Protein Family IF05844

Metagenome Isolate
208 Members
77 Samples
180 Scaffolds
227.14 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_137259|Ga0466707_137259_561_1346
Length
261 aa
Sequence
MRKVVVRKAPERTLRTAFFSNFPDMEIIYEDNHLIAVNKNCHEIVQGDKTGDIPLPEMLKEWLKEKYAKPGNVFAGVIHRLDRPVTGAVVFAKTSKALQRMNEKFRLGEVKKNYWAIVKNNPPEPEGELIHWLVRNEKQNKSFAYDAEKPGAKQAILHYRLIAQSERYFLLEIDLKTGRHHQIRCQLAKIGCPVKGDLKYGADRSNPDGGISLHARSISFLHPVTRQPVRLVAPVPGDTLWQALAESVPVHPDETLSPEKP

📊 Sample Types

Isolate 13.5%
Metagenome 86.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 26.0%
Blattidae 23.4%
Kalotermitidae 18.2%
Unclassified 10.4%
Termopsidae 5.2%
Rhinotermitidae 3.9%
Passalidae 2.6%
Tenebrionidae 2.6%
Elmidae 2.6%
Drosophilidae 2.6%
Hodotermitidae 1.3%
Hydrophilidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 206
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
3 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
4 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
5 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
8 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
14 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
17 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
18 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
19 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
20 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
21 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
22 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
23 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
26 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
27 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
28 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
29 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
30 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
31 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
32 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
33 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
34 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
37 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
38 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
39 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
40 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
41 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
42 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
43 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
44 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
45 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
46 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
47 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
48 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
49 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
50 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
51 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
52 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
53 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
54 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
55 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
56 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
57 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
58 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
59 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
60 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
61 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
62 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
63 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
