Protein Family IF05860
Metagenome
Isolate
130
Members
54
Samples
118
Scaffolds
156.87
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_159640|Ga0466707_159640_364_909
- Length
- 181 aa
- Sequence
- MNTVEIDSNIEESEEVPLGLQIDWLKNVVPFVEAALARLDIDDWELSVLFCADPFIAALNKQYRGIEAPTDVLSFSQEDTHIAGDIVISVDTLARNARDFKVPADEELKRLLVHGILHLAGYDHGDSLLPPKKMPTLSPKNKLGTSPQQEMLALQERVLTELSDYSIINKRSFRQDTIWEY
Sample Types
Isolate
9.2%
Metagenome
90.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.2%
Unclassified
25.0%
Kalotermitidae
19.2%
Termopsidae
7.7%
Rhinotermitidae
3.8%
Taxonomy
Archaea
0
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 7 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 8 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 9 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 10 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 11 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 17 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 18 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 19 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 24 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 25 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 28 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 33 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 34 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 35 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 36 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 37 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 38 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 39 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 40 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 41 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 46 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 47 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 48 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 49 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 50 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 51 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 52 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 53 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 54 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_285051 | 3300042601 | Bacteria | 1512 |
| 2 | Ga0466707_292693 | 3300042601 | Bacteria | 1999 |
| 3 | Ga0466720_163600 | 3300042607 | Bacteria | 14544 |
| 4 | Ga0466698_196416 | 3300042610 | Bacteria | 1236 |
| 5 | Ga0466712_004881 | 3300042614 | Bacteria | 10297 |
| 6 | Ga0415639_143791 | 3300038395 | Bacteria | 1152 |
| 7 | JGI24698J34947_10047704 | 3300002449 | Bacteria | 2173 |
| 8 | JGI24698J34947_10086768 | 3300002449 | Bacteria | 1449 |
| 9 | JGI24698J34947_10105791 | 3300002449 | Bacteria | 1253 |
| 10 | JGI24695J34938_10000276 | 3300002450 | Bacteria | 50333 |
| 11 | JGI24695J34938_10025686 | 3300002450 | Bacteria | 2811 |
| 12 | JGI24695J34938_10048065 | 3300002450 | Bacteria | 1881 |
| 13 | JGI24699J35502_11040910 | 3300002509 | Bacteria | 1575 |
| 14 | Ga0466705_270247 | 3300042612 | Bacteria | 6776 |
| 15 | Ga0466707_389429 | 3300042601 | Bacteria | 1106 |
