Protein Family IF05830

Metagenome Isolate
165 Members
120 Samples
85 Scaffolds
374.63 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_113367|Ga0466707_113367_161_1363
Length
400 aa
Sequence
MKIQRAQTAAADGGKGGTYDGEMAQVSESDVRAALARVQDPEIRKPITEIGMVGDIVIGDDNSVKVGIYLTTSGCPLRTEIEKRVKAAVADVPGAGAVTVELDVMNDEQKAMLRKTLHGDSNAPIIPFAQPGNRTRVYAVASGKGGVGKSSVTVNIAASLAARGLSVGLLDADIYGHSVPRMLGTTARPTQVDKMIVPPIAHEVRVVSIAQFTQGNVPVVWRGPMLHRVLQQFLADVFWGDLDVLLLDLPPGTGDIAISVAQLIPNAEILVVTTPQLAAAEVAERAGAIALQTRQRLVGVVENMSWMTMPDGSRMDVFGAGGGQVVANRLTRALGADVPLLGQIPLDQRLREGGDDGVPVVLGAPDTEAAKALESIADKLAVRKRGLAGMSLGIDTTRHP

📊 Sample Types

Isolate 48.5%
Metagenome 51.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 28.9%
Termitidae 18.4%
Formicidae 16.7%
Tenebrionidae 6.1%
Kalotermitidae 5.3%
Culicidae 4.4%
Elmidae 3.5%
Cambaridae 2.6%
Hydrophilidae 1.8%
Scarabaeidae 1.8%
Termopsidae 1.8%
Cimicidae 0.9%
Apidae 0.9%
Siricidae 0.9%
Reduviidae 0.9%
Cerambycidae 0.9%
Hodotermitidae 0.9%
Ixodidae 0.9%
Curculionidae 0.9%
Pyralidae 0.9%
Armadillidiidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 149
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2505679068 Isoptericola variabilis 225 Isolate Unclassified
2 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
3 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
4 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
5 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
6 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
7 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
8 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
9 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
10 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
11 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
12 8062637095 Yimella sp. cx-51 Isolate Cambaridae
13 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
14 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
15 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
16 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
17 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
18 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
19 2718217924 Pseudonocardia sp. HH130630-07 Isolate Formicidae
20 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
21 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
22 2820876581 Unclassified Actinobacteria Lab288P1bin83 Isolate Unclassified
23 2820929059 Unclassified Actinobacteria Emb289P3bin110 Isolate Unclassified
24 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
25 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
26 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
27 2862784999 Streptomyces sp. M41 Isolate Unclassified
28 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
29 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
30 2909412500 Yimella sp. cx-573 Isolate Cambaridae
31 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
32 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
35 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
36 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
37 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
38 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
39 2888667245 Corynebacterium diphtheriae FRC0190 Isolate Unclassified
40 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
41 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
42 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
43 2547132081 Streptomyces sp. S4 Isolate Formicidae
44 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
45 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
46 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
47 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
48 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
49 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
50 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
51 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
52 2504756063 Isoptericola variabilis J5 Isolate Unclassified
53 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
54 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
55 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