64 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
65 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
66 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
67 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
68 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
69 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
70 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
71 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
72 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
73 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
74 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
75 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
76 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
77 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_210739 3300042659 Bacteria 1344
2 Ga0466715_012770 3300042616 Bacteria 3906
3 Ga0466715_080209 3300042616 Bacteria 5381
4 Ga0466715_583205 3300042616 Bacteria 24186
5 Ga0466728_335249 3300042620 Bacteria 1375
6 Ga0466700_193144 3300042600 Bacteria 1418
7 Ga0466700_381744 3300042600 Bacteria 2459
8 Ga0466713_059975 3300042602 Bacteria 22865
9 Ga0466716_202084 3300042605 Bacteria 17568
10 Ga0466719_072964 3300042606 Bacteria 3294
11 Ga0466719_086818 3300042606 Bacteria 2700
12 Ga0466719_331648 3300042606 Bacteria 1263
13 Ga0123355_10001821 3300009826 Bacteria 29815
14 Ga0466735_009555 3300042624 Bacteria 1095
15 Ga0466704_517162 3300042643 Bacteria 1942
16 Ga0466725_071344 3300042654 Bacteria 7932
17 Ga0466690_048858 3300042590 Bacteria 42701
18 Ga0123357_10001032 3300009784 Bacteria 28568
19 Ga0466723_119358 3300042618 Bacteria 14928
20 Ga0466707_241108 3300042601 Bacteria 10272
21 Ga0466719_132659 3300042606 Bacteria 30972
22 Ga0466722_233453 3300042609 Bacteria 6938
23 Ga0123356_10012807 3300010049 Bacteria 8120
24 Ga0123356_10278042 3300010049 Bacteria 1768
25 Ga0123356_11363787 3300010049 Bacteria 871
26 Ga0123353_10000423 3300010167 Bacteria 52369
27 Ga0123354_10002953 3300010882 Bacteria 23087
28 Ga0466735_079356 3300042624 Bacteria 8146
29 Ga0466724_31268 3300042649 Bacteria 225286
30 Ga0466727_066312 3300042655 Bacteria 11464
31 Ga0466727_265039 3300042655 Bacteria 8851
32 Ga0466690_037659 3300042590 Bacteria 14391
33 Ga0466690_255390 3300042590 Bacteria 4057
34 Ga0466692_166284 3300042591 Bacteria 10665
35 Ga0466696_080066 3300042596 Bacteria 3660
36 2227563833 2225789004 Bacteria 2692
37 Ga0068302_10145285 3300005071 Unclassified 2636
38 Ga0072940_1315469 3300005200 Bacteria 1046
39 Ga0562377_0004 3300056842 Bacteria 3525959
40 Ga0466715_077237 3300042616 Bacteria 28902
41 Ga0466726_167735 3300042619 Bacteria 5364
42 Ga0466706_048730 3300042599 Bacteria 101759
43 Ga0466707_137259 3300042601 Bacteria 1602
44 Ga0466707_373554 3300042601 Bacteria 8608
45 Ga0466716_072096 3300042605 Bacteria 13449
46 Ga0466719_242706 3300042606 Bacteria 6331
47 Ga0123354_10137783 3300010882 Bacteria 3040
48 Ga0466704_194858 3300042643 Bacteria 20469
49 Ga0466694_001019 3300042594 Bacteria 1572
50 Ga0466696_151019 3300042596 Bacteria 3702
51 Ga0466701_011125 3300042598 Bacteria 31883
52 JGI24702J35022_10018786 3300002462 Bacteria 3767
53 Ga0466705_172980 3300042612 Bacteria 40831
54 Ga0466732_127717 3300042656 Bacteria 1538
55 Ga0466705_486192 3300042612 Bacteria 7879
56 Ga0466715_145673 3300042616 Bacteria 3539
57 Ga0466715_188116 3300042616 Bacteria 8718
58 Ga0466715_348253 3300042616 Bacteria 12317
59 Ga0466701_058067 3300042598 Bacteria 74144
60 Ga0466706_135756 3300042599 Bacteria 21184
61 Ga0466713_121173 3300042602 Bacteria 12626