| 16 | Ga0123356_10001164 | 3300010049 | Bacteria | 29125 |
| 17 | Ga0123356_12084569 | 3300010049 | Bacteria | 708 |
| 18 | Ga0264413_100299 | 3300024493 | Bacteria | 10426 |
| 19 | Ga0466694_072755 | 3300042594 | Bacteria | 1132 |
| 20 | Ga0466696_304693 | 3300042596 | Bacteria | 1401 |
| 21 | Ga0466699_370982 | 3300042597 | Bacteria | 1268 |
| 22 | JGI24698J34947_10003945 | 3300002449 | Bacteria | 8069 |
| 23 | JGI24698J34947_10017994 | 3300002449 | Bacteria | 3824 |
| 24 | Ga0068302_10682953 | 3300005071 | Bacteria | 1267 |
| 25 | Ga0072941_1012814 | 3300005201 | Bacteria | 13104 |
| 26 | Ga0466732_196151 | 3300042656 | Bacteria | 1776 |
| 27 | Ga0466733_023296 | 3300042659 | Bacteria | 1233 |
| 28 | Ga0466707_011661 | 3300042601 | Bacteria | 3585 |
| 29 | Ga0466719_148988 | 3300042606 | Bacteria | 1327 |
| 30 | Ga0466719_441205 | 3300042606 | Bacteria | 7575 |
| 31 | Ga0466720_197641 | 3300042607 | Bacteria | 23703 |
| 32 | Ga0123353_10792608 | 3300010167 | Bacteria | 1310 |
| 33 | Ga0466726_450630 | 3300042619 | Bacteria | 1937 |
| 34 | Ga0466728_374556 | 3300042620 | Bacteria | 6789 |
| 35 | Ga0466735_054450 | 3300042624 | Bacteria | 2108 |
| 36 | Ga0466694_327373 | 3300042594 | Bacteria | 1636 |
| 37 | JGI24698J34947_10061614 | 3300002449 | Bacteria | 1845 |
| 38 | JGI24695J34938_10068440 | 3300002450 | Bacteria | 1491 |
| 39 | JGI24705J35276_12163611 | 3300002504 | Bacteria | 1247 |
| 40 | Ga0072940_1013075 | 3300005200 | Bacteria | 3309 |
| 41 | Ga0466721_128130 | 3300042608 | Bacteria | 2306 |
| 42 | Ga0123354_10449277 | 3300010882 | Bacteria | 1045 |
| 43 | Ga0123354_10508682 | 3300010882 | Bacteria | 934 |
| 44 | Ga0466708_236919 | 3300042652 | Bacteria | 12140 |
| 45 | Ga0466727_148700 | 3300042655 | Bacteria | 10958 |
| 46 | Ga0466694_189698 | 3300042594 | Bacteria | 15080 |
| 47 | Ga0072941_1016635 | 3300005201 | Bacteria | 20897 |
| 48 | Ga0072941_1191126 | 3300005201 | Bacteria | 1199 |
| 49 | Ga0466707_236186 | 3300042601 | Bacteria | 1132 |
| 50 | Ga0466717_034372 | 3300042604 | Bacteria | 1143 |
| 51 | Ga0123356_13301847 | 3300010049 | Bacteria | 561 |
| 52 | Ga0466712_003887 | 3300042614 | Bacteria | 35817 |
| 53 | Ga0466712_009175 | 3300042614 | Bacteria | 17547 |
| 54 | Ga0466712_026871 | 3300042614 | Bacteria | 18582 |
| 55 | Ga0466718_126067 | 3300042617 | Bacteria | 1722 |
| 56 | Ga0466735_029768 | 3300042624 | Bacteria | 2369 |
| 57 | Ga0466703_049156 | 3300042636 | Bacteria | 5598 |
| 58 | Ga0466703_101873 | 3300042636 | Bacteria | 27649 |
| 59 | Ga0466703_113927 | 3300042636 | Bacteria | 4637 |
| 60 | Ga0466694_089913 | 3300042594 | Bacteria | 1689 |
| 61 | Ga0466699_012235 | 3300042597 | Bacteria | 1161 |
| 62 | Ga0466699_095860 | 3300042597 | Bacteria | 1389 |
| 63 | JGI24698J34947_10073279 | 3300002449 | Bacteria | 1635 |
| 64 | JGI24698J34947_10101154 | 3300002449 | Bacteria | 1296 |
| 65 | JGI24695J34938_10012069 | 3300002450 | Bacteria | 4606 |
| 66 | JGI24702J35022_10149212 | 3300002462 | Bacteria | 1311 |
| 67 | Ga0466707_159640 | 3300042601 | Bacteria | 2079 |
| 68 | Ga0466716_402638 | 3300042605 | Bacteria | 8337 |
| 69 | Ga0466720_137681 | 3300042607 | Bacteria | 22704 |
