Protein Family IF05833

Metagenome Isolate
127 Members
60 Samples
98 Scaffolds
702.17 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_119075|Ga0466707_119075_2604_4826
Length
740 aa
Sequence
MHRISKPVIKKDHSAKMDGSALYVGDYPQEGVLHGKLIRSPHPRARIVAINLPQLPEGYFSVDRSDVPGLNRVHVVLDDSFAFAEDTVEYVGDPLAMIVGPDEQTAASLAAQTEVVYEQLPAVLDIEEHDTVFFDYNFGHGDPDGAFAEADKVYEEVFTTGYQEQAYLEPQGMIAAYDAGAGVMTVHGSIQCPYYVHGAVSKVTGLPPDRVRIIQDVTGGGFGGKEAYPSFLASQTAIAAYKAGGNPVRVVFGRREDMAFTSKRHPSKCSYKVAVKNGRITAMDIDVIFNSGAFTTLSPVVLQRGIIAAPGVYDVPNLKVHGRAVKTNTVPTGAYRGFGAPQTFFAVELMMEHIARDLGIEPLTFKESHLVMQGDMTSTGGQYHYPVPLPALIEEVDELSDYRRKRAEYSKPQSGRYRRGIGMALWFHGAGFTGSGERDLIKAITAIRKTAEGKVEILASNSDMGQGIKTTFSKIVANELNLPYEDILIGNPDTFNVPDSGPTVASRSLMIVGELLRRAAIRLRETWKDGEEQIIEERYAEPDFLTPFSLEDFTGDAYPTYAWAAAAVEIXXXTLTGTNEIIGAWGSFDVGTPIDLNVATGQMEGGVLQGLGYASMEQMAIDAGGRIRNNSYSDYIIPTSKDVPELKVTMHVEEYPFGPYGAKGAGELPLVGIPAAFISAAEQATGGTGINHIPFTAEDALEILSLQNKERNPVIPGQQRNEGTSHPRPRPGIHKGGALT

📊 Sample Types

Isolate 22.1%
Metagenome 78.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 45.0%
Termitidae 21.7%
Kalotermitidae 20.0%
Termopsidae 6.7%
Blattidae 3.3%
Rhinotermitidae 3.3%

🌳 Taxonomy

Archaea 0
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820836992 Unclassified Actinobacteria Lab288P4bin32 Isolate Unclassified
2 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
3 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
4 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
5 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
6 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
7 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
8 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
9 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
10 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
11 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
12 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
13 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
18 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
22 2590828839 Clostridium sp. 1 Isolate Termitidae
23 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
24 2820626145 Unclassified Firmicutes Emb289P1bin123 Isolate Unclassified
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
26 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
27 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
28 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
29 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
30 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
35 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
36 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
37 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
38 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
41 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
42 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
43 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
44 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
47 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
48 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
49 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
50 2820823448 Unclassified Actinobacteria Nt197P3bin113 Isolate Unclassified
