Protein Family IF05873

Metagenome Metatranscriptome Isolate
258 Members
188 Samples
137 Scaffolds
114.69 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_175608|Ga0466707_175608_5544_6005
Length
132 aa
Sequence
MQARAIAKNIGVTPRKARLIVDLVRGKAIEDAYAILENTNKSASLPVLKVIKSATANAVKNLNLKADDLFVKEIFVDEAIKMRRFLPRAKGSASGLVKRWSHITAVVSDEIGERKIKKAKVEPVVAEGKGAK

📊 Sample Types

Isolate 46.9%
Metagenome 52.7%
MAG 0.0%
Metatranscriptome 0.4%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 27.4%
Apidae 20.0%
Termitidae 12.0%
Kalotermitidae 7.4%
Drosophilidae 5.7%
Halictidae 5.1%
Tenebrionidae 4.6%
Formicidae 2.9%
Scarabaeidae 2.9%
Rhinotermitidae 2.3%
Termopsidae 2.3%
Dytiscidae 1.1%
Passalidae 1.1%
Vespidae 0.6%
Bombycidae 0.6%
Hodotermitidae 0.6%
Rhaphidophoridae 0.6%
Noctuidae 0.6%
Gomphidae 0.6%
Cicadellidae 0.6%
Libellulidae 0.6%
Hydrophilidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 238
Eukaryota 0
Viruses 0
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
2 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
3 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
4 2595698193 Melissococcus plutonius B5 Isolate Apidae
5 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
6 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
7 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
8 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
9 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
10 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
11 2820416776 Unclassified Firmicutes Lab288P3bin9 Isolate Unclassified
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
14 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
15 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
16 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
17 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
18 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
19 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
20 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
21 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
25 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
26 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 2896402965 Weissella diestrammenae KACC 16890 Isolate Rhaphidophoridae
29 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
30 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
31 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
32 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
33 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
34 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
35 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
36 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
37 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
38 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
39 8108568626 Enterococcus sp. DIV1094 Isolate
40 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
41 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
42 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
43 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
44 3300026559 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 Metagenome Formicidae
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
49 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
50 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
51 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
52 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
53 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
54 2595698195 Melissococcus plutonius 119 Isolate Apidae
55 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
56 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
57 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
58 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
59 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
60 8007223943 Enterococcus sp. MSG2901 Isolate
61 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