| 70 | Ga0466712_315661 | 3300042614 | Bacteria | 20765 |
| 71 | Ga0466729_265273 | 3300042621 | Bacteria | 1139 |
| 72 | Ga0466731_338092 | 3300042622 | Bacteria | 1626 |
| 73 | Ga0466704_031565 | 3300042643 | Bacteria | 14824 |
| 74 | Ga0466704_346148 | 3300042643 | Bacteria | 1226 |
| 75 | JGI24698J34947_10100408 | 3300002449 | Bacteria | 1303 |
| 76 | JGI24698J34947_10101052 | 3300002449 | Bacteria | 1297 |
| 77 | JGI24695J34938_10000201 | 3300002450 | Bacteria | 56424 |
| 78 | JGI24695J34938_10000659 | 3300002450 | Bacteria | 32678 |
| 79 | JGI24695J34938_10018603 | 3300002450 | Unclassified | 3467 |
| 80 | Ga0466705_060150 | 3300042612 | Bacteria | 42844 |
| 81 | Ga0466707_229876 | 3300042601 | Bacteria | 1306 |
| 82 | Ga0466707_366473 | 3300042601 | Bacteria | 2146 |
| 83 | Ga0466722_017520 | 3300042609 | Bacteria | 32151 |
| 84 | Ga0123356_10000042 | 3300010049 | Bacteria | 135091 |
| 85 | Ga0123356_10052706 | 3300010049 | Bacteria | 3785 |
| 86 | Ga0123356_10885217 | 3300010049 | Bacteria | 1064 |
| 87 | Ga0123356_11766090 | 3300010049 | Bacteria | 768 |
| 88 | Ga0466715_116881 | 3300042616 | Bacteria | 4780 |
| 89 | Ga0466702_125791 | 3300042635 | Bacteria | 1201 |
| 90 | Ga0466703_080253 | 3300042636 | Bacteria | 1470 |
| 91 | Ga0466704_545136 | 3300042643 | Bacteria | 1001 |
| 92 | AustNasuHG_c1023060 | 3300000089 | Bacteria | 1992 |
| 93 | JGI24698J34947_10034039 | 3300002449 | Bacteria | 2669 |
| 94 | JGI24698J34947_10130601 | 3300002449 | Bacteria | 1074 |
| 95 | Ga0072941_1030470 | 3300005201 | Bacteria | 4185 |
| 96 | Ga0072941_1069869 | 3300005201 | Bacteria | 2006 |
| 97 | Ga0072941_1098072 | 3300005201 | Bacteria | 1782 |
| 98 | Ga0466732_252112 | 3300042656 | Bacteria | 23763 |
| 99 | Ga0466707_082116 | 3300042601 | Bacteria | 1895 |
| 100 | Ga0466707_344736 | 3300042601 | Bacteria | 2460 |
| 101 | Ga0466720_048903 | 3300042607 | Bacteria | 5725 |
| 102 | Ga0123356_10000424 | 3300010049 | Bacteria | 48165 |
| 103 | Ga0123356_11776961 | 3300010049 | Bacteria | 766 |
| 104 | Ga0466726_404177 | 3300042619 | Bacteria | 25452 |
| 105 | Ga0466735_040751 | 3300042624 | Bacteria | 1329 |
| 106 | Ga0466727_096910 | 3300042655 | Bacteria | 14290 |
| 107 | Ga0466690_052561 | 3300042590 | Bacteria | 4719 |
| 108 | Ga0466694_036976 | 3300042594 | Bacteria | 1792 |
| 109 | Ga0466696_253695 | 3300042596 | Bacteria | 2190 |
| 110 | Ga0466696_335069 | 3300042596 | Bacteria | 23035 |
| 111 | Ga0466699_282407 | 3300042597 | Bacteria | 1965 |
| 112 | AustNasuHG_c1028124 | 3300000089 | Bacteria | 1690 |
| 113 | JGI24698J34947_10001557 | 3300002449 | Bacteria | 12136 |
| 114 | JGI24698J34947_10016249 | 3300002449 | Bacteria | 4041 |
| 115 | JGI24698J34947_10063560 | 3300002449 | Bacteria | 1808 |
| 116 | JGI24698J34947_10094024 | 3300002449 | Bacteria | 1367 |
| 117 | JGI24695J34938_10000567 | 3300002450 | Bacteria | 35569 |
| 118 | JGI24702J35022_10122016 | 3300002462 | Bacteria | 1440 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042619 | Ga0466726_450630 | Ga0466726_450630_40_453 | 137 |
| 2 | 3300042643 | Ga0466704_346148 | Ga0466704_346148_264_722 | 139 |
