Protein Family IF05832

Metagenome Isolate
125 Members
68 Samples
99 Scaffolds
560.84 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_118981|Ga0466707_118981_2351_4192
Length
613 aa
Sequence
MGFLFPFDVTGKQKDIALKTVNPANHPTDYGSRLLPICPYLLIFVVEIPYVMRCYSILSCFAGVMLAICPASLQGQELRNPFDFPIVLSGSFGELRANHFHSGLDFKTQGVEGKAVHAVEAGYVSRISVSPGGYGNVLYITHPSGITTVYAHLQRFAPEIAAYVKEQQYAAESFRVNLLPGPEQFPTGKGDVVAWSGNTGSSGGPHLHFEVRDTESEEVLDPLVYYRERISDTRPPRIDGIMIYPAEGKGVVNGSGRKQEFKRSAARDGGALALNGRIEAWGKIGIAVKAYDYMDGTQNIYGVKEITLKADSQVIFHSCIDRFAFDESRYLNSFIDYAEWTDNRSFYMKSFVEPGNRLRFFDTRNRGYLTIDREQTYHLQYVLADVYGHTARLSFTIEGKEQVVPLPETGAERFYRNVENHFGAKGVRLTIPYGNLYDDLYFRYAVKEDSTALAGTHLLHDRPLAFHQAARLSLRLSKDTLANKEQYGIVRIHRGRYLWTGGTYRDGWIEAPIGELGKYTVAADTVAPVITPVDQPAWKGNKRFVFRLSDNLSGVAGYRGEIDGQYALFEMDNHSVITYRFDGERLAQGAHTLRLTAADACGNETIYTYKFNY

📊 Sample Types

Isolate 20.8%
Metagenome 79.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 33.3%
Kalotermitidae 21.2%
Termitidae 15.2%
Unclassified 7.6%
Termopsidae 4.5%
Rhinotermitidae 4.5%
Armadillidiidae 4.5%
Passalidae 4.5%
Formicidae 1.5%
Hodotermitidae 1.5%
Nephropidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 123
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
2 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
3 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
4 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
5 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
6 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
7 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
8 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
9 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
12 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
23 2923982719 Parabacteroides sp. 52 Isolate Blattidae
24 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
25 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
26 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
30 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
31 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
32 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
33 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
34 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
35 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
39 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
40 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
41 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
42 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
43 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
44 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
45 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
46 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
47 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
48 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
50 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
51 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
52 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
53 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
54 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
55 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