62 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
63 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
64 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
65 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
66 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
67 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
68 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
69 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
70 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
71 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
72 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
73 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
74 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
75 2684622912 Lactobacillus apis Lb_185 Isolate Unclassified
76 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
77 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
78 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
79 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
80 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
81 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
82 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
83 2820471304 Unclassified Firmicutes Lab288P1bin89 Isolate Unclassified
84 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
85 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
86 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
87 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
88 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
89 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
90 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
91 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
92 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
93 3300026558 Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 Metagenome Formicidae
94 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
95 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
96 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
97 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
98 2834540479 Leuconostoc citreum DmW_111 Isolate Drosophilidae
99 2595698198 Melissococcus plutonius L9 Isolate Apidae
100 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
101 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
102 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
103 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
104 2718218463 Candidatus Phytoplasma M3 Isolate Cicadellidae
105 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
106 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
107 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
108 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
109 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
110 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
111 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
112 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
113 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
114 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
115 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
116 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
117 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
118 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
119 8114555646 Enterococcus sp. DIV1094 Isolate
120 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
121 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
122 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
123 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
124 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
125 2627853628 Melissococcus plutonius 82 Isolate Apidae
126 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
127 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
128 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
129 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
130 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
131 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
132 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
133 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
134 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
135 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
136 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
137 2912324399 Lactobacillus apis ESL0185 Isolate Apidae
138 2595698197 Melissococcus plutonius H6 Isolate Apidae
139 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
140 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
141 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
142 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
143 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
144 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
145 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
146 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
147 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
148 3300008519 Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Neivamyrmex summichrasti Gut microbial communities of Neivamyrmex summichrasti Metagenome Formicidae
149 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
150 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
151 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
152 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
153 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
154 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
155 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
156 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
157 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
158 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
159 2595698199 Melissococcus plutonius 60 Isolate Apidae
160 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
161 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
162 2756170272 Convivina intestini DSM 28795 Isolate Unclassified
163 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
164 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
165 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
166 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
167 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
168 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
169 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
170 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
171 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
172 3300061801 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_LDPE_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
173 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
174 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
175 8007237282 Enterococcus sp. DIV0212c Isolate
176 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
177 8017489919 Lactobacillus brevis EF Isolate Unclassified
178 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
179 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
180 8066802609 Apilactobacillus timberlakei HV_09 Isolate Halictidae
181 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
182 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
183 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
184 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
185 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
186 3004719924 Lactobacillus sp. W8174 Isolate Apidae
187 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
188 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0009 3300056790 Bacteria 1927879
2 Ga0562378_0004 3300056814 Bacteria 2423881
3 HBC_ctgsDRAFT_1001649 3300000333 Unclassified 4895
4 JGI24702J35022_10069278 3300002462 Bacteria 1897
5 JGI24697J35500_11260002 3300002507 Unclassified 2953
6 Ga0068305_10009599 3300005083 Bacteria 20421
7 Ga0072940_1241986 3300005200 Bacteria 4194
8 Ga0466705_445586 3300042612 Bacteria 19081
9 Ga0466657_332912 3300042582 Bacteria 1934