| 3 | 3300042643 | Ga0466704_545136 | Ga0466704_545136_185_643 | 139 |
| 4 | 3300042601 | Ga0466707_082116 | Ga0466707_082116_271_708 | 145 |
| 5 | 3300042597 | Ga0466699_095860 | Ga0466699_095860_311_751 | 146 |
| 6 | 3300042597 | Ga0466699_370982 | Ga0466699_370982_311_751 | 146 |
| 7 | 3300042604 | Ga0466717_034372 | Ga0466717_034372_28_468 | 146 |
| 8 | 3300002462 | JGI24702J35022_10149212 | JGI24702J35022_101492122 | 147 |
| 9 | 3300002504 | JGI24705J35276_12163611 | JGI24705J35276_121636112 | 147 |
| 10 | 3300010049 | Ga0123356_11766090 | Ga0123356_117660902 | 147 |
| 11 | 3300010049 | Ga0123356_11776961 | Ga0123356_117769612 | 147 |
| 12 | 3300010882 | Ga0123354_10449277 | Ga0123354_104492772 | 147 |
| 13 | 3300005071 | Ga0068302_10682953 | Ga0068302_106829532 | 150 |
| 14 | 3300042597 | Ga0466699_282407 | Ga0466699_282407_1402_1854 | 150 |
| 15 | iso_pr_bacteria | 2781125692 | 2781431571 | 150 |
| 16 | 3300002450 | JGI24695J34938_10068440 | JGI24695J34938_100684402 | 151 |
| 17 | 3300042590 | Ga0466690_052561 | Ga0466690_052561_1819_2274 | 151 |
| 18 | 3300042594 | Ga0466694_189698 | Ga0466694_189698_2326_2781 | 151 |
| 19 | 3300042596 | Ga0466696_304693 | Ga0466696_304693_176_631 | 151 |
| 20 | 3300042596 | Ga0466696_335069 | Ga0466696_335069_18758_19213 | 151 |
| 21 | 3300042605 | Ga0466716_402638 | Ga0466716_402638_3369_3824 | 151 |
| 22 | 3300042621 | Ga0466729_265273 | Ga0466729_265273_131_586 | 151 |
| 23 | 3300042601 | Ga0466707_229876 | Ga0466707_229876_454_912 | 152 |
| 24 | 3300042624 | Ga0466735_054450 | Ga0466735_054450_350_808 | 152 |
| 25 | 3300042636 | Ga0466703_049156 | Ga0466703_049156_5081_5539 | 152 |
| 26 | 3300042636 | Ga0466703_080253 | Ga0466703_080253_953_1411 | 152 |
| 27 | 3300042636 | Ga0466703_113927 | Ga0466703_113927_546_1004 | 152 |
| 28 | 3300042652 | Ga0466708_236919 | Ga0466708_236919_6241_6699 | 152 |
| 29 | iso_pr_bacteria | 2781125652 | 2781311798 | 153 |
| 30 | 3300042596 | Ga0466696_253695 | Ga0466696_253695_1193_1657 | 154 |
| 31 | 3300042606 | Ga0466719_441205 | Ga0466719_441205_3156_3620 | 154 |
| 32 | 3300042612 | Ga0466705_060150 | Ga0466705_060150_8974_9438 | 154 |
| 33 | 3300042655 | Ga0466727_096910 | Ga0466727_096910_7641_8105 | 154 |
| 34 | 3300042594 | Ga0466694_036976 | Ga0466694_036976_994_1461 | 155 |
| 35 | 3300042601 | Ga0466707_011661 | Ga0466707_011661_32_499 | 155 |
| 36 | 3300042614 | Ga0466712_003887 | Ga0466712_003887_17342_17809 | 155 |
| 37 | 3300002449 | JGI24698J34947_10047704 | JGI24698J34947_100477043 | 156 |
| 38 | 3300002449 | JGI24698J34947_10063560 | JGI24698J34947_100635601 | 156 |
| 39 | 3300002450 | JGI24695J34938_10025686 | JGI24695J34938_100256862 | 156 |
| 40 | 3300002462 | JGI24702J35022_10122016 | JGI24702J35022_101220162 | 156 |
| 41 | 3300042594 | Ga0466694_072755 | Ga0466694_072755_234_704 | 156 |
| 42 | 3300042594 | Ga0466694_089913 | Ga0466694_089913_76_546 | 156 |
| 43 | 3300042594 | Ga0466694_327373 | Ga0466694_327373_628_1098 | 156 |
| 44 | 3300042610 | Ga0466698_196416 | Ga0466698_196416_100_570 | 156 |
| 45 | 3300042614 | Ga0466712_004881 | Ga0466712_004881_1116_1586 | 156 |
| 46 | 3300042614 | Ga0466712_026871 | Ga0466712_026871_7102_7572 | 156 |