62 Ga0123354_10247080 3300010882 Bacteria 1819
63 Ga0466735_057981 3300042624 Bacteria 1103
64 Ga0466703_082207 3300042636 Bacteria 19739
65 Ga0466727_008719 3300042655 Bacteria 14999
66 Ga0466727_025347 3300042655 Bacteria 2465
67 Ga0466727_095823 3300042655 Bacteria 11264
68 Ga0466727_112751 3300042655 Bacteria 7654
69 Ga0466657_291017 3300042582 Bacteria 1899
70 Ga0466692_168442 3300042591 Bacteria 1098
71 Ga0466694_028470 3300042594 Bacteria 1038
72 Ga0466696_048279 3300042596 Bacteria 9304
73 Ga0466696_158124 3300042596 Bacteria 18249
74 Ga0466696_213692 3300042596 Bacteria 9451
75 2227522695 2225789004 Bacteria 3309
76 2227634903 2225789004 Unclassified 2097
77 IMNBL1DRAFT_c0001623 3300000062 Bacteria 16669
78 IMNBL1DRAFT_c0009074 3300000062 Bacteria 4977
79 JGI24702J35022_10022440 3300002462 Bacteria 3416
80 JGI24699J35502_11132371 3300002509 Bacteria 6759
81 Ga0104048_1168809 3300007143 Bacteria 2793
82 Ga0466733_051051 3300042659 Bacteria 11253
83 Ga0466733_067578 3300042659 Bacteria 4628
84 Ga0466711_045636 3300042615 Bacteria 24219
85 Ga0466711_217459 3300042615 Bacteria 9140
86 Ga0466715_452977 3300042616 Bacteria 2266
87 Ga0466701_058340 3300042598 Bacteria 8230
88 Ga0466707_072578 3300042601 Bacteria 15033
89 Ga0466713_094833 3300042602 Bacteria 47599
90 Ga0466714_008837 3300042603 Bacteria 1080
91 Ga0123357_10314845 3300009784 Bacteria 1556
92 Ga0123353_10174601 3300010167 Bacteria 3408
93 Ga0123354_10000925 3300010882 Bacteria 32969
94 Ga0123354_10018220 3300010882 Bacteria 11007
95 Ga0466730_015231 3300042625 Bacteria 2385
96 Ga0466708_290271 3300042652 Bacteria 28875
97 Ga0466725_006692 3300042654 Bacteria 1873
98 Ga0466690_175771 3300042590 Bacteria 56622
99 Ga0466696_432602 3300042596 Bacteria 17624
100 Ga0466701_005987 3300042598 Bacteria 1351
101 IMNBL1DRAFT_c0007451 3300000062 Bacteria 5753
102 IMNBL1DRAFT_c0047934 3300000062 Bacteria 1375
103 Ga0068305_10002944 3300005083 Bacteria 22660
104 Ga0466723_199550 3300042618 Bacteria 8988
105 Ga0466726_097828 3300042619 Bacteria 1224
106 Ga0466726_300403 3300042619 Bacteria 11532
107 Ga0466726_486113 3300042619 Bacteria 1068
108 Ga0466728_109015 3300042620 Bacteria 4195
109 Ga0466706_010424 3300042599 Bacteria 17050
110 Ga0466707_099950 3300042601 Bacteria 1079
111 Ga0466713_000398 3300042602 Bacteria 12002
112 Ga0466716_187250 3300042605 Bacteria 3361
113 Ga0466719_298958 3300042606 Bacteria 17836
114 Ga0466722_152891 3300042609 Bacteria 26871
115 Ga0466722_205722 3300042609 Bacteria 13113
116 Ga0466698_432236 3300042610 Bacteria 2396
117 Ga0123357_10324166 3300009784 Bacteria 1516
118 Ga0123353_11403178 3300010167 Bacteria 898
119 Ga0466735_096576 3300042624 Bacteria 1445
120 Ga0466703_331732 3300042636 Bacteria 9966
121 Ga0466727_182646 3300042655 Bacteria 2013
122 Ga0466727_335323 3300042655 Bacteria 2434
123 Ga0466696_384414 3300042596 Bacteria 1076
124 2227632943 2225789004 Bacteria 11346
125 JGI24699J35502_11133974 3300002509 Bacteria 22272
126 Ga0466705_370120 3300042612 Bacteria 6275
127 Ga0466711_303779 3300042615 Bacteria 18039
128 Ga0466711_373737 3300042615 Bacteria 78112
129 Ga0466715_498734 3300042616 Bacteria 4309
130 Ga0466715_594337 3300042616 Bacteria 3791
131 Ga0466723_085797 3300042618 Bacteria 6260
132 Ga0466726_193560 3300042619 Bacteria 1311
133 Ga0466706_140997 3300042599 Bacteria 4928
134 Ga0466700_039627 3300042600 Bacteria 11016
135 Ga0466707_284882 3300042601 Bacteria 17288
136 Ga0466713_013942 3300042602 Bacteria 36823
137 Ga0466713_145405 3300042602 Bacteria 30268
138 Ga0466714_088011 3300042603 Bacteria 41067
139 Ga0466716_033986 3300042605 Bacteria 1306