56 2859977607 Pseudonocardia sp. Ae707_Ps1 Isolate Formicidae
57 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
58 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
59 2900354037 Nocardia macrotermitis RB20 Isolate Termitidae
60 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
61 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
62 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
63 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
64 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
65 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
66 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
67 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
68 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
69 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
70 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
71 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
72 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
73 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
74 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
75 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
76 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
77 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
78 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
79 2856966858 Pseudonocardia sp. Ae263_Ps1 Isolate Formicidae
80 2862075925 Corynebacterium lactis S064 Isolate Ixodidae
81 2896955351 Streptomyces sp. GF20 Isolate Termitidae
82 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
83 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
84 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
85 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
86 649989992 Pseudonocardia sp. P1 Isolate Formicidae
87 8073544309 Actinomadura sp. RB99 Isolate Termitidae
88 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
89 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
90 2820867525 Unclassified Actinobacteria Lab288P3bin128 Isolate Unclassified
91 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
92 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
93 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
94 2900368070 Nocardia aurantia RB56 Isolate Termitidae
95 2912749649 Streptomyces sp. GS7 Isolate Termitidae
96 3006461590 Streptomyces sp. RB5 Isolate Termitidae
97 3006667155 Streptomyces sp. SID9727 Isolate
98 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
99 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
100 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
101 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
102 8062747827 Yimella sp. cx-51 Isolate Cambaridae
103 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
104 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
105 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
106 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
107 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
108 2856671350 Pseudonocardia sp. Ae356_Ps1 Isolate Formicidae
109 2856947901 Pseudonocardia sp. Ae168_Ps1 Isolate Formicidae
110 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
111 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
112 2908241010 Streptomyces sp. HF10 Isolate Termitidae
113 2912817845 Streptomyces griseus SID164 Isolate
114 3006468911 Streptomyces sp. RB17 Isolate Termitidae
115 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
116 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
117 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
118 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
119 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
120 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562378_0006 3300056814 Bacteria 1902205
2 Ga0562375_3409 3300056856 Unclassified 14991
3 Ga0466715_566181 3300042616 Bacteria 5194
4 Ga0466727_214475 3300042655 Bacteria 1110
5 Ga0160452_100013 3300012834 Bacteria 343612
6 Ga0160472_100006 3300012839 Bacteria 656551
7 Ga0160448_101353 3300012854 Bacteria 7917
8 Ga0123355_10005052 3300009826 Unclassified 19215
9 Ga0160442_100203 3300012806 Unclassified 48435
10 JGI24699J35502_11112179 3300002509 Bacteria 2750
