620 Bacteria 23116
119 Ga0466728_029201 3300042620 Bacteria 4650
120 Ga0466705_315418 3300042612 Bacteria 36789
121 Ga0466729_200954 3300042621 Bacteria 1381
122 Ga0466729_203270 3300042621 Bacteria 9490
123 Ga0466735_046374 3300042624 Bacteria 2359
124 Ga0466735_064245 3300042624 Bacteria 4679
125 Ga0466735_064762 3300042624 Bacteria 1623
126 Ga0466709_012705 3300042648 Bacteria 4268
127 Ga0466709_307870 3300042648 Bacteria 13082
128 Ga0466709_413845 3300042648 Bacteria 3465
129 Ga0466727_017336 3300042655 Bacteria 9433
130 Ga0068305_10055564 3300005083 Bacteria 18731

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005071 Ga0068302_10024942 Ga0068302_100249422 140
2 3300042609 Ga0466722_038834 Ga0466722_038834_769_1269 166
3 3300042655 Ga0466727_196437 Ga0466727_196437_4918_5418 166
4 3300042621 Ga0466729_062936 Ga0466729_062936_6011_6526 171
5 3300042596 Ga0466696_248458 Ga0466696_248458_2183_2707 174
6 2225789004 2227268305 2227716586 176
7 3300042648 Ga0466709_413845 Ga0466709_413845_2695_3225 176
8 2225789004 2227463519 2227898802 177
9 2225789004 2227486883 2227954176 177
10 3300000062 IMNBL1DRAFT_c0002844 IMNBL1DRAFT_00028449 177
11 3300010882 Ga0123354_10021249 Ga0123354_100212497 177
12 3300042600 Ga0466700_390206 Ga0466700_390206_13710_14243 177
13 3300042601 Ga0466707_094824 Ga0466707_094824_26716_27249 177
14 3300042601 Ga0466707_222979 Ga0466707_222979_363_896 177
15 3300042601 Ga0466707_377121 Ga0466707_377121_1755_2288 177
16 3300042612 Ga0466705_170791 Ga0466705_170791_1837_2370 177
17 3300042618 Ga0466723_059303 Ga0466723_059303_2660_3193 177
18 3300042623 Ga0466734_119028 Ga0466734_119028_500_1033 177
19 3300042624 Ga0466735_097693 Ga0466735_097693_2628_3161 177
20 iso_pr_bacteria 2967483437 2967483456 177
21 3300002462 JGI24702J35022_10014413 JGI24702J35022_100144132 178
22 3300042590 Ga0466690_233716 Ga0466690_233716_94_630 178
23 3300042591 Ga0466692_008888 Ga0466692_008888_8357_8893 178
24 3300042596 Ga0466696_030088 Ga0466696_030088_6239_6775 178
25 3300042596 Ga0466696_178899 Ga0466696_178899_2832_3368 178
26 3300042596 Ga0466696_284879 Ga0466696_284879_4151_4687 178
27 3300042598 Ga0466701_091620 Ga0466701_091620_882_1418 178
28 3300042601 Ga0466707_014815 Ga0466707_014815_4153_4689 178
29 3300042601 Ga0466707_176524 Ga0466707_176524_1081_1617 178
30 3300042601 Ga0466707_400240 Ga0466707_400240_622_1158 178
31 3300042606 Ga0466719_261383 Ga0466719_261383_181_717 178
32 3300042609 Ga0466722_132071 Ga0466722_132071_7692_8228 178
33 3300042610 Ga0466698_136679 Ga0466698_136679_183_719 178
34 3300042612 Ga0466705_315418 Ga0466705_315418_16990_17526 178
35 3300042615 Ga0466711_020407 Ga0466711_020407_5584_6120 178
36 3300042615 Ga0466711_199160 Ga0466711_199160_454_990 178
37 3300042618 Ga0466723_038290 Ga0466723_038290_208_744 178
38 3300042621 Ga0466729_083382 Ga0466729_083382_2422_2958 178
39 3300042621 Ga0466729_203270 Ga0466729_203270_5818_6354 178