51 2820831444 Unclassified Actinobacteria Nc150P4bin21 Isolate Unclassified
52 2593339125 Clostridium sp. 5 Isolate Termitidae
53 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
54 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
55 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
56 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
57 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
58 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
59 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
60 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24695J34938_10000159 3300002450 Bacteria 62505
2 Ga0415639_030426 3300038395 Bacteria 3240
3 Ga0466707_329631 3300042601 Bacteria 5780
4 Ga0466721_097985 3300042608 Bacteria 27262
5 Ga0466722_232304 3300042609 Bacteria 9261
6 Ga0123355_10000767 3300009826 Bacteria 43870
7 Ga0123356_10003486 3300010049 Bacteria 16452
8 Ga0123356_10120335 3300010049 Bacteria 2552
9 Ga0123353_10165265 3300010167 Bacteria 3518
10 Ga0123353_10282127 3300010167 Bacteria 2550
11 Ga0466705_023857 3300042612 Bacteria 36957
12 Ga0466705_199486 3300042612 Bacteria 19717
13 Ga0466715_156844 3300042616 Bacteria 19036
14 Ga0466715_406082 3300042616 Bacteria 3821
15 Ga0466729_012315 3300042621 Bacteria 6824
16 Ga0466713_043845 3300042602 Bacteria 115614
17 Ga0466721_114097 3300042608 Bacteria 23336
18 Ga0123355_10035971 3300009826 Bacteria 8051
19 Ga0123356_10003751 3300010049 Bacteria 15836
20 Ga0123356_10004947 3300010049 Bacteria 13663
21 Ga0123353_10091019 3300010167 Bacteria 4913
22 Ga0123353_10145828 3300010167 Bacteria 3785
23 Ga0466703_067333 3300042636 Bacteria 23157
24 Ga0466709_337170 3300042648 Bacteria 51271
25 Ga0466725_250254 3300042654 Bacteria 4258
26 Ga0466727_164717 3300042655 Bacteria 3972
27 Ga0466733_043322 3300042659 Bacteria 12025
28 Ga0068302_10020637 3300005071 Bacteria 6361
29 Ga0466705_407214 3300042612 Bacteria 20230
30 Ga0466711_239333 3300042615 Bacteria 6401
31 Ga0466726_312280 3300042619 Bacteria 4830
32 Ga0466707_081271 3300042601 Bacteria 5768
33 Ga0466722_032277 3300042609 Bacteria 25232
34 Ga0123355_10000054 3300009826 Bacteria 118112
35 Ga0123355_10000143 3300009826 Bacteria 85423
36 Ga0123355_10001406 3300009826 Bacteria 33563
37 Ga0123355_10008119 3300009826 Bacteria 15847
38 Ga0123356_10000327 3300010049 Bacteria 54770
39 Ga0123353_10027115 3300010167 Bacteria 8773
40 Ga0466735_076343 3300042624 Bacteria 2688
41 Ga0466724_46092 3300042649 Bacteria 6210
42 Ga0466705_319466 3300042612 Bacteria 27771
43 Ga0415639_016018 3300038395 Bacteria 8501
44 Ga0466707_119075 3300042601 Unclassified 5150
45 Ga0466716_109727 3300042605 Bacteria 9008
46 Ga0466722_012298 3300042609 Bacteria 3637
47 Ga0466722_152903 3300042609 Bacteria 10909
48 Ga0123355_10006964 3300009826 Bacteria 16841
49 Ga0123355_10220326 3300009826 Unclassified 2730
50 Ga0123353_10016414 3300010167 Bacteria 10826
51 Ga0123354_10097275 3300010882 Unclassified 4012
52 Ga0466703_004494 3300042636 Bacteria 9433
53 Ga0466708_030628 3300042652 Bacteria 94331
54 Ga0466708_179337 3300042652 Bacteria 29890
55 Ga0466725_320944 3300042654 Bacteria 2598
56 Ga0466711_071925 3300042615 Bacteria 16152
57 Ga0466728_021292 3300042620 Bacteria 4284