56 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
57 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
58 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
59 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
60 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
61 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
62 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
63 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
64 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
65 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
66 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
67 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
68 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_056566 3300042659 Bacteria 66737
2 Ga0466709_179213 3300042648 Bacteria 3721
3 Ga0466725_157962 3300042654 Bacteria 30767
4 Ga0466711_340350 3300042615 Bacteria 11504
5 Ga0466711_424379 3300042615 Bacteria 3153
6 Ga0466715_188075 3300042616 Bacteria 87062
7 Ga0160445_100508 3300012847 Unclassified 19055
8 Ga0466692_038856 3300042591 Bacteria 66664
9 Ga0466696_471991 3300042596 Bacteria 8662
10 Ga0466701_073839 3300042598 Bacteria 6852
11 Ga0466707_081394 3300042601 Bacteria 8758
12 Ga0466719_222632 3300042606 Bacteria 13943
13 Ga0466709_209153 3300042648 Bacteria 4039
14 Ga0466708_228442 3300042652 Bacteria 4630
15 Ga0466727_197964 3300042655 Bacteria 22347
16 Ga0466727_313475 3300042655 Bacteria 4641
17 Ga0466711_101292 3300042615 Bacteria 10482
18 Ga0466715_079967 3300042616 Bacteria 5033
19 Ga0160433_100421 3300012846 Bacteria 22611
20 Ga0466690_149910 3300042590 Bacteria 3707
21 Ga0466692_127213 3300042591 Bacteria 4561
22 Ga0466707_048942 3300042601 Bacteria 15157
23 Ga0466722_058028 3300042609 Bacteria 4931
24 JGI24702J35022_10000259 3300002462 Bacteria 30226
25 JGI24702J35022_10007161 3300002462 Bacteria 6413
26 Ga0466703_099783 3300042636 Bacteria 2357
27 Ga0466708_028736 3300042652 Bacteria 16446
28 Ga0466711_010134 3300042615 Bacteria 3372
29 Ga0466711_066519 3300042615 Bacteria 37581
30 Ga0466711_214846 3300042615 Bacteria 20080
31 Ga0466711_223836 3300042615 Bacteria 37949
32 Ga0466726_415280 3300042619 Bacteria 4217
33 Ga0466656_036778 3300042550 Bacteria 3725
34 Ga0466696_295020 3300042596 Bacteria 31908
35 Ga0123353_10025466 3300010167 Bacteria 9016
36 Ga0466700_249204 3300042600 Bacteria 41013
37 Ga0466713_017744 3300042602 Bacteria 33043
38 Ga0466722_219492 3300042609 Bacteria 63959
39 Ga0466705_280525 3300042612 Bacteria 10801
40 Ga0466732_041734 3300042656 Bacteria 75299
41 Ga0466703_166586 3300042636 Bacteria 1959
42 Ga0466703_320165 3300042636 Bacteria 13646
43 Ga0466704_180446 3300042643 Bacteria 10940
44 Ga0466709_062906 3300042648 Bacteria 1810
45 Ga0466715_065641 3300042616 Bacteria 5596
46 Ga0466692_141398 3300042591 Bacteria 5091
47 Ga0466696_220112 3300042596 Bacteria 7899
48 Ga0160464_100140 3300012805 Bacteria 79019
49 Ga0466707_118981 3300042601 Bacteria 4301
50 Ga0466707_188845 3300042601 Bacteria 16270
51 Ga0466716_230301 3300042605 Bacteria 8125
52 IMNBL1DRAFT_c0000079 3300000062 Bacteria 87281
53 IMNBL1DRAFT_c0003813 3300000062 Bacteria 9395