10 Ga0466691_105136 3300042593 Bacteria 11830
11 Ga0123355_10083911 3300009826 Bacteria 5076
12 Ga0123356_11562451 3300010049 Unclassified 816
13 Ga0123356_13841996 3300010049 Bacteria 518
14 Ga0466707_079941 3300042601 Bacteria 4479
15 Ga0466714_074012 3300042603 Bacteria 10127
16 Ga0466727_142534 3300042655 Bacteria 55597
17 Ga0466705_246639 3300042612 Bacteria 4111
18 Ga0466705_279280 3300042612 Bacteria 14131
19 Ga0466732_212890 3300042656 Bacteria 1160
20 Ga0562379_0005 3300056790 Bacteria 2649770
21 Ga0562379_0410 3300056790 Bacteria 93813
22 Ga0562374_0016 3300057007 Bacteria 1205025
23 Ga0562374_0620 3300057007 Bacteria 54714
24 2227080773 2225789004 Bacteria 205580
25 Ga0052191_100638 3300003097 Bacteria 1901
26 Ga0072941_1012258 3300005201 Bacteria 37649
27 Ga0466692_201456 3300042591 Unclassified 1104
28 Ga0466696_280620 3300042596 Bacteria 1790
29 Ga0123356_10227480 3300010049 Bacteria 1927
30 Ga0123356_13363050 3300010049 Bacteria 556
31 Ga0123356_14120225 3300010049 Bacteria 500
32 Ga0123353_10505009 3300010167 Unclassified 1760
33 Ga0466706_156900 3300042599 Bacteria 13644
34 Ga0466700_041154 3300042600 Bacteria 59068
35 Ga0466704_435702 3300042643 Bacteria 9389
36 Ga0466724_11615 3300042649 Bacteria 6564
37 Ga0562379_0091 3300056790 Bacteria 324047
38 HBC_ctgsDRAFT_1034216 3300000333 Unclassified 1248
39 JGI24697J35500_11113858 3300002507 Bacteria 1207
40 CVPL010L_1000082 3300002932 Bacteria 29431
41 Ga0068302_10000197 3300005071 Bacteria 28753
42 Ga0074278_148624 3300005721 Unclassified 1933
43 Ga0466715_357572 3300042616 Bacteria 181743
44 Ga0466696_011597 3300042596 Bacteria 4540
45 Ga0123355_10274230 3300009826 Bacteria 2338
46 Ga0123356_10030210 3300010049 Bacteria 5071
47 Ga0123353_10004369 3300010167 Bacteria 18194
48 Ga0466706_032791 3300042599 Bacteria 3728
49 Ga0466700_215031 3300042600 Bacteria 1501
50 Ga0466707_031260 3300042601 Bacteria 71521
51 Ga0466714_025045 3300042603 Bacteria 5162
52 Ga0466735_023118 3300042624 Bacteria 12000
53 Ga0466704_199178 3300042643 Bacteria 10818
54 Ga0466708_419261 3300042652 Unclassified 3839
55 Ga0562378_0008 3300056814 Bacteria 1370151
56 Ga0562376_0604 3300056857 Bacteria 61358
57 Ga0590791_17339 3300061801 Unclassified 543
58 IMNBL1DRAFT_c0000219 3300000062 Bacteria 50195
59 AustNasuHG_c1001775 3300000089 Bacteria 7810
60 Ga0068302_10003269 3300005071 Bacteria 26234
61 Ga0104045_1088118 3300007085 Bacteria 768
62 Ga0466715_464863 3300042616 Bacteria 1260
63 Ga0466728_148897 3300042620 Bacteria 5731
64 Ga0466696_092509 3300042596 Bacteria 3737
65 Ga0123356_11996094 3300010049 Bacteria 723
66 Ga0466700_378389 3300042600 Bacteria 55739
67 Ga0466707_221470 3300042601 Bacteria 71824
68 Ga0466717_043303 3300042604 Bacteria 7032
69 Ga0466734_119789 3300042623 Bacteria 17928
70 Ga0466735_005603 3300042624 Bacteria 13011
71 Ga0466702_002868 3300042635 Bacteria 60427
72 2227507956 2225789004 Bacteria 66298
73 Ga0104041_1120380 3300007106 Unclassified 1044
74 Ga0466711_473502 3300042615 Bacteria 1134
75 Ga0466715_224470 3300042616 Bacteria 60101
76 Ga0466715_301768 3300042616 Bacteria 11970
77 Ga0466715_453764 3300042616 Bacteria 6079
78 Ga0466718_088859 3300042617 Bacteria 1192
79 Ga0466726_353337 3300042619 Bacteria 59989
80 Ga0466728_289989 3300042620 Unclassified 2940
81 Ga0466693_114185 3300042592 Bacteria 1665
82 Ga0123356_11570124 3300010049 Bacteria 814
83 Ga0123353_10074994 3300010167 Bacteria 5437
84 Ga0466706_015449 3300042599 Bacteria 1511
85 Ga0466713_104153 3300042602 Bacteria 73386
86 Ga0466734_028366 3300042623 Bacteria 3040
87 Ga0466709_052786 3300042648 Bacteria 2017
88 Ga0466733_010171 3300042659 Bacteria 4019
89 Ga0562379_1990 3300056790 Bacteria 19376
90 Ga0562375_0506 3300056856 Bacteria 80016
91 IMNBL1DRAFT_c0000511 3300000062 Bacteria 31936
92 HBC_ctgsDRAFT_1074271 3300000333 Unclassified 809
93 Ga0104147_1060604 3300007224 Bacteria 6184
94 Ga0466705_429575 3300042612 Bacteria 3984
95 Ga0255576_1000150 3300026558 Bacteria 47989