140 Ga0466719_113260 3300042606 Bacteria 1013
141 Ga0466722_239940 3300042609 Bacteria 60486
142 Ga0466722_242007 3300042609 Bacteria 3724
143 Ga0466698_383983 3300042610 Bacteria 1182
144 Ga0123354_10020792 3300010882 Bacteria 10331
145 Ga0123354_10044892 3300010882 Bacteria 6770
146 Ga0466703_150695 3300042636 Bacteria 7729
147 Ga0466709_363785 3300042648 Bacteria 41688
148 Ga0466696_313177 3300042596 Bacteria 11374
149 2227228038 2225789004 Bacteria 7376
150 2227520197 2225789004 Bacteria 3357
151 IMNBL1DRAFT_c0089890 3300000062 Bacteria 843
152 JGI24702J35022_10002991 3300002462 Bacteria 10230
153 JGI24702J35022_10040189 3300002462 Bacteria 2494
154 Ga0068305_10238999 3300005083 Bacteria 5937
155 Ga0466710_304970 3300042613 Bacteria 1117
156 Ga0466723_005723 3300042618 Bacteria 7983
157 Ga0466726_026154 3300042619 Bacteria 9851
158 Ga0466728_360258 3300042620 Bacteria 5803
159 Ga0466706_025047 3300042599 Bacteria 5815
160 Ga0466706_086623 3300042599 Bacteria 12385
161 Ga0466707_261326 3300042601 Bacteria 4883
162 Ga0466713_063067 3300042602 Bacteria 116971
163 Ga0466719_133232 3300042606 Bacteria 3179
164 Ga0466722_264474 3300042609 Bacteria 1543
165 Ga0123357_10052147 3300009784 Bacteria 5525
166 Ga0466704_055670 3300042643 Bacteria 9312
167 Ga0466704_268159 3300042643 Bacteria 10201
168 Ga0466709_330726 3300042648 Bacteria 8260
169 Ga0466708_440707 3300042652 Bacteria 7881
170 Ga0466690_241728 3300042590 Bacteria 1122
171 Ga0466690_351619 3300042590 Bacteria 10399
172 Ga0466692_104727 3300042591 Bacteria 1095
173 Ga0466691_222548 3300042593 Bacteria 20111
174 Ga0466696_096834 3300042596 Bacteria 8275
175 Ga0466696_274194 3300042596 Bacteria 9483
176 2227241906 2225789004 Bacteria 7231
177 IMNBL1DRAFT_c0002018 3300000062 Bacteria 14545
178 JGI24702J35022_10012760 3300002462 Bacteria 4663
179 Ga0068305_10228752 3300005083 Bacteria 2650
180 Ga0104019_1193940 3300007150 Bacteria 1383

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_10012807 Ga0123356_100128072 209
2 3300042602 Ga0466713_094833 Ga0466713_094833_6028_6708 209
3 3300042612 Ga0466705_486192 Ga0466705_486192_3313_3990 210
4 3300042636 Ga0466703_150695 Ga0466703_150695_2709_3377 210
5 3300005083 Ga0068305_10002944 Ga0068305_1000294417 214
6 3300042648 Ga0466709_363785 Ga0466709_363785_19097_19768 214
7 3300042602 Ga0466713_059975 Ga0466713_059975_18296_18973 216
8 3300042616 Ga0466715_498734 Ga0466715_498734_2322_2999 216
9 2225789004 2227522695 2228027650 219
10 3300042605 Ga0466716_187250 Ga0466716_187250_2573_3265 219
11 2225789004 2227228038 2227663339 220
12 2225789004 2227634903 2228221139 221
13 3300000062 IMNBL1DRAFT_c0001623 IMNBL1DRAFT_000162317 221
14 3300042590 Ga0466690_255390 Ga0466690_255390_2739_3404 221
15 3300042606 Ga0466719_113260 Ga0466719_113260_14_679 221
16 3300042606 Ga0466719_331648 Ga0466719_331648_550_1215 221
17 3300042609 Ga0466722_239940 Ga0466722_239940_23636_24301 221
18 3300042618 Ga0466723_085797 Ga0466723_085797_2152_2835 221
19 3300042636 Ga0466703_082207 Ga0466703_082207_4148_4831 221
20 2225789004 2227241906 2227681551 222
21 2225789004 2227632943 2228218040 222
22 3300000062 IMNBL1DRAFT_c0007451 IMNBL1DRAFT_00074515 222
23 3300000062 IMNBL1DRAFT_c0009074 IMNBL1DRAFT_00090742 222
24 3300009784 Ga0123357_10052147 Ga0123357_100521474 222
25 3300042582 Ga0466657_291017 Ga0466657_291017_98_766 222
26 3300042590 Ga0466690_037659 Ga0466690_037659_2685_3368 222
27 3300042590 Ga0466690_048858 Ga0466690_048858_28293_28961 222
28 3300042591 Ga0466692_104727 Ga0466692_104727_370_1038 222
29 3300042591 Ga0466692_168442 Ga0466692_168442_402_1070 222