54 Ga0068305_10064743 3300005083 Bacteria 15354
55 Ga0466703_092372 3300042636 Bacteria 7662
56 Ga0466704_069957 3300042643 Bacteria 18760
57 Ga0466704_124229 3300042643 Bacteria 13880
58 Ga0466708_101648 3300042652 Bacteria 32818
59 Ga0466708_310919 3300042652 Bacteria 7713
60 Ga0466708_332352 3300042652 Bacteria 2450
61 Ga0466715_045974 3300042616 Bacteria 42084
62 Ga0466723_092210 3300042618 Bacteria 16133
63 Ga0466728_339660 3300042620 Bacteria 14592
64 Ga0466729_192842 3300042621 Bacteria 7074
65 Ga0160444_100218 3300012841 Bacteria 49781
66 Ga0466706_023408 3300042599 Bacteria 7020
67 2227008135 2225789003 Bacteria 27247
68 Ga0068302_10158821 3300005071 Unclassified 1936
69 Ga0103265_1000609 3300007068 Bacteria 6025
70 Ga0466703_186467 3300042636 Bacteria 3521
71 Ga0466704_170415 3300042643 Bacteria 25587
72 Ga0466715_079603 3300042616 Bacteria 222305
73 Ga0466690_180551 3300042590 Bacteria 65151
74 Ga0466691_193013 3300042593 Bacteria 11280
75 Ga0466707_058866 3300042601 Bacteria 13756
76 Ga0466722_065825 3300042609 Bacteria 12557
77 2227505164 2225789004 Bacteria 19074
78 IMNBL1DRAFT_c0000298 3300000062 Bacteria 42272
79 IMNBL1DRAFT_c0006606 3300000062 Bacteria 6293
80 Ga0466705_053984 3300042612 Bacteria 7693
81 Ga0466705_169781 3300042612 Bacteria 18950
82 Ga0466704_028371 3300042643 Bacteria 10898
83 Ga0466705_438866 3300042612 Bacteria 4156
84 Ga0160433_100351 3300012846 Bacteria 27213
85 Ga0123353_10215985 3300010167 Bacteria 3004
86 Ga0123353_10454296 3300010167 Bacteria 1885
87 Ga0466713_077022 3300042602 Bacteria 15402
88 Ga0466716_399890 3300042605 Bacteria 9947
89 Ga0466722_153819 3300042609 Bacteria 6968
90 Ga0466722_233912 3300042609 Bacteria 9388
91 JGI24696J40584_12956741 3300002834 Bacteria 3214
92 Ga0466705_175096 3300042612 Bacteria 32654
93 Ga0466733_108250 3300042659 Bacteria 6704
94 Ga0466733_130252 3300042659 Bacteria 8712
95 Ga0466711_239934 3300042615 Bacteria 17196
96 Ga0466711_282013 3300042615 Bacteria 7855
97 Ga0466696_244013 3300042596 Bacteria 5479
98 Ga0466722_203003 3300042609 Bacteria 20008
99 JGI24705J35276_12236789 3300002504 Bacteria 8929

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042618 Ga0466723_092210 Ga0466723_092210_1713_3266 517
2 3300042656 Ga0466732_041734 Ga0466732_041734_43571_45286 519
3 3300042612 Ga0466705_280525 Ga0466705_280525_1547_3160 524
4 3300042598 Ga0466701_073839 Ga0466701_073839_1457_3040 527
5 3300042652 Ga0466708_332352 Ga0466708_332352_575_2188 537
6 3300042654 Ga0466725_157962 Ga0466725_157962_9816_11429 537
7 3300042636 Ga0466703_099783 Ga0466703_099783_461_2077 538
8 3300042615 Ga0466711_340350 Ga0466711_340350_8867_10486 539
9 3300042636 Ga0466703_186467 Ga0466703_186467_1613_3304 539
10 3300042590 Ga0466690_180551 Ga0466690_180551_9293_11002 540
11 3300042602 Ga0466713_077022 Ga0466713_077022_5166_6794 542
12 3300042602 Ga0466713_017744 Ga0466713_017744_22730_24361 543
13 3300042643 Ga0466704_069957 Ga0466704_069957_3857_5542 543
14 3300042619 Ga0466726_415280 Ga0466726_415280_2240_3874 544
15 3300007068 Ga0103265_1000609 Ga0103265_10006097 546
16 3300042655 Ga0466727_197964 Ga0466727_197964_9009_10676 547
17 3300042605 Ga0466716_399890 Ga0466716_399890_422_2110 549