96 Ga0123356_10093969 3300010049 Bacteria 2863
97 Ga0123353_10095571 3300010167 Bacteria 4788
98 Ga0466700_023040 3300042600 Bacteria 7156
99 Ga0466707_025096 3300042601 Bacteria 11103
100 Ga0466719_014206 3300042606 Bacteria 3283
101 Ga0466719_274679 3300042606 Bacteria 3752
102 Ga0466703_236236 3300042636 Unclassified 1023
103 Ga0466703_275592 3300042636 Bacteria 11908
104 Ga0466703_306546 3300042636 Bacteria 3585
105 Ga0466703_327373 3300042636 Bacteria 22986
106 Ga0466708_420189 3300042652 Unclassified 3838
107 JGI24703J35330_11650699 3300002501 Unclassified 1596
108 JGI24703J35330_11729692 3300002501 Bacteria 2671
109 JGI24700J35501_10871056 3300002508 Unclassified 2253
110 Ga0074188_1178694 3300005318 Unclassified 706
111 Ga0074278_100321 3300005721 Bacteria 4684
112 Ga0466723_063787 3300042618 Bacteria 1664
113 Ga0466728_452942 3300042620 Bacteria 39308
114 Ga0466729_179085 3300042621 Bacteria 60360
115 Ga0466690_148542 3300042590 Bacteria 12801
116 Ga0466692_078337 3300042591 Bacteria 9721
117 Ga0466713_143789 3300042602 Bacteria 39342
118 Ga0466717_021947 3300042604 Bacteria 25100
119 Ga0466722_240797 3300042609 Bacteria 12349
120 Ga0466704_418829 3300042643 Bacteria 8884
121 Ga0466724_02361 3300042649 Bacteria 34785
122 Ga0466697_241817 3300042611 Bacteria 1434
123 Ga0530661_000003 3300056564 Bacteria 462969
124 Ga0562379_0026 3300056790 Bacteria 801830
125 Ga0562374_0008 3300057007 Bacteria 1999653
126 2227266899 2225789004 Bacteria 6958
127 2227414123 2225789004 Bacteria 26621
128 Ga0105553_1026687 3300007767 Unclassified 11589
129 Ga0111037_105193 3300008519 Bacteria 11025
130 Ga0466715_051439 3300042616 Bacteria 8519
131 Ga0466729_156052 3300042621 Bacteria 12586
132 Ga0255575_1000023 3300026559 Bacteria 88290
133 Ga0466690_390876 3300042590 Unclassified 1071
134 Ga0466691_054986 3300042593 Bacteria 23619
135 Ga0466696_247313 3300042596 Unclassified 1415
136 Ga0466706_060468 3300042599 Bacteria 4408
137 Ga0466707_175608 3300042601 Bacteria 13441

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_011597 Ga0466696_011597_3948_4232 94
2 3300042606 Ga0466719_274679 Ga0466719_274679_3385_3669 94
3 3300042612 Ga0466705_279280 Ga0466705_279280_6613_6897 94
4 3300042616 Ga0466715_301768 Ga0466715_301768_5038_5322 94
5 3300042620 Ga0466728_289989 Ga0466728_289989_28_312 94
6 3300042636 Ga0466703_236236 Ga0466703_236236_52_336 94
7 3300042643 Ga0466704_199178 Ga0466704_199178_5534_5818 94
8 3300042643 Ga0466704_418829 Ga0466704_418829_2843_3127 94
9 3300042652 Ga0466708_420189 Ga0466708_420189_3155_3439 94
10 3300042590 Ga0466690_390876 Ga0466690_390876_757_1044 95
11 3300042590 Ga0466690_148542 Ga0466690_148542_8209_8562 101
12 3300042603 Ga0466714_074012 Ga0466714_074012_7122_7460 103
13 3300042604 Ga0466717_021947 Ga0466717_021947_4103_4417 104
14 2225789004 2227266899 2227714755 110
15 3300042582 Ga0466657_332912 Ga0466657_332912_520_852 110
16 iso_pr_bacteria 2820075487 2820077040 110
17 2225789004 2227080773 2227451341 111
18 3300002462 JGI24702J35022_10069278 JGI24702J35022_100692783 111
19 3300010049 Ga0123356_10030210 Ga0123356_100302108 111
20 3300010049 Ga0123356_13841996 Ga0123356_138419961 111
21 3300010167 Ga0123353_10074994 Ga0123353_100749946 111
22 3300010167 Ga0123353_10505009 Ga0123353_105050093 111
23 3300026558 Ga0255576_1000150 Ga0255576_100015024 111
24 3300042596 Ga0466696_092509 Ga0466696_092509_815_1150 111
25 3300042596 Ga0466696_280620 Ga0466696_280620_687_1022 111
26 3300042599 Ga0466706_060468 Ga0466706_060468_2485_2820 111
27 3300042624 Ga0466735_005603 Ga0466735_005603_6983_7318 111
28 iso_pr_bacteria 2820393573 2820396553 111
29 2225789004 2227414123 2227855765 112
30 3300000089 AustNasuHG_c1001775 AustNasuHG_100177516 112
31 3300002501 JGI24703J35330_11729692 JGI24703J35330_117296923 112
32 3300002507 JGI24697J35500_11113858 JGI24697J35500_111138582 112
33 3300002507 JGI24697J35500_11260002 JGI24697J35500_112600023 112
34 3300005201 Ga0072941_1012258 Ga0072941_101225824 112