30 3300042594 Ga0466694_001019 Ga0466694_001019_794_1462 222
31 3300042596 Ga0466696_158124 Ga0466696_158124_11422_12090 222
32 3300042601 Ga0466707_241108 Ga0466707_241108_9452_10120 222
33 3300042601 Ga0466707_284882 Ga0466707_284882_13903_14571 222
34 3300042602 Ga0466713_013942 Ga0466713_013942_21279_21947 222
35 3300042616 Ga0466715_348253 Ga0466715_348253_6257_6925 222
36 3300042616 Ga0466715_583205 Ga0466715_583205_14147_14815 222
37 3300042618 Ga0466723_005723 Ga0466723_005723_4278_4946 222
38 3300042619 Ga0466726_097828 Ga0466726_097828_338_1006 222
39 3300042619 Ga0466726_193560 Ga0466726_193560_343_1011 222
40 3300042620 Ga0466728_360258 Ga0466728_360258_1820_2488 222
41 3300042655 Ga0466727_335323 Ga0466727_335323_1698_2366 222
42 3300042656 Ga0466732_127717 Ga0466732_127717_637_1305 222
43 iso_pr_bacteria 2940205530 2940207613 222
44 iso_pr_bacteria 2940212447 2940214528 222
45 iso_pr_bacteria 2940298504 2940300582 222
46 iso_pr_bacteria 2940302308 2940304413 222
47 iso_pr_bacteria 2940306115 2940307977 222
48 iso_pr_bacteria 2940309933 2940311760 222
49 iso_pr_bacteria 2940313741 2940315629 222
50 iso_pr_bacteria 2940317558 2940319444 222
51 iso_pr_bacteria 2940321370 2940323689 222
52 iso_pr_bacteria 2940325180 2940327256 222
53 iso_pr_bacteria 2940328985 2940331089 222
54 iso_pr_bacteria 2940332795 2940334681 222
55 3300000062 IMNBL1DRAFT_c0089890 IMNBL1DRAFT_00898901 223
56 3300005083 Ga0068305_10238999 Ga0068305_102389996 223
57 3300005200 Ga0072940_1315469 Ga0072940_13154691 223
58 3300042590 Ga0466690_175771 Ga0466690_175771_54239_54910 223
59 3300042599 Ga0466706_010424 Ga0466706_010424_14900_15571 223
60 3300042602 Ga0466713_121173 Ga0466713_121173_8885_9556 223
61 3300042624 Ga0466735_079356 Ga0466735_079356_7416_8087 223
62 3300042624 Ga0466735_096576 Ga0466735_096576_709_1380 223
63 2225789004 2227520197 2228022792 224
64 3300002462 JGI24702J35022_10002991 JGI24702J35022_100029915 224
65 3300009826 Ga0123355_10001821 Ga0123355_1000182125 224
66 3300042599 Ga0466706_025047 Ga0466706_025047_4119_4793 224
67 3300042602 Ga0466713_000398 Ga0466713_000398_7088_7762 224
68 3300042605 Ga0466716_033986 Ga0466716_033986_431_1132 224
69 3300042609 Ga0466722_242007 Ga0466722_242007_2851_3525 224
70 3300042610 Ga0466698_383983 Ga0466698_383983_102_776 224
71 3300042610 Ga0466698_432236 Ga0466698_432236_1300_1974 224
72 3300042615 Ga0466711_303779 Ga0466711_303779_15860_16534 224
73 3300042619 Ga0466726_300403 Ga0466726_300403_543_1217 224
74 3300042620 Ga0466728_109015 Ga0466728_109015_3072_3746 224
75 3300042636 Ga0466703_331732 Ga0466703_331732_2451_3125 224
76 3300042654 Ga0466725_006692 Ga0466725_006692_960_1634 224
77 3300042655 Ga0466727_112751 Ga0466727_112751_6178_6852 224
78 iso_pr_bacteria 2873600114 2873603545 224
79 2225789004 2227563833 2228104053 225
80 3300002462 JGI24702J35022_10018786 JGI24702J35022_100187864 225
81 3300010049 Ga0123356_10278042 Ga0123356_102780422 225
82 3300010882 Ga0123354_10018220 Ga0123354_100182204 225
83 3300010882 Ga0123354_10020792 Ga0123354_100207923 225
84 3300010882 Ga0123354_10044892 Ga0123354_100448924 225
85 3300042590 Ga0466690_241728 Ga0466690_241728_351_1028 225
86 3300042596 Ga0466696_096834 Ga0466696_096834_1847_2524 225
87 3300042596 Ga0466696_274194 Ga0466696_274194_1007_1684 225
88 3300042600 Ga0466700_381744 Ga0466700_381744_1493_2170 225
89 3300042601 Ga0466707_261326 Ga0466707_261326_1436_2113 225
90 3300042602 Ga0466713_063067 Ga0466713_063067_98231_98908 225
91 3300042615 Ga0466711_045636 Ga0466711_045636_5887_6564 225