18 3300010167 Ga0123353_10454296 Ga0123353_104542961 550
19 3300010167 Ga0123353_10215985 Ga0123353_102159852 551
20 3300042605 Ga0466716_230301 Ga0466716_230301_3721_5376 551
21 3300042616 Ga0466715_079603 Ga0466715_079603_118105_119763 552
22 3300042600 Ga0466700_249204 Ga0466700_249204_245_1906 553
23 3300042609 Ga0466722_065825 Ga0466722_065825_2697_4358 553
24 3300042609 Ga0466722_219492 Ga0466722_219492_55534_57195 553
25 3300042636 Ga0466703_092372 Ga0466703_092372_522_2231 554
26 3300042643 Ga0466704_170415 Ga0466704_170415_11620_13284 554
27 3300042652 Ga0466708_228442 Ga0466708_228442_2840_4531 554
28 3300042659 Ga0466733_108250 Ga0466733_108250_1117_2820 554
29 iso_pr_bacteria 2718218155 2720330308 554
30 3300012841 Ga0160444_100218 Ga0160444_10021816 556
31 3300042606 Ga0466719_222632 Ga0466719_222632_8449_10149 556
32 3300042609 Ga0466722_058028 Ga0466722_058028_2784_4454 556
33 3300042652 Ga0466708_028736 Ga0466708_028736_7300_8970 556
34 3300042609 Ga0466722_233912 Ga0466722_233912_4279_5979 557
35 3300000062 IMNBL1DRAFT_c0006606 IMNBL1DRAFT_00066063 558
36 3300042616 Ga0466715_045974 Ga0466715_045974_36764_38440 558
37 iso_pr_bacteria 2940216256 2940217659 558
38 3300005083 Ga0068305_10064743 Ga0068305_1006474310 559
39 3300042593 Ga0466691_193013 Ga0466691_193013_4485_6164 559
40 3300042596 Ga0466696_471991 Ga0466696_471991_4497_6209 559
41 3300042591 Ga0466692_038856 Ga0466692_038856_45977_47659 560
42 3300042615 Ga0466711_101292 Ga0466711_101292_4162_5844 560
43 3300042615 Ga0466711_424379 Ga0466711_424379_135_1817 560
44 3300042550 Ga0466656_036778 Ga0466656_036778_1827_3551 561
45 3300042636 Ga0466703_166586 Ga0466703_166586_132_1817 561
46 3300042643 Ga0466704_028371 Ga0466704_028371_5281_6966 561
47 3300042643 Ga0466704_124229 Ga0466704_124229_2014_3699 561
48 3300042648 Ga0466709_209153 Ga0466709_209153_1175_2860 561
49 3300042659 Ga0466733_130252 Ga0466733_130252_732_2525 561
50 iso_pr_bacteria 2940202316 2940205065 561
51 3300042596 Ga0466696_220112 Ga0466696_220112_3464_5152 562
52 3300042596 Ga0466696_295020 Ga0466696_295020_26930_28618 562
53 3300042612 Ga0466705_053984 Ga0466705_053984_1889_3577 562
54 3300042616 Ga0466715_079967 Ga0466715_079967_1609_3297 562
55 3300042648 Ga0466709_179213 Ga0466709_179213_1584_3272 562
56 3300042659 Ga0466733_056566 Ga0466733_056566_39521_41209 562
57 iso_pr_bacteria 2838772460 2838776457 562
58 iso_pr_bacteria 2910949487 2910951024 562
59 iso_pr_bacteria 2923982719 2923982861 562
60 iso_pr_bacteria 2940195863 2940197548 562
61 iso_pr_bacteria 2940205530 2940207846 562
62 iso_pr_bacteria 2940212447 2940214761 562
63 iso_pr_bacteria 2940298504 2940300714 562
64 iso_pr_bacteria 2940302308 2940304517 562
65 iso_pr_bacteria 2940306115 2940308181 562
66 iso_pr_bacteria 2940309933 2940311920 562
67 iso_pr_bacteria 2940313741 2940315833 562
68 iso_pr_bacteria 2940317558 2940319548 562
69 iso_pr_bacteria 2940321370 2940323153 562
70 iso_pr_bacteria 2940325180 2940327388 562
71 iso_pr_bacteria 2940328985 2940331294 562
72 iso_pr_bacteria 2940332795 2940334885 562
73 iso_pr_bacteria 2940371297 2940372934 562
74 3300000062 IMNBL1DRAFT_c0003813 IMNBL1DRAFT_00038136 563