40 3300042643 Ga0466704_413379 Ga0466704_413379_3747_4283 178
41 3300002462 JGI24702J35022_10025037 JGI24702J35022_100250374 179
42 3300002462 JGI24702J35022_10028582 JGI24702J35022_100285823 179
43 3300009784 Ga0123357_10005752 Ga0123357_100057527 179
44 3300009784 Ga0123357_10103711 Ga0123357_101037112 179
45 3300042591 Ga0466692_191579 Ga0466692_191579_654_1193 179
46 3300042594 Ga0466694_116893 Ga0466694_116893_3279_3818 179
47 3300042596 Ga0466696_498571 Ga0466696_498571_340_879 179
48 3300042601 Ga0466707_038585 Ga0466707_038585_9784_10323 179
49 3300042601 Ga0466707_410729 Ga0466707_410729_584_1123 179
50 3300042602 Ga0466713_140075 Ga0466713_140075_3586_4125 179
51 3300042605 Ga0466716_288764 Ga0466716_288764_34328_34867 179
52 3300042605 Ga0466716_289360 Ga0466716_289360_1740_2279 179
53 3300042609 Ga0466722_230401 Ga0466722_230401_4049_4588 179
54 3300042619 Ga0466726_442609 Ga0466726_442609_4197_4736 179
55 3300042620 Ga0466728_029201 Ga0466728_029201_19_558 179
56 3300042621 Ga0466729_200954 Ga0466729_200954_423_962 179
57 3300042624 Ga0466735_102269 Ga0466735_102269_1989_2528 179
58 3300042643 Ga0466704_451688 Ga0466704_451688_5537_6076 179
59 3300042655 Ga0466727_017336 Ga0466727_017336_8372_8911 179
60 3300042655 Ga0466727_033053 Ga0466727_033053_21215_21754 179
61 3300042655 Ga0466727_301768 Ga0466727_301768_4735_5274 179
62 3300009784 Ga0123357_10004943 Ga0123357_100049437 180
63 3300009784 Ga0123357_10179001 Ga0123357_101790013 180
64 3300010049 Ga0123356_13114657 Ga0123356_131146571 180
65 3300024582 Ga0265387_1012996 Ga0265387_10129962 180
66 3300042600 Ga0466700_269640 Ga0466700_269640_110_652 180
67 3300042623 Ga0466734_035703 Ga0466734_035703_562_1104 180
68 3300042624 Ga0466735_064245 Ga0466735_064245_3681_4223 180
69 3300042643 Ga0466704_478384 Ga0466704_478384_7601_8143 180
70 3300042648 Ga0466709_012705 Ga0466709_012705_1781_2323 180
71 iso_pr_bacteria 2820778767 2820778888 180
72 2225789004 2227494071 2227969269 181
73 3300042590 Ga0466690_233246 Ga0466690_233246_5701_6246 181
74 3300042596 Ga0466696_039610 Ga0466696_039610_10706_11251 181
75 3300042596 Ga0466696_299299 Ga0466696_299299_1307_1852 181
76 3300042598 Ga0466701_011753 Ga0466701_011753_5378_5923 181
77 3300042600 Ga0466700_002689 Ga0466700_002689_122_667 181
78 3300042618 Ga0466723_196459 Ga0466723_196459_8690_9235 181
79 3300042619 Ga0466726_178424 Ga0466726_178424_5484_6029 181
80 3300042624 Ga0466735_023623 Ga0466735_023623_149_694 181
81 3300042624 Ga0466735_046374 Ga0466735_046374_249_794 181
82 3300042624 Ga0466735_064762 Ga0466735_064762_252_797 181
83 3300042624 Ga0466735_153548 Ga0466735_153548_661_1206 181
84 3300042648 Ga0466709_376736 Ga0466709_376736_221_766 181
85 3300042654 Ga0466725_000375 Ga0466725_000375_103_648 181
86 3300000062 IMNBL1DRAFT_c0012771 IMNBL1DRAFT_00127714 182
87 3300005071 Ga0068302_10124951 Ga0068302_101249514 182
88 3300042596 Ga0466696_057108 Ga0466696_057108_1850_2398 182
89 3300042601 Ga0466707_194378 Ga0466707_194378_495_1043 182