58 Ga0466729_068727 3300042621 Bacteria 27754
59 Ga0466693_390147 3300042592 Bacteria 2081
60 Ga0466707_376323 3300042601 Bacteria 4857
61 Ga0466722_021828 3300042609 Bacteria 20079
62 Ga0123356_10011777 3300010049 Bacteria 8513
63 Ga0123353_10130227 3300010167 Bacteria 4038
64 Ga0123353_10273610 3300010167 Bacteria 2600
65 Ga0466727_251059 3300042655 Bacteria 3012
66 JGI24695J34938_10000340 3300002450 Bacteria 46153
67 Ga0466723_129049 3300042618 Bacteria 10247
68 Ga0415639_050570 3300038395 Bacteria 10274
69 Ga0466719_212359 3300042606 Bacteria 15889
70 Ga0123353_10027557 3300010167 Bacteria 8709
71 Ga0466725_061807 3300042654 Bacteria 2945
72 Ga0466705_260708 3300042612 Bacteria 9239
73 Ga0068305_10013128 3300005083 Bacteria 20037
74 Ga0466711_108937 3300042615 Bacteria 35885
75 Ga0466715_146685 3300042616 Bacteria 3046
76 Ga0466691_125877 3300042593 Bacteria 7015
77 Ga0466713_107647 3300042602 Bacteria 24108
78 Ga0123355_10001580 3300009826 Bacteria 31786
79 Ga0123355_10131830 3300009826 Bacteria 3850
80 Ga0123355_10165770 3300009826 Bacteria 3316
81 Ga0123356_10000795 3300010049 Bacteria 35033
82 Ga0123356_10001852 3300010049 Bacteria 22940
83 Ga0123356_10003366 3300010049 Bacteria 16796
84 Ga0123356_10012496 3300010049 Bacteria 8232
85 Ga0123353_10000333 3300010167 Bacteria 58025
86 Ga0123353_10090264 3300010167 Bacteria 4933
87 Ga0123353_10184011 3300010167 Bacteria 3305
88 Ga0123353_10242448 3300010167 Bacteria 2799
89 Ga0466704_086500 3300042643 Bacteria 11394
90 Ga0466715_167809 3300042616 Bacteria 59858
91 Ga0123356_10000446 3300010049 Bacteria 46577
92 Ga0123356_10002865 3300010049 Bacteria 18251
93 Ga0123356_10058304 3300010049 Bacteria 3600
94 Ga0123353_10000058 3300010167 Bacteria 125313
95 Ga0123353_10000060 3300010167 Bacteria 123051
96 Ga0123353_10028246 3300010167 Bacteria 8615
97 Ga0123353_10035941 3300010167 Bacteria 7756
98 Ga0466708_171820 3300042652 Bacteria 69370

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_071925 Ga0466711_071925_10810_12780 641
2 3300042592 Ga0466693_390147 Ga0466693_390147_16_1974 652
3 3300042655 Ga0466727_164717 Ga0466727_164717_292_2304 655
4 3300042601 Ga0466707_081271 Ga0466707_081271_2046_4019 657
5 3300010167 Ga0123353_10273610 Ga0123353_102736102 667
6 3300010167 Ga0123353_10016414 Ga0123353_100164146 673
7 3300038395 Ga0415639_030426 Ga0415639_030426_210_2231 673
8 3300010167 Ga0123353_10165265 Ga0123353_101652652 675
9 iso_pr_bacteria 2820831444 2820832699 675
10 3300009826 Ga0123355_10000054 Ga0123355_1000005472 678
11 3300009826 Ga0123355_10000767 Ga0123355_100007675 679
12 3300042652 Ga0466708_171820 Ga0466708_171820_24953_27076 682
13 3300010167 Ga0123353_10000333 Ga0123353_1000033333 684
14 3300009826 Ga0123355_10131830 Ga0123355_101318303 688
15 3300010049 Ga0123356_10012496 Ga0123356_100124965 688
16 3300042652 Ga0466708_179337 Ga0466708_179337_3926_6049 689
17 3300010167 Ga0123353_10242448 Ga0123353_102424482 690
18 3300042605 Ga0466716_109727 Ga0466716_109727_2424_4544 690
19 3300042616 Ga0466715_406082 Ga0466715_406082_69_2210 690
20 3300010167 Ga0123353_10028246 Ga0123353_100282464 691
21 3300042618 Ga0466723_129049 Ga0466723_129049_1495_3615 691