| 47 | 3300042614 | Ga0466712_315661 | Ga0466712_315661_9463_9933 | 156 |
| 48 | 3300042624 | Ga0466735_029768 | Ga0466735_029768_654_1124 | 156 |
| 49 | 3300042624 | Ga0466735_040751 | Ga0466735_040751_621_1091 | 156 |
| 50 | 3300042635 | Ga0466702_125791 | Ga0466702_125791_595_1065 | 156 |
| 51 | 3300042643 | Ga0466704_031565 | Ga0466704_031565_7068_7538 | 156 |
| 52 | iso_pr_bacteria | 2781125638 | 2781283767 | 156 |
| 53 | iso_pr_bacteria | 2781125642 | 2781292122 | 156 |
| 54 | iso_pr_bacteria | 650716102 | 650883020 | 156 |
| 55 | 3300002449 | JGI24698J34947_10001557 | JGI24698J34947_100015576 | 157 |
| 56 | 3300002449 | JGI24698J34947_10016249 | JGI24698J34947_100162492 | 157 |
| 57 | 3300002449 | JGI24698J34947_10034039 | JGI24698J34947_100340393 | 157 |
| 58 | 3300002449 | JGI24698J34947_10073279 | JGI24698J34947_100732792 | 157 |
| 59 | 3300002449 | JGI24698J34947_10086768 | JGI24698J34947_100867682 | 157 |
| 60 | 3300002449 | JGI24698J34947_10094024 | JGI24698J34947_100940241 | 157 |
| 61 | 3300002449 | JGI24698J34947_10100408 | JGI24698J34947_101004082 | 157 |
| 62 | 3300002449 | JGI24698J34947_10101052 | JGI24698J34947_101010521 | 157 |
| 63 | 3300002449 | JGI24698J34947_10101154 | JGI24698J34947_101011541 | 157 |
| 64 | 3300002449 | JGI24698J34947_10130601 | JGI24698J34947_101306012 | 157 |
| 65 | 3300002450 | JGI24695J34938_10000201 | JGI24695J34938_1000020122 | 157 |
| 66 | 3300002450 | JGI24695J34938_10000276 | JGI24695J34938_1000027610 | 157 |
| 67 | 3300002450 | JGI24695J34938_10000567 | JGI24695J34938_100005676 | 157 |
| 68 | 3300002450 | JGI24695J34938_10000659 | JGI24695J34938_1000065917 | 157 |
| 69 | 3300002450 | JGI24695J34938_10048065 | JGI24695J34938_100480651 | 157 |
| 70 | 3300002509 | JGI24699J35502_11040910 | JGI24699J35502_110409102 | 157 |
| 71 | 3300005201 | Ga0072941_1012814 | Ga0072941_10128147 | 157 |
| 72 | 3300005201 | Ga0072941_1069869 | Ga0072941_10698693 | 157 |
| 73 | 3300005201 | Ga0072941_1191126 | Ga0072941_11911261 | 157 |
| 74 | 3300024493 | Ga0264413_100299 | Ga0264413_1002993 | 157 |
| 75 | 3300042597 | Ga0466699_012235 | Ga0466699_012235_305_778 | 157 |
| 76 | 3300042601 | Ga0466707_236186 | Ga0466707_236186_227_700 | 157 |
| 77 | 3300042616 | Ga0466715_116881 | Ga0466715_116881_2941_3414 | 157 |
| 78 | 3300042622 | Ga0466731_338092 | Ga0466731_338092_704_1177 | 157 |
| 79 | 3300000089 | AustNasuHG_c1023060 | AustNasuHG_10230601 | 158 |
| 80 | 3300002449 | JGI24698J34947_10017994 | JGI24698J34947_100179943 | 158 |
| 81 | 3300005201 | Ga0072941_1030470 | Ga0072941_10304703 | 158 |
| 82 | 3300038395 | Ga0415639_143791 | Ga0415639_143791_647_1123 | 158 |
| 83 | 3300042609 | Ga0466722_017520 | Ga0466722_017520_12605_13081 | 158 |
| 84 | 3300042614 | Ga0466712_009175 | Ga0466712_009175_5111_5587 | 158 |
| 85 | 3300042619 | Ga0466726_404177 | Ga0466726_404177_17324_17800 | 158 |
| 86 | 3300042655 | Ga0466727_148700 | Ga0466727_148700_876_1352 | 158 |
| 87 | 3300042659 | Ga0466733_023296 | Ga0466733_023296_599_1075 | 158 |
| 88 | iso_pr_bacteria | 2781125661 | 2781332069 | 158 |
| 89 | iso_pr_bacteria | 2781125664 | 2781339138 | 158 |