35 3300009826 Ga0123355_10083911 Ga0123355_100839117 112
36 3300009826 Ga0123355_10274230 Ga0123355_102742305 112
37 3300042591 Ga0466692_078337 Ga0466692_078337_3413_3751 112
38 3300042596 Ga0466696_247313 Ga0466696_247313_413_751 112
39 3300042600 Ga0466700_023040 Ga0466700_023040_73_411 112
40 3300042602 Ga0466713_143789 Ga0466713_143789_4059_4397 112
41 3300042612 Ga0466705_445586 Ga0466705_445586_16795_17133 112
42 3300042620 Ga0466728_148897 Ga0466728_148897_1608_1946 112
43 3300042636 Ga0466703_306546 Ga0466703_306546_565_903 112
44 3300042643 Ga0466704_435702 Ga0466704_435702_3904_4242 112
45 3300042652 Ga0466708_419261 Ga0466708_419261_3156_3494 112
46 3300000062 IMNBL1DRAFT_c0000219 IMNBL1DRAFT_000021949 113
47 3300042616 Ga0466715_464863 Ga0466715_464863_907_1248 113
48 3300042623 Ga0466734_028366 Ga0466734_028366_1799_2140 113
49 iso_pr_bacteria 2820369699 2820369725 113
50 3300010049 Ga0123356_10227480 Ga0123356_102274801 114
51 3300010049 Ga0123356_11996094 Ga0123356_119960942 114
52 3300042599 Ga0466706_156900 Ga0466706_156900_7354_7698 114
53 3300042602 Ga0466713_104153 Ga0466713_104153_53099_53443 114
54 3300042612 Ga0466705_429575 Ga0466705_429575_3018_3362 114
55 3300042616 Ga0466715_051439 Ga0466715_051439_7261_7605 114
56 3300042616 Ga0466715_224470 Ga0466715_224470_4072_4416 114
57 3300042618 Ga0466723_063787 Ga0466723_063787_495_839 114
58 3300042621 Ga0466729_156052 Ga0466729_156052_4304_4648 114
59 3300042624 Ga0466735_023118 Ga0466735_023118_4016_4360 114
60 3300042636 Ga0466703_275592 Ga0466703_275592_4233_4577 114
61 3300042648 Ga0466709_052786 Ga0466709_052786_477_821 114
62 iso_pr_bacteria 2997944163 2997944245 114
63 2225789004 2227507956 2227998564 115
64 3300042591 Ga0466692_201456 Ga0466692_201456_41_388 115
65 3300042592 Ga0466693_114185 Ga0466693_114185_990_1337 115
66 3300042599 Ga0466706_015449 Ga0466706_015449_656_1003 115
67 3300042599 Ga0466706_032791 Ga0466706_032791_855_1202 115
68 3300042600 Ga0466700_041154 Ga0466700_041154_44669_45016 115
69 3300042600 Ga0466700_378389 Ga0466700_378389_21961_22308 115
70 3300042601 Ga0466707_025096 Ga0466707_025096_2966_3313 115
71 3300042601 Ga0466707_031260 Ga0466707_031260_36729_37076 115
72 3300042601 Ga0466707_079941 Ga0466707_079941_51_398 115
73 3300042601 Ga0466707_221470 Ga0466707_221470_58485_58832 115
74 3300042609 Ga0466722_240797 Ga0466722_240797_4088_4435 115
75 3300042615 Ga0466711_473502 Ga0466711_473502_119_466 115
76 3300042617 Ga0466718_088859 Ga0466718_088859_363_710 115
77 3300042619 Ga0466726_353337 Ga0466726_353337_13119_13466 115
78 3300042620 Ga0466728_452942 Ga0466728_452942_24673_25020 115
79 3300042623 Ga0466734_119789 Ga0466734_119789_4000_4347 115
80 3300042635 Ga0466702_002868 Ga0466702_002868_6983_7330 115
81 3300042649 Ga0466724_02361 Ga0466724_02361_24237_24584 115
82 3300042649 Ga0466724_11615 Ga0466724_11615_5590_5937 115
83 3300042655 Ga0466727_142534 Ga0466727_142534_30909_31256 115
84 3300042656 Ga0466732_212890 Ga0466732_212890_509_856 115
85 3300042659 Ga0466733_010171 Ga0466733_010171_2418_2765 115
86 3300056564 Ga0530661_000003 Ga0530661_000003_22394_22741 115
87 3300056790 Ga0562379_0005 Ga0562379_0005_691897_692244 115
88 3300056790 Ga0562379_0026 Ga0562379_0026_566143_566490 115
89 3300056790 Ga0562379_0091 Ga0562379_0091_241990_242337 115
90 3300056790 Ga0562379_1990 Ga0562379_1990_7192_7539 115
91 3300056814 Ga0562378_0004 Ga0562378_0004_1791853_1792200 115
92 3300056857 Ga0562376_0604 Ga0562376_0604_156_503 115
93 3300057007 Ga0562374_0008 Ga0562374_0008_602091_602438 115
94 3300057007 Ga0562374_0016 Ga0562374_0016_102751_103098 115
95 3300057007 Ga0562374_0620 Ga0562374_0620_32802_33149 115
96 3300061801 Ga0590791_17339 Ga0590791_17339_13_360 115
97 iso_pr_bacteria 2585428141 2588054833 115
98 iso_pr_bacteria 2595698190 2596205100 115
99 iso_pr_bacteria 2595698193 2596210498 115
100 iso_pr_bacteria 2595698194 2596213573 115
101 iso_pr_bacteria 2595698195 2596214184 115
102 iso_pr_bacteria 2595698196 2596216007 115