22 3300042620 Ga0466728_021292 Ga0466728_021292_1879_4005 693
23 3300009826 Ga0123355_10165770 Ga0123355_101657703 695
24 3300042624 Ga0466735_076343 Ga0466735_076343_578_2665 695
25 3300002450 JGI24695J34938_10000159 JGI24695J34938_1000015913 697
26 3300010049 Ga0123356_10003366 Ga0123356_1000336610 697
27 3300042655 Ga0466727_251059 Ga0466727_251059_577_2709 697
28 3300042601 Ga0466707_376323 Ga0466707_376323_450_2621 699
29 3300042612 Ga0466705_319466 Ga0466705_319466_16140_18281 699
30 3300042636 Ga0466703_067333 Ga0466703_067333_7924_10059 699
31 iso_pr_bacteria 2820318056 2820318087 699
32 3300009826 Ga0123355_10008119 Ga0123355_100081194 700
33 3300010167 Ga0123353_10282127 Ga0123353_102821272 700
34 3300042602 Ga0466713_107647 Ga0466713_107647_2089_4191 700
35 3300042608 Ga0466721_114097 Ga0466721_114097_20560_22662 700
36 3300009826 Ga0123355_10000143 Ga0123355_100001432 701
37 3300010167 Ga0123353_10035941 Ga0123353_100359414 701
38 3300042608 Ga0466721_097985 Ga0466721_097985_21738_23843 701
39 3300042654 Ga0466725_320944 Ga0466725_320944_237_2342 701
40 3300042609 Ga0466722_032277 Ga0466722_032277_19395_21587 702
41 3300042654 Ga0466725_061807 Ga0466725_061807_452_2560 702
42 3300042654 Ga0466725_250254 Ga0466725_250254_1401_3509 702
43 iso_pr_bacteria 2820492969 2820495178 702
44 3300042609 Ga0466722_232304 Ga0466722_232304_497_2608 703
45 iso_pr_bacteria 2820483401 2820483463 703
46 iso_pr_bacteria 2820504582 2820504974 703
47 iso_pr_bacteria 2820587002 2820590111 703
48 3300009826 Ga0123355_10006964 Ga0123355_100069644 704
49 3300009826 Ga0123355_10220326 Ga0123355_102203261 704
50 3300010049 Ga0123356_10001852 Ga0123356_100018525 704
51 3300010049 Ga0123356_10004947 Ga0123356_100049475 704
52 3300010049 Ga0123356_10120335 Ga0123356_101203351 704
53 3300010167 Ga0123353_10027557 Ga0123353_100275576 704
54 3300010167 Ga0123353_10091019 Ga0123353_100910194 704
55 3300010167 Ga0123353_10130227 Ga0123353_101302272 704
56 3300042609 Ga0466722_012298 Ga0466722_012298_1168_3282 704
57 3300042649 Ga0466724_46092 Ga0466724_46092_1781_3895 704
58 iso_pr_bacteria 2590828839 2593250993 704
59 iso_pr_bacteria 2593339125 2595065996 704
60 iso_pr_bacteria 2820340373 2820341890 704
61 iso_pr_bacteria 2820693137 2820693516 704
62 3300010167 Ga0123353_10027115 Ga0123353_100271155 705
63 iso_pr_bacteria 2820432912 2820433773 705
64 iso_pr_bacteria 2820488713 2820490829 705
65 iso_pr_bacteria 2820530790 2820532751 705
66 iso_pr_bacteria 2820533259 2820534349 705
67 iso_pr_bacteria 2820661146 2820661503 705
68 iso_pr_bacteria 2820690275 2820690596 705
69 iso_pr_bacteria 2940241992 2940242516 705
70 iso_pr_bacteria 2940349480 2940350114 705
71 3300002450 JGI24695J34938_10000340 JGI24695J34938_1000034038 706
72 3300009826 Ga0123355_10001406 Ga0123355_1000140628 706
73 3300010167 Ga0123353_10145828 Ga0123353_101458282 706
74 3300042619 Ga0466726_312280 Ga0466726_312280_631_2751 706
75 3300042659 Ga0466733_043322 Ga0466733_043322_1231_3351 706
76 iso_pr_bacteria 2820442516 2820442640 706
77 iso_pr_bacteria 2820459456 2820460153 706
78 iso_pr_bacteria 2820626145 2820627514 706
79 3300010049 Ga0123356_10000795 Ga0123356_1000079512 707
80 3300010167 Ga0123353_10000058 Ga0123353_1000005816 707