92 3300042616 Ga0466715_012770 Ga0466715_012770_506_1183 225
93 3300042616 Ga0466715_188116 Ga0466715_188116_6217_6894 225
94 3300042625 Ga0466730_015231 Ga0466730_015231_641_1318 225
95 3300042655 Ga0466727_182646 Ga0466727_182646_331_1008 225
96 iso_pr_bacteria 2820741847 2820743478 225
97 3300000062 IMNBL1DRAFT_c0002018 IMNBL1DRAFT_00020185 226
98 3300002509 JGI24699J35502_11132371 JGI24699J35502_111323718 226
99 3300009784 Ga0123357_10324166 Ga0123357_103241662 226
100 3300010167 Ga0123353_10174601 Ga0123353_101746012 226
101 3300010882 Ga0123354_10137783 Ga0123354_101377832 226
102 3300042590 Ga0466690_351619 Ga0466690_351619_1553_2233 226
103 3300042594 Ga0466694_028470 Ga0466694_028470_265_966 226
104 3300042596 Ga0466696_432602 Ga0466696_432602_5690_6370 226
105 3300042599 Ga0466706_048730 Ga0466706_048730_7468_8148 226
106 3300042599 Ga0466706_135756 Ga0466706_135756_13526_14206 226
107 3300042600 Ga0466700_039627 Ga0466700_039627_8175_8855 226
108 3300042606 Ga0466719_072964 Ga0466719_072964_353_1033 226
109 3300042606 Ga0466719_133232 Ga0466719_133232_714_1394 226
110 3300042606 Ga0466719_298958 Ga0466719_298958_3244_3924 226
111 3300042613 Ga0466710_304970 Ga0466710_304970_23_703 226
112 3300042616 Ga0466715_077237 Ga0466715_077237_10492_11172 226
113 3300042643 Ga0466704_268159 Ga0466704_268159_2512_3192 226
114 3300042652 Ga0466708_290271 Ga0466708_290271_9336_10016 226
115 3300042655 Ga0466727_008719 Ga0466727_008719_113_793 226
116 3300042659 Ga0466733_067578 Ga0466733_067578_485_1165 226
117 3300056842 Ga0562377_0004 Ga0562377_0004_1459516_1460196 226
118 iso_pr_bacteria 2695420317 2695484565 226
119 iso_pr_bacteria 2940193328 2940193666 226
120 iso_pr_bacteria 2940336608 2940336945 226
121 iso_pr_bacteria 8100157865 8100161834 226
122 3300000062 IMNBL1DRAFT_c0047934 IMNBL1DRAFT_00479342 227
123 3300002462 JGI24702J35022_10040189 JGI24702J35022_100401892 227
124 3300005071 Ga0068302_10145285 Ga0068302_101452852 227
125 3300009784 Ga0123357_10001032 Ga0123357_1000103215 227
126 3300009784 Ga0123357_10314845 Ga0123357_103148453 227
127 3300010049 Ga0123356_11363787 Ga0123356_113637872 227
128 3300010882 Ga0123354_10000925 Ga0123354_100009258 227
129 3300010882 Ga0123354_10247080 Ga0123354_102470802 227
130 3300042599 Ga0466706_086623 Ga0466706_086623_3086_3769 227
131 3300042601 Ga0466707_373554 Ga0466707_373554_1775_2458 227
132 3300042603 Ga0466714_008837 Ga0466714_008837_162_845 227
133 3300042619 Ga0466726_026154 Ga0466726_026154_2534_3217 227
134 3300042655 Ga0466727_025347 Ga0466727_025347_997_1680 227
135 3300002462 JGI24702J35022_10022440 JGI24702J35022_100224404 228
136 3300010167 Ga0123353_10000423 Ga0123353_1000042346 228
137 3300042593 Ga0466691_222548 Ga0466691_222548_9401_10087 228
138 3300042596 Ga0466696_048279 Ga0466696_048279_915_1601 228
139 3300042596 Ga0466696_213692 Ga0466696_213692_2399_3085 228
140 3300042596 Ga0466696_313177 Ga0466696_313177_3678_4364 228
141 3300042606 Ga0466719_086818 Ga0466719_086818_79_765 228
142 3300042606 Ga0466719_132659 Ga0466719_132659_28019_28705 228
143 3300042606 Ga0466719_242706 Ga0466719_242706_1500_2186 228
144 3300042609 Ga0466722_264474 Ga0466722_264474_784_1470 228
145 3300042612 Ga0466705_172980 Ga0466705_172980_28132_28818 228
146 3300042655 Ga0466727_095823 Ga0466727_095823_7371_8057 228
147 iso_pr_bacteria 2695420314 2695472189 228
148 3300010882 Ga0123354_10002953 Ga0123354_100029536 229
149 3300042598 Ga0466701_005987 Ga0466701_005987_496_1185 229
150 3300042598 Ga0466701_058340 Ga0466701_058340_4809_5498 229
151 3300042601 Ga0466707_099950 Ga0466707_099950_328_1017 229