103 iso_pr_bacteria 2595698197 2596217838 115
104 iso_pr_bacteria 2595698198 2596219668 115
105 iso_pr_bacteria 2595698199 2596221481 115
106 iso_pr_bacteria 2627853628 2628279798 115
107 iso_pr_bacteria 2740892556 2743948685 115
108 iso_pr_bacteria 2775507073 2777015985 115
109 iso_pr_bacteria 2820236043 2820236846 115
110 iso_pr_bacteria 2820416776 2820416885 115
111 iso_pr_bacteria 2820471304 2820471386 115
112 iso_pr_bacteria 2825804107 2825805188 115
113 iso_pr_bacteria 2850695442 2850697300 115
114 iso_pr_bacteria 2873581347 2873582514 115
115 iso_pr_bacteria 2873584433 2873584844 115
116 iso_pr_bacteria 2873632256 2873632701 115
117 iso_pr_bacteria 2877522083 2877522499 115
118 iso_pr_bacteria 2878857142 2878858538 115
119 iso_pr_bacteria 2881375749 2881378040 115
120 iso_pr_bacteria 2881902429 2881903597 115
121 iso_pr_bacteria 2896402965 2896403544 115
122 iso_pr_bacteria 2905310146 2905310351 115
123 iso_pr_bacteria 2923762712 2923763948 115
124 iso_pr_bacteria 2936628749 2936629311 115
125 iso_pr_bacteria 647533136 647746970 115
126 iso_pr_bacteria 650716050 650844376 115
127 iso_pr_bacteria 8002299145 8002303597 115
128 iso_pr_bacteria 8007211731 8007214470 115
129 iso_pr_bacteria 8007215774 8007219211 115
130 iso_pr_bacteria 8007220153 8007222747 115
131 iso_pr_bacteria 8007223943 8007226400 115
132 iso_pr_bacteria 8007237282 8007239133 115
133 iso_pr_bacteria 8012939035 8012939834 115
134 iso_pr_bacteria 8018750880 8018753875 115
135 iso_pr_bacteria 8018754795 8018755099 115
136 iso_pr_bacteria 8018794549 8018794977 115
137 iso_pr_bacteria 8018798118 8018798927 115
138 iso_pr_bacteria 8018802046 8018803736 115
139 iso_pr_bacteria 8038268975 8038272060 115
140 iso_pr_bacteria 8066790652 8066790966 115
141 iso_pr_bacteria 8066792404 8066792477 115
142 iso_pr_bacteria 8066794103 8066794815 115
143 iso_pr_bacteria 8066795793 8066797387 115
144 iso_pr_bacteria 8066797744 8066797817 115
145 iso_pr_bacteria 8066799369 8066799700 115
146 iso_pr_bacteria 8066802609 8066803359 115
147 iso_pr_bacteria 8077780672 8077780885 115
148 iso_pr_bacteria 8108568626 8108569955 115
149 iso_pr_bacteria 8108576847 8108579179 115
150 iso_pr_bacteria 8114537524 8114539403 115
151 iso_pr_bacteria 8114541043 8114543910 115
152 iso_pr_bacteria 8114544644 8114546891 115
153 iso_pr_bacteria 8114549044 8114551376 115
154 iso_pr_bacteria 8114555646 8114556975 115
155 3300000333 HBC_ctgsDRAFT_1001649 HBC_ctgsDRAFT_10016495 116
156 3300002501 JGI24703J35330_11650699 JGI24703J35330_116506992 116
157 3300002508 JGI24700J35501_10871056 JGI24700J35501_108710564 116
158 3300002932 CVPL010L_1000082 CVPL010L_100008210 116
159 3300003097 Ga0052191_100638 Ga0052191_1006382 116
160 3300005071 Ga0068302_10000197 Ga0068302_1000019712 116
161 3300005071 Ga0068302_10003269 Ga0068302_1000326923 116
162 3300005200 Ga0072940_1241986 Ga0072940_12419869 116
163 3300005318 Ga0074188_1178694 Ga0074188_11786942 116
164 3300007085 Ga0104045_1088118 Ga0104045_10881182 116
165 3300007106 Ga0104041_1120380 Ga0104041_11203801 116
166 3300007224 Ga0104147_1060604 Ga0104147_10606046 116
167 3300007767 Ga0105553_1026687 Ga0105553_10266878 116
168 3300010167 Ga0123353_10004369 Ga0123353_1000436911 116
169 3300042611 Ga0466697_241817 Ga0466697_241817_158_508 116
170 iso_pr_bacteria 2630968413 2631702551 116
171 iso_pr_bacteria 2758568557 2760422174 116
172 iso_pr_bacteria 2758568559 2760425822 116
173 iso_pr_bacteria 2758568560 2760427754 116
174 iso_pr_bacteria 2758568561 2760429085 116
175 iso_pr_bacteria 2808606958 2811757504 116
176 iso_pr_bacteria 2851412233 2851412346 116
177 iso_pr_bacteria 2956926959 2956927127 116
178 iso_pr_bacteria 2956928875 2956929483 116
179 iso_pr_bacteria 2956930723 2956932225 116
180 iso_pr_bacteria 8001918023 8001919565 116
181 3300000062 IMNBL1DRAFT_c0000511 IMNBL1DRAFT_000051146 117
182 3300000333 HBC_ctgsDRAFT_1034216 HBC_ctgsDRAFT_10342162 117
183 3300000333 HBC_ctgsDRAFT_1074271 HBC_ctgsDRAFT_10742712 117