11 Ga0562379_0149 3300056790 Bacteria 210994
12 Ga0562377_0190 3300056842 Bacteria 160537
13 Ga0562377_1694 3300056842 Bacteria 20853
14 Ga0562376_0050 3300056857 Bacteria 302526
15 Ga0562376_0134 3300056857 Bacteria 164011
16 Ga0562374_0329 3300057007 Unclassified 88952
17 Ga0466730_004378 3300042625 Bacteria 8913
18 Ga0466730_023856 3300042625 Bacteria 6761
19 Ga0160448_110227 3300012854 Unclassified 1993
20 Ga0466696_439691 3300042596 Bacteria 2654
21 Ga0466707_113367 3300042601 Bacteria 1505
22 Ga0466707_130928 3300042601 Bacteria 85348
23 Ga0068302_10107190 3300005071 Bacteria 3687
24 Ga0072941_1140745 3300005201 Bacteria 17075
25 Ga0466733_037488 3300042659 Bacteria 18659
26 Ga0530661_002528 3300056564 Unclassified 6763
27 Ga0562377_0107 3300056842 Bacteria 267817
28 Ga0562377_0154 3300056842 Bacteria 196497
29 Ga0562375_0574 3300056856 Bacteria 72250
30 Ga0160432_101617 3300012818 Bacteria 6638
31 Ga0466693_175073 3300042592 Bacteria 99322
32 Ga0530661_000021 3300056564 Bacteria 209934
33 Ga0562379_0008 3300056790 Bacteria 1928858
34 Ga0562375_0051 3300056856 Bacteria 467539
35 Ga0562375_0295 3300056856 Bacteria 125606
36 Ga0562376_1630 3300056857 Unclassified 30424
37 Ga0466728_308776 3300042620 Bacteria 2351
38 Ga0466730_018932 3300042625 Bacteria 159047
39 Ga0466703_202353 3300042636 Bacteria 12100
40 Ga0466704_170151 3300042643 Bacteria 6519
41 Ga0466706_080441 3300042599 Bacteria 247551
42 Ga0466706_274816 3300042599 Bacteria 2292
43 Ga0466713_000844 3300042602 Bacteria 3302
44 Ga0466713_105765 3300042602 Bacteria 92337
45 Ga0123353_10169353 3300010167 Unclassified 3468
46 Ga0123354_10361720 3300010882 Bacteria 1278
47 Ga0466705_151903 3300042612 Bacteria 8477
48 Ga0562379_0438 3300056790 Unclassified 88173
49 Ga0562378_0226 3300056814 Bacteria 131582
50 Ga0562374_0264 3300057007 Bacteria 104081
51 Ga0466718_161486 3300042617 Bacteria 1398
52 Ga0466704_527075 3300042643 Bacteria 9478
53 Ga0466724_69064 3300042649 Bacteria 4138
54 Ga0160458_110851 3300012832 Unclassified 1013
55 Ga0160452_100590 3300012834 Bacteria 20304
56 Ga0466693_227909 3300042592 Bacteria 21993
57 Ga0123356_10065519 3300010049 Bacteria 3399
58 Ga0123356_10349912 3300010049 Bacteria 1601
59 Ga0123354_10002803 3300010882 Unclassified 23480
60 Ga0466705_034336 3300042612 Bacteria 2397
61 Ga0466733_087904 3300042659 Bacteria 11755
62 Ga0562374_0746 3300057007 Bacteria 47794
63 Ga0562374_2327 3300057007 Unclassified 17109
64 Ga0466734_092640 3300042623 Bacteria 2107
65 Ga0160457_1000295 3300012858 Bacteria 31057
66 Ga0123353_10003248 3300010167 Unclassified 20497
67 Ga0562379_0416 3300056790 Unclassified 92586
68 Ga0562375_0370 3300056856 Bacteria 100886
69 Ga0160436_1001904 3300012861 Bacteria 5514
70 Ga0466706_017132 3300042599 Bacteria 1527
71 Ga0466713_087505 3300042602 Bacteria 4153
72 Ga0466713_110872 3300042602 Bacteria 77171
73 Ga0123357_10112249 3300009784 Bacteria 3470
74 Ga0123355_10261749 3300009826 Bacteria 2418
75 Ga0123356_10000015 3300010049 Bacteria 187518
76 Ga0123354_10081620 3300010882 Bacteria 4566
77 Ga0562378_0238 3300056814 Bacteria 128710
78 Ga0562377_1161 3300056842 Bacteria 30598
79 Ga0562375_0002 3300056856 Bacteria 3523859
80 Ga0562376_0840 3300056857 Bacteria 49037
81 Ga0562374_3570 3300057007 Bacteria 7941
82 Ga0160446_100007 3300012835 Bacteria 393914
83 Ga0160436_1000941 3300012861 Unclassified 8860
84 Ga0123353_10004642 3300010167 Unclassified 17742
85 Ga0123357_10000014 3300009784 Bacteria 149146

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042655 Ga0466727_214475 Ga0466727_214475_147_1094 315
2 iso_pr_bacteria 2862075925 2862076583 323
3 3300012832 Ga0160458_110851 Ga0160458_1108511 326
4 3300042599 Ga0466706_017132 Ga0466706_017132_483_1508 341
5 3300012854 Ga0160448_101353 Ga0160448_1013538 343
6 3300012861 Ga0160436_1000941 Ga0160436_10009417 343
7 iso_pr_bacteria 2820867525 2820867567 352
8 3300010167 Ga0123353_10004642 Ga0123353_100046424 353
9 3300042592 Ga0466693_175073 Ga0466693_175073_47819_48883 354
10 3300042592 Ga0466693_227909 Ga0466693_227909_1252_2376 354
11 3300056790 Ga0562379_0416 Ga0562379_0416_26936_28057 357
12 3300042659 Ga0466733_037488 Ga0466733_037488_1693_2769 358