75 3300010167 Ga0123353_10025466 Ga0123353_100254664 563
76 3300042601 Ga0466707_188845 Ga0466707_188845_1360_3051 563
77 3300042612 Ga0466705_169781 Ga0466705_169781_1922_3613 563
78 3300042615 Ga0466711_239934 Ga0466711_239934_6605_8296 563
79 3300042652 Ga0466708_101648 Ga0466708_101648_3197_4888 563
80 iso_pr_bacteria 2894649344 2894650795 563
81 iso_pr_bacteria 2940199050 2940201043 563
82 iso_pr_bacteria 2940346213 2940347955 563
83 3300042601 Ga0466707_081394 Ga0466707_081394_5700_7394 564
84 3300042636 Ga0466703_320165 Ga0466703_320165_7440_9134 564
85 3300042652 Ga0466708_310919 Ga0466708_310919_588_2282 564
86 3300042655 Ga0466727_313475 Ga0466727_313475_2829_4523 564
87 3300005071 Ga0068302_10158821 Ga0068302_101588211 565
88 3300042601 Ga0466707_058866 Ga0466707_058866_2985_4682 565
89 3300042615 Ga0466711_066519 Ga0466711_066519_5998_7695 565
90 3300042616 Ga0466715_188075 Ga0466715_188075_69988_71685 565
91 3300042620 Ga0466728_339660 Ga0466728_339660_11944_13641 565
92 3300042643 Ga0466704_180446 Ga0466704_180446_2160_3896 565
93 3300002834 JGI24696J40584_12956741 JGI24696J40584_129567413 566
94 3300042599 Ga0466706_023408 Ga0466706_023408_2179_3879 566
95 3300042609 Ga0466722_203003 Ga0466722_203003_1904_3604 566
96 3300042615 Ga0466711_214846 Ga0466711_214846_15351_17051 566
97 3300042615 Ga0466711_223836 Ga0466711_223836_18973_20673 566
98 2225789003 2227008135 2227365028 567
99 2225789004 2227505164 2227991777 567
100 3300042591 Ga0466692_127213 Ga0466692_127213_1009_2715 568
101 3300000062 IMNBL1DRAFT_c0000079 IMNBL1DRAFT_000007967 569
102 3300000062 IMNBL1DRAFT_c0000298 IMNBL1DRAFT_00002984 569
103 3300012846 Ga0160433_100351 Ga0160433_10035116 569
104 3300012847 Ga0160445_100508 Ga0160445_10050810 569
105 iso_pr_bacteria 2910926975 2910928606 569
106 3300042615 Ga0466711_010134 Ga0466711_010134_1155_2867 570
107 3300042648 Ga0466709_062906 Ga0466709_062906_79_1791 570
108 3300042601 Ga0466707_048942 Ga0466707_048942_11935_13650 571
109 3300012846 Ga0160433_100421 Ga0160433_10042116 572
110 3300042612 Ga0466705_438866 Ga0466705_438866_312_2030 572
111 3300042615 Ga0466711_282013 Ga0466711_282013_4876_6597 573
112 3300002462 JGI24702J35022_10007161 JGI24702J35022_100071615 574
113 iso_pr_bacteria 2820789850 2820790203 574
114 3300012805 Ga0160464_100140 Ga0160464_10014049 575
115 3300042612 Ga0466705_175096 Ga0466705_175096_7360_9087 575
116 3300002504 JGI24705J35276_12236789 JGI24705J35276_122367897 578
117 3300042609 Ga0466722_153819 Ga0466722_153819_547_2283 578
118 3300042591 Ga0466692_141398 Ga0466692_141398_833_2572 579
119 3300042596 Ga0466696_244013 Ga0466696_244013_2623_4362 579
120 3300042616 Ga0466715_065641 Ga0466715_065641_214_1953 579
121 3300042590 Ga0466690_149910 Ga0466690_149910_1292_3037 581
122 3300042621 Ga0466729_192842 Ga0466729_192842_5057_6802 581
123 3300002462 JGI24702J35022_10000259 JGI24702J35022_100002598 588
124 iso_pr_bacteria 2940209341 2940210419 604
125 3300042601 Ga0466707_118981 Ga0466707_118981_2351_4192 613

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01551 Peptidase_M23 Peptidase family M23 100 170 0.85

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.