184 3300010049 Ga0123356_10093969 Ga0123356_100939693 117
185 3300010049 Ga0123356_14120225 Ga0123356_141202252 117
186 3300042593 Ga0466691_054986 Ga0466691_054986_3883_4236 117
187 3300042593 Ga0466691_105136 Ga0466691_105136_8242_8595 117
188 3300042616 Ga0466715_357572 Ga0466715_357572_91680_92033 117
189 3300042636 Ga0466703_327373 Ga0466703_327373_4789_5142 117
190 3300056790 Ga0562379_0410 Ga0562379_0410_52167_52520 117
191 3300056856 Ga0562375_0506 Ga0562375_0506_11675_12028 117
192 iso_pr_bacteria 2645727721 2646684821 117
193 iso_pr_bacteria 2684622911 2686074180 117
194 iso_pr_bacteria 2684622912 2686075897 117
195 iso_pr_bacteria 2684622913 2686077782 117
196 iso_pr_bacteria 2684622914 2686079613 117
197 iso_pr_bacteria 2758568501 2760245772 117
198 iso_pr_bacteria 2758568502 2760247405 117
199 iso_pr_bacteria 2758568503 2760249067 117
200 iso_pr_bacteria 2758568504 2760250729 117
201 iso_pr_bacteria 2758568505 2760252357 117
202 iso_pr_bacteria 2758568506 2760254129 117
203 iso_pr_bacteria 2758568507 2760255658 117
204 iso_pr_bacteria 2758568508 2760257357 117
205 iso_pr_bacteria 2758568509 2760259057 117
206 iso_pr_bacteria 2758568510 2760260878 117
207 iso_pr_bacteria 2758568511 2760262532 117
208 iso_pr_bacteria 2758568512 2760264285 117
209 iso_pr_bacteria 2758568513 2760266131 117
210 iso_pr_bacteria 2758568514 2760268139 117
211 iso_pr_bacteria 2758568515 2760269976 117
212 iso_pr_bacteria 2758568558 2760424214 117
213 iso_pr_bacteria 2785510748 2785747785 117
214 iso_pr_bacteria 2799112220 2799192067 117
215 iso_pr_bacteria 2799112229 2799230123 117
216 iso_pr_bacteria 2799112230 2799232112 117
217 iso_pr_bacteria 2814123166 2815023105 117
218 iso_pr_bacteria 2851410423 2851411799 117
219 iso_pr_bacteria 2877513988 2877515449 117
220 iso_pr_bacteria 2882334426 2882335412 117
221 iso_pr_bacteria 2902668162 2902669883 117
222 iso_pr_bacteria 2912324399 2912325643 117
223 iso_pr_bacteria 2958885890 2958887129 117
224 iso_pr_bacteria 2961465228 2961466586 117
225 iso_pr_bacteria 2961515617 2961516950 117
226 iso_pr_bacteria 2968368220 2968369794 117
227 iso_pr_bacteria 2971062614 2971063704 117
228 iso_pr_bacteria 2979949929 2979951283 117
229 iso_pr_bacteria 3004719924 3004721814 117
230 iso_pr_bacteria 8004832522 8004833752 117
231 iso_pr_bacteria 8017440191 8017440811 117
232 iso_pr_bacteria 8017458139 8017458391 117
233 iso_pr_bacteria 8017462664 8017464222 117
234 iso_pr_bacteria 8017536074 8017537615 117
235 3300005721 Ga0074278_100321 Ga0074278_1003216 118
236 3300005721 Ga0074278_148624 Ga0074278_1486245 118
237 3300042616 Ga0466715_453764 Ga0466715_453764_3862_4218 118
238 3300056790 Ga0562379_0009 Ga0562379_0009_847381_847737 118
239 3300056814 Ga0562378_0008 Ga0562378_0008_698815_699171 118
240 iso_pr_bacteria 2756170272 2756776479 118
241 iso_pr_bacteria 2834540479 2834541703 118
242 iso_pr_bacteria 2896843662 2896846361 118
243 iso_pr_bacteria 8017489919 8017490792 118
244 3300042604 Ga0466717_043303 Ga0466717_043303_632_991 119
245 3300042606 Ga0466719_014206 Ga0466719_014206_499_858 119
246 3300010049 Ga0123356_11562451 Ga0123356_115624511 120
247 3300010049 Ga0123356_13363050 Ga0123356_133630501 120
248 3300026559 Ga0255575_1000023 Ga0255575_100002355 120
249 3300008519 Ga0111037_105193 Ga0111037_10519312 121
250 3300042603 Ga0466714_025045 Ga0466714_025045_4140_4547 123
251 3300042612 Ga0466705_246639 Ga0466705_246639_2884_3258 124
252 3300005083 Ga0068305_10009599 Ga0068305_1000959910 126
253 3300042600 Ga0466700_215031 Ga0466700_215031_126_509 127
254 3300010049 Ga0123356_11570124 Ga0123356_115701242 128
255 3300010167 Ga0123353_10095571 Ga0123353_100955716 128
256 3300042621 Ga0466729_179085 Ga0466729_179085_27700_28086 128
257 iso_pr_bacteria 2718218463 2721569958 129
258 3300042601 Ga0466707_175608 Ga0466707_175608_5544_6005 132

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00237 Ribosomal_L22 Ribosomal protein L22p/L17e 5 107 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.