13 iso_pr_bacteria 2820897376 2820898815 359
14 3300056842 Ga0562377_0107 Ga0562377_0107_264466_265596 360
15 3300056857 Ga0562376_0050 Ga0562376_0050_286144_287274 360
16 3300009784 Ga0123357_10000014 Ga0123357_1000001416 361
17 3300009826 Ga0123355_10005052 Ga0123355_100050528 361
18 3300012818 Ga0160432_101617 Ga0160432_1016175 361
19 3300009826 Ga0123355_10261749 Ga0123355_102617492 362
20 3300057007 Ga0562374_0264 Ga0562374_0264_49845_50984 362
21 3300012835 Ga0160446_100007 Ga0160446_100007216 363
22 3300012854 Ga0160448_110227 Ga0160448_1102272 363
23 3300042602 Ga0466713_110872 Ga0466713_110872_30898_31989 363
24 3300010049 Ga0123356_10000015 Ga0123356_10000015157 364
25 3300012861 Ga0160436_1001904 Ga0160436_10019045 364
26 3300042602 Ga0466713_087505 Ga0466713_087505_1738_2832 364
27 3300042599 Ga0466706_274816 Ga0466706_274816_269_1369 366
28 3300042643 Ga0466704_170151 Ga0466704_170151_993_2093 366
29 3300012834 Ga0160452_100590 Ga0160452_1005909 367
30 3300042617 Ga0466718_161486 Ga0466718_161486_214_1386 367
31 3300042596 Ga0466696_439691 Ga0466696_439691_996_2102 368
32 3300042601 Ga0466707_130928 Ga0466707_130928_1808_2917 369
33 3300005071 Ga0068302_10107190 Ga0068302_101071903 370
34 3300010882 Ga0123354_10081620 Ga0123354_100816202 370
35 3300012806 Ga0160442_100203 Ga0160442_10020310 371
36 iso_pr_bacteria 2547132081 2547295299 371
37 iso_pr_bacteria 2820842553 2820844952 371
38 iso_pr_bacteria 2820849606 2820852638 371
39 iso_pr_bacteria 2820929059 2820931131 371
40 3300009784 Ga0123357_10112249 Ga0123357_101122493 372
41 3300010049 Ga0123356_10065519 Ga0123356_100655193 372
42 3300010882 Ga0123354_10002803 Ga0123354_1000280317 372
43 3300010882 Ga0123354_10361720 Ga0123354_103617201 372
44 iso_pr_bacteria 2820803007 2820804410 372
45 3300042599 Ga0466706_080441 Ga0466706_080441_18303_19424 373
46 3300056564 Ga0530661_002528 Ga0530661_002528_1664_2785 373
47 3300056790 Ga0562379_0149 Ga0562379_0149_152764_153885 373
48 3300056790 Ga0562379_0438 Ga0562379_0438_32667_33788 373
49 3300056842 Ga0562377_1694 Ga0562377_1694_14312_15433 373
50 3300056856 Ga0562375_0051 Ga0562375_0051_7761_8882 373
51 3300056857 Ga0562376_0840 Ga0562376_0840_5148_6269 373
52 3300056857 Ga0562376_1630 Ga0562376_1630_24437_25558 373
53 3300057007 Ga0562374_3570 Ga0562374_3570_5586_6707 373
54 iso_pr_bacteria 8012935351 8012938126 373
55 3300042602 Ga0466713_000844 Ga0466713_000844_1057_2184 375
56 3300042602 Ga0466713_105765 Ga0466713_105765_21791_22948 375
57 3300042612 Ga0466705_034336 Ga0466705_034336_33_1160 375
58 3300042612 Ga0466705_151903 Ga0466705_151903_3583_4710 375
59 3300042616 Ga0466715_566181 Ga0466715_566181_1124_2251 375
60 3300042636 Ga0466703_202353 Ga0466703_202353_2587_3714 375
61 3300042643 Ga0466704_527075 Ga0466704_527075_3765_4892 375
62 iso_pr_bacteria 2820926697 2820926852 375
63 3300056564 Ga0530661_000021 Ga0530661_000021_102961_104091 376
64 3300056814 Ga0562378_0006 Ga0562378_0006_1799233_1800363 376
65 3300056814 Ga0562378_0226 Ga0562378_0226_49720_50850 376
66 3300056842 Ga0562377_0190 Ga0562377_0190_65845_66975 376
67 3300056842 Ga0562377_1161 Ga0562377_1161_6681_7811 376
68 3300056856 Ga0562375_0002 Ga0562375_0002_636815_637945 376
69 3300056856 Ga0562375_3409 Ga0562375_3409_10246_11376 376
70 3300057007 Ga0562374_0329 Ga0562374_0329_54346_55476 376
71 3300057007 Ga0562374_0746 Ga0562374_0746_27241_28371 376
72 iso_pr_bacteria 2873586004 2873588276 376
73 3300042620 Ga0466728_308776 Ga0466728_308776_488_1621 377
74 3300042625 Ga0466730_004378 Ga0466730_004378_5180_6313 377
75 3300042625 Ga0466730_018932 Ga0466730_018932_76155_77288 377
76 3300056856 Ga0562375_0574 Ga0562375_0574_68588_69721 377
77 3300056857 Ga0562376_0134 Ga0562376_0134_20016_21149 377
78 iso_pr_bacteria 2515154104 2515590684 377
79 iso_pr_bacteria 2515154106 2515602848 377
80 iso_pr_bacteria 2523533511 2523592241 377
81 iso_pr_bacteria 2862784999 2862787954 377
82 iso_pr_bacteria 2873589062 2873589449 377
83 iso_pr_bacteria 2888667245 2888668246 377
84 iso_pr_bacteria 2908241010 2908245759 377
85 iso_pr_bacteria 2912817845 2912824867 377
86 iso_pr_bacteria 3006667155 3006673201 377
87 iso_pr_bacteria 647000328 647329119 377
88 iso_pr_bacteria 8046957834 8046959450 377