152 3300042615 Ga0466711_373737 Ga0466711_373737_50702_51391 229
153 3300042616 Ga0466715_145673 Ga0466715_145673_2313_3002 229
154 3300042616 Ga0466715_452977 Ga0466715_452977_755_1444 229
155 3300042655 Ga0466727_066312 Ga0466727_066312_2740_3429 229
156 3300042655 Ga0466727_265039 Ga0466727_265039_7824_8513 229
157 3300042659 Ga0466733_210739 Ga0466733_210739_429_1118 229
158 iso_pr_bacteria 2864878056 2864880093 229
159 iso_pr_bacteria 2864886855 2864888893 229
160 3300042603 Ga0466714_088011 Ga0466714_088011_18783_19475 230
161 3300042609 Ga0466722_152891 Ga0466722_152891_16220_16912 230
162 3300042609 Ga0466722_233453 Ga0466722_233453_2181_2873 230
163 3300042616 Ga0466715_080209 Ga0466715_080209_2336_3064 230
164 3300042624 Ga0466735_057981 Ga0466735_057981_264_956 230
165 3300042654 Ga0466725_071344 Ga0466725_071344_3287_3979 230
166 iso_pr_bacteria 2940216256 2940217780 230
167 3300042596 Ga0466696_384414 Ga0466696_384414_339_1034 231
168 3300042598 Ga0466701_058067 Ga0466701_058067_3837_4532 231
169 3300042612 Ga0466705_370120 Ga0466705_370120_2290_2985 231
170 3300042618 Ga0466723_199550 Ga0466723_199550_5238_5987 231
171 iso_pr_bacteria 2820759988 2820761374 231
172 3300002509 JGI24699J35502_11133974 JGI24699J35502_1113397417 232
173 3300005083 Ga0068305_10228752 Ga0068305_102287523 232
174 3300007150 Ga0104019_1193940 Ga0104019_11939401 232
175 3300042598 Ga0466701_011125 Ga0466701_011125_2433_3131 232
176 3300042602 Ga0466713_145405 Ga0466713_145405_16590_17288 232
177 3300042618 Ga0466723_119358 Ga0466723_119358_5409_6107 232
178 3300042649 Ga0466724_31268 Ga0466724_31268_40531_41229 232
179 3300042659 Ga0466733_051051 Ga0466733_051051_10389_11087 232
180 iso_pr_bacteria 2899132286 2899134631 232
181 3300007143 Ga0104048_1168809 Ga0104048_11688093 233
182 3300010167 Ga0123353_11403178 Ga0123353_114031781 233
183 3300042599 Ga0466706_140997 Ga0466706_140997_2348_3049 233
184 3300042619 Ga0466726_486113 Ga0466726_486113_275_976 233
185 3300002462 JGI24702J35022_10012760 JGI24702J35022_100127603 234
186 3300042605 Ga0466716_202084 Ga0466716_202084_6759_7466 235
187 3300042601 Ga0466707_072578 Ga0466707_072578_7745_8455 236
188 3300042615 Ga0466711_217459 Ga0466711_217459_5845_6555 236
189 iso_pr_bacteria 2940244548 2940246595 237
190 iso_pr_bacteria 2940248789 2940250829 237
191 iso_pr_bacteria 2940257232 2940258913 237
192 3300042596 Ga0466696_151019 Ga0466696_151019_387_1103 238
193 3300042596 Ga0466696_080066 Ga0466696_080066_2776_3495 239
194 3300042609 Ga0466722_205722 Ga0466722_205722_8108_8827 239
195 3300042643 Ga0466704_055670 Ga0466704_055670_237_959 240
196 3300042591 Ga0466692_166284 Ga0466692_166284_3383_4108 241
197 3300042600 Ga0466700_193144 Ga0466700_193144_336_1064 242
198 3300042605 Ga0466716_072096 Ga0466716_072096_11743_12471 242
199 3300042616 Ga0466715_594337 Ga0466715_594337_1739_2467 242
200 3300042643 Ga0466704_517162 Ga0466704_517162_1037_1765 242
201 3300042648 Ga0466709_330726 Ga0466709_330726_505_1233 242
202 3300042652 Ga0466708_440707 Ga0466708_440707_6462_7190 242
203 iso_pr_bacteria 2695420931 2698111145 242
204 3300042624 Ga0466735_009555 Ga0466735_009555_82_816 244
205 3300042619 Ga0466726_167735 Ga0466726_167735_4389_5126 245
206 3300042620 Ga0466728_335249 Ga0466728_335249_282_1031 249
207 3300042601 Ga0466707_137259 Ga0466707_137259_561_1346 261
208 3300042643 Ga0466704_194858 Ga0466704_194858_8409_9293 294

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00849 PseudoU_synth_2 RNA pseudouridylate synthase 33 188 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.