90 3300042615 Ga0466711_137465 Ga0466711_137465_696_1244 182
91 3300042616 Ga0466715_076420 Ga0466715_076420_4448_4996 182
92 3300042618 Ga0466723_028830 Ga0466723_028830_5171_5719 182
93 3300042620 Ga0466728_005517 Ga0466728_005517_988_1536 182
94 3300042624 Ga0466735_149260 Ga0466735_149260_75_623 182
95 3300042655 Ga0466727_291286 Ga0466727_291286_14_562 182
96 iso_pr_bacteria 2695420931 2698109557 182
97 3300002834 JGI24696J40584_12921462 JGI24696J40584_129214622 183
98 3300042602 Ga0466713_055966 Ga0466713_055966_13537_14088 183
99 3300042636 Ga0466703_176953 Ga0466703_176953_3378_3929 183
100 3300002450 JGI24695J34938_10240258 JGI24695J34938_102402581 184
101 3300010882 Ga0123354_10000907 Ga0123354_1000090719 184
102 3300042590 Ga0466690_335757 Ga0466690_335757_4660_5214 184
103 3300042605 Ga0466716_250561 Ga0466716_250561_2299_2853 184
104 3300042612 Ga0466705_127316 Ga0466705_127316_4508_5062 184
105 3300042615 Ga0466711_067449 Ga0466711_067449_1384_1938 184
106 3300042620 Ga0466728_141606 Ga0466728_141606_486_1040 184
107 3300042636 Ga0466703_266607 Ga0466703_266607_4228_4782 184
108 3300042643 Ga0466704_121319 Ga0466704_121319_16699_17253 184
109 2225789004 2227211073 2227639934 185
110 3300010882 Ga0123354_10055732 Ga0123354_100557321 185
111 3300042550 Ga0466656_202107 Ga0466656_202107_219_776 185
112 3300042590 Ga0466690_120762 Ga0466690_120762_4753_5310 185
113 3300042596 Ga0466696_024621 Ga0466696_024621_6542_7099 185
114 3300042602 Ga0466713_061789 Ga0466713_061789_65745_66302 185
115 3300042605 Ga0466716_491259 Ga0466716_491259_5901_6458 185
116 3300042616 Ga0466715_109794 Ga0466715_109794_28897_29454 185
117 3300042624 Ga0466735_116668 Ga0466735_116668_11776_12333 185
118 3300042636 Ga0466703_407425 Ga0466703_407425_2004_2561 185
119 3300042648 Ga0466709_307870 Ga0466709_307870_8996_9553 185
120 3300042652 Ga0466708_435851 Ga0466708_435851_49340_49897 185
121 3300042659 Ga0466733_016781 Ga0466733_016781_7048_7605 185
122 3300000062 IMNBL1DRAFT_c0004470 IMNBL1DRAFT_00044703 186
123 3300005083 Ga0068305_10055564 Ga0068305_100555648 186
124 3300009784 Ga0123357_10404300 Ga0123357_104043002 186
125 3300042655 Ga0466727_192398 Ga0466727_192398_101_664 187
126 3300005201 Ga0072941_1134452 Ga0072941_11344523 188
127 3300042599 Ga0466706_165086 Ga0466706_165086_6803_7369 188
128 3300042600 Ga0466700_145866 Ga0466700_145866_232_801 189
129 3300042618 Ga0466723_132747 Ga0466723_132747_4475_5044 189
130 3300010049 Ga0123356_10055837 Ga0123356_100558374 191
131 3300002462 JGI24702J35022_10002093 JGI24702J35022_100020934 192
132 3300042621 Ga0466729_193243 Ga0466729_193243_687_1274 195
133 3300042601 Ga0466707_179776 Ga0466707_179776_2880_3470 196

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03602 Cons_hypoth95 Conserved hypothetical protein 95 1 174 0.91
PF13847 Methyltransf_31 Methyltransferase domain 44 152 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.