89 3300010167 Ga0123353_10169353 Ga0123353_101693534 378
90 3300042659 Ga0466733_087904 Ga0466733_087904_6122_7258 378
91 3300056856 Ga0562375_0295 Ga0562375_0295_28460_29629 378
92 iso_pr_bacteria 2545824723 2546570310 378
93 iso_pr_bacteria 2675903013 2676271645 378
94 iso_pr_bacteria 2731957681 2732699019 378
95 iso_pr_bacteria 2820876581 2820877234 378
96 iso_pr_bacteria 2820901319 2820901784 378
97 iso_pr_bacteria 2864773010 2864775366 378
98 iso_pr_bacteria 2864899338 2864901702 378
99 iso_pr_bacteria 2864918810 2864922179 378
100 iso_pr_bacteria 2864964650 2864967361 378
101 iso_pr_bacteria 2896955351 2896959810 378
102 iso_pr_bacteria 2900354037 2900360183 378
103 iso_pr_bacteria 2909412500 2909413003 378
104 iso_pr_bacteria 3006461590 3006468158 378
105 iso_pr_bacteria 646564587 646803899 378
106 iso_pr_bacteria 8077775691 8077779462 378
107 iso_pr_bacteria 8077783556 8077787917 378
108 iso_pr_bacteria 8109397740 8109398487 378
109 3300056842 Ga0562377_0154 Ga0562377_0154_172629_173768 379
110 3300057007 Ga0562374_2327 Ga0562374_2327_9139_10278 379
111 iso_pr_bacteria 2518645556 2518830301 379
112 iso_pr_bacteria 2856652821 2856656387 379
113 iso_pr_bacteria 2900368070 2900375565 379
114 iso_pr_bacteria 8067071256 8067078594 379
115 iso_pr_bacteria 8073544309 8073546069 379
116 3300042649 Ga0466724_69064 Ga0466724_69064_2629_3771 380
117 iso_pr_bacteria 2820825283 2820826251 380
118 iso_pr_bacteria 2848356102 2848359591 380
119 iso_pr_bacteria 2898589227 2898590907 380
120 iso_pr_bacteria 2504756063 2504977643 381
121 iso_pr_bacteria 2505679068 2505951917 381
122 iso_pr_bacteria 8062637095 8062639367 381
123 iso_pr_bacteria 8062747827 8062748544 381
124 iso_pr_bacteria 8118075156 8118079498 381
125 3300010049 Ga0123356_10349912 Ga0123356_103499121 382
126 iso_pr_bacteria 2547132042 2547183281 382
127 iso_pr_bacteria 2671180625 2673532419 382
128 iso_pr_bacteria 2675903497 2678194970 382
129 iso_pr_bacteria 2718217924 2719368903 382
130 iso_pr_bacteria 2852016966 2852020539 382
131 iso_pr_bacteria 2856671350 2856677088 382
132 iso_pr_bacteria 2856882415 2856885088 382
133 iso_pr_bacteria 2856947901 2856952062 382
134 iso_pr_bacteria 2856954254 2856956739 382
135 iso_pr_bacteria 2856960404 2856963093 382
136 iso_pr_bacteria 2856966858 2856968002 382
137 iso_pr_bacteria 2856973192 2856976282 382
138 iso_pr_bacteria 2859970369 2859971023 382
139 iso_pr_bacteria 2859977607 2859978469 382
140 iso_pr_bacteria 2863397684 2863401257 382
141 iso_pr_bacteria 2884351759 2884354987 382
142 iso_pr_bacteria 649989992 650091832 382
143 3300010167 Ga0123353_10003248 Ga0123353_1000324815 383
144 3300012839 Ga0160472_100006 Ga0160472_100006372 383
145 iso_pr_bacteria 2648501322 2649449626 384
146 iso_pr_bacteria 2883361506 2883362507 384
147 iso_pr_bacteria 3006468911 3006473593 384
148 3300012834 Ga0160452_100013 Ga0160452_100013205 385
149 3300056790 Ga0562379_0008 Ga0562379_0008_768641_769798 385
150 iso_pr_bacteria 2820914081 2820914920 385
151 iso_pr_bacteria 2873196663 2873205860 385
152 3300002509 JGI24699J35502_11112179 JGI24699J35502_111121792 386
153 3300005201 Ga0072941_1140745 Ga0072941_11407454 387
154 3300012858 Ga0160457_1000295 Ga0160457_10002958 387
155 iso_pr_bacteria 2912749649 2912756631 387
156 3300042625 Ga0466730_023856 Ga0466730_023856_3714_4880 388
157 3300056814 Ga0562378_0238 Ga0562378_0238_12713_13894 388
158 iso_pr_bacteria 2515154100 2515555357 388
159 iso_pr_bacteria 2681812870 2682012030 389
160 iso_pr_bacteria 2820820509 2820821615 393
161 iso_pr_bacteria 2820857933 2820858505 394
162 iso_pr_bacteria 2820882373 2820888739 394
163 3300056856 Ga0562375_0370 Ga0562375_0370_82433_83626 397
164 3300042623 Ga0466734_092640 Ga0466734_092640_537_1778 398
165 3300042601 Ga0466707_113367 Ga0466707_113367_161_1363 400

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF10609 ParA NUBPL iron-transfer P-loop NTPase 135 380 0.95
PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein 29 101 0.94
PF13614 AAA_31 AAA domain 136 179 0.83
PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain 139 358 0.77
PF09140 MipZ ATPase MipZ 139 207 0.65

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.