| 90 | iso_pr_bacteria | 2781125690 | 2781428352 | 158 |
| 91 | 3300010049 | Ga0123356_10000042 | Ga0123356_1000004290 | 159 |
| 92 | 3300010049 | Ga0123356_10001164 | Ga0123356_1000116428 | 159 |
| 93 | 3300010049 | Ga0123356_13301847 | Ga0123356_133018472 | 159 |
| 94 | 3300042601 | Ga0466707_285051 | Ga0466707_285051_903_1382 | 159 |
| 95 | 3300042607 | Ga0466720_163600 | Ga0466720_163600_5749_6228 | 159 |
| 96 | 3300042607 | Ga0466720_197641 | Ga0466720_197641_16226_16705 | 159 |
| 97 | 3300042608 | Ga0466721_128130 | Ga0466721_128130_1041_1520 | 159 |
| 98 | 3300042612 | Ga0466705_270247 | Ga0466705_270247_3669_4178 | 159 |
| 99 | 3300042656 | Ga0466732_196151 | Ga0466732_196151_514_993 | 159 |
| 100 | 3300042656 | Ga0466732_252112 | Ga0466732_252112_15928_16407 | 159 |
| 101 | 3300010049 | Ga0123356_10052706 | Ga0123356_100527063 | 160 |
| 102 | 3300010167 | Ga0123353_10792608 | Ga0123353_107926082 | 160 |
| 103 | 3300042607 | Ga0466720_137681 | Ga0466720_137681_13344_13826 | 160 |
| 104 | 3300042617 | Ga0466718_126067 | Ga0466718_126067_1073_1555 | 160 |
| 105 | iso_pr_bacteria | 2781125636 | 2781280287 | 160 |
| 106 | iso_pr_bacteria | 2781125646 | 2781301253 | 160 |
| 107 | 3300000089 | AustNasuHG_c1028124 | AustNasuHG_10281242 | 161 |
| 108 | 3300002450 | JGI24695J34938_10012069 | JGI24695J34938_100120694 | 161 |
| 109 | 3300010882 | Ga0123354_10508682 | Ga0123354_105086821 | 161 |
| 110 | 3300042601 | Ga0466707_366473 | Ga0466707_366473_1482_1967 | 161 |
| 111 | 3300042606 | Ga0466719_148988 | Ga0466719_148988_89_574 | 161 |
| 112 | 3300042636 | Ga0466703_101873 | Ga0466703_101873_16620_17105 | 161 |
| 113 | 3300005200 | Ga0072940_1013075 | Ga0072940_10130751 | 162 |
| 114 | 3300042601 | Ga0466707_292693 | Ga0466707_292693_571_1059 | 162 |
| 115 | 3300042620 | Ga0466728_374556 | Ga0466728_374556_4845_5333 | 162 |
| 116 | 3300002449 | JGI24698J34947_10105791 | JGI24698J34947_101057912 | 163 |
| 117 | 3300005201 | Ga0072941_1016635 | Ga0072941_101663514 | 163 |
| 118 | 3300010049 | Ga0123356_10885217 | Ga0123356_108852172 | 163 |
| 119 | 3300042601 | Ga0466707_389429 | Ga0466707_389429_602_1096 | 164 |
| 120 | 3300010049 | Ga0123356_12084569 | Ga0123356_120845691 | 166 |
| 121 | 3300042601 | Ga0466707_344736 | Ga0466707_344736_591_1091 | 166 |
| 122 | 3300002449 | JGI24698J34947_10061614 | JGI24698J34947_100616142 | 169 |
| 123 | iso_pr_bacteria | 2781125660 | 2781331273 | 169 |
| 124 | 3300005201 | Ga0072941_1098072 | Ga0072941_10980722 | 170 |
| 125 | 3300010049 | Ga0123356_10000424 | Ga0123356_1000042416 | 170 |
| 126 | 3300042607 | Ga0466720_048903 | Ga0466720_048903_50_562 | 170 |
| 127 | iso_pr_bacteria | 2781125643 | 2781294442 | 171 |
| 128 | 3300002450 | JGI24695J34938_10018603 | JGI24695J34938_100186033 | 172 |
| 129 | 3300002449 | JGI24698J34947_10003945 | JGI24698J34947_100039452 | 176 |
| 130 | 3300042601 | Ga0466707_159640 | Ga0466707_159640_364_909 | 181 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02130 | YbeY | Endoribonuclease YbeY | 31 | 126 | 0.86 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.77 | 0.84 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.