81 3300010167 Ga0123353_10090264 Ga0123353_100902643 707
82 iso_pr_bacteria 2820516196 2820517997 707
83 iso_pr_bacteria 2820666966 2820668108 707
84 3300038395 Ga0415639_016018 Ga0415639_016018_3405_5531 708
85 3300038395 Ga0415639_050570 Ga0415639_050570_1513_3639 708
86 3300042602 Ga0466713_043845 Ga0466713_043845_57854_59980 708
87 3300042612 Ga0466705_023857 Ga0466705_023857_19842_21968 708
88 3300042643 Ga0466704_086500 Ga0466704_086500_1450_3576 708
89 3300042648 Ga0466709_337170 Ga0466709_337170_31752_33878 708
90 3300005083 Ga0068305_10013128 Ga0068305_1001312818 709
91 3300009826 Ga0123355_10035971 Ga0123355_100359713 709
92 3300010049 Ga0123356_10011777 Ga0123356_100117772 709
93 3300010167 Ga0123353_10000060 Ga0123353_1000006052 709
94 3300010167 Ga0123353_10184011 Ga0123353_101840111 709
95 iso_pr_bacteria 2820566695 2820567793 709
96 iso_pr_bacteria 2820836992 2820837813 709
97 3300010049 Ga0123356_10000327 Ga0123356_1000032731 710
98 3300010049 Ga0123356_10002865 Ga0123356_100028655 710
99 3300010049 Ga0123356_10003751 Ga0123356_100037518 710
100 3300010049 Ga0123356_10058304 Ga0123356_100583042 710
101 3300010882 Ga0123354_10097275 Ga0123354_100972752 710
102 3300042615 Ga0466711_239333 Ga0466711_239333_3203_5335 710
103 iso_pr_bacteria 2989309576 2989313373 710
104 3300005071 Ga0068302_10020637 Ga0068302_100206372 711
105 3300042601 Ga0466707_329631 Ga0466707_329631_1839_3974 711
106 3300042609 Ga0466722_021828 Ga0466722_021828_7585_9720 711
107 3300042609 Ga0466722_152903 Ga0466722_152903_3091_5226 711
108 3300042612 Ga0466705_199486 Ga0466705_199486_14895_17030 711
109 3300042612 Ga0466705_260708 Ga0466705_260708_4133_6268 711
110 3300042612 Ga0466705_407214 Ga0466705_407214_5235_7370 711
111 3300042616 Ga0466715_146685 Ga0466715_146685_53_2296 711
112 3300010049 Ga0123356_10003486 Ga0123356_100034868 712
113 3300042621 Ga0466729_012315 Ga0466729_012315_198_2336 712
114 3300042636 Ga0466703_004494 Ga0466703_004494_812_2950 712
115 iso_pr_bacteria 2820602899 2820603636 712
116 3300009826 Ga0123355_10001580 Ga0123355_100015805 713
117 3300010049 Ga0123356_10000446 Ga0123356_100004463 714
118 3300042606 Ga0466719_212359 Ga0466719_212359_2276_4423 715
119 3300042621 Ga0466729_068727 Ga0466729_068727_348_2495 715
120 3300042616 Ga0466715_156844 Ga0466715_156844_13440_15596 718
121 3300042652 Ga0466708_030628 Ga0466708_030628_51656_53839 719
122 3300042593 Ga0466691_125877 Ga0466691_125877_3357_5519 720
123 3300042616 Ga0466715_167809 Ga0466715_167809_42382_44544 720
124 iso_pr_bacteria 2820823448 2820824023 725
125 3300042615 Ga0466711_108937 Ga0466711_108937_2427_4634 735
126 3300042609 Ga0466722_032277 Ga0466722_032277_1159_3375 738
127 3300042601 Ga0466707_119075 Ga0466707_119075_2604_4826 740

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02738 MoCoBD_1 Molybdopterin cofactor-binding domain 131 367 0.96
PF20256 MoCoBD_2 Molybdopterin cofactor-binding domain 396 644 0.91
PF01315 Ald_Xan_dh_C Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain 19 121 0.9

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02738 GO:0016491 oxidoreductase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.93 0.95 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.