Protein Family IF05819

Metagenome Metatranscriptome Isolate
121 Members
59 Samples
103 Scaffolds
122.52 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_091590|Ga0466707_091590_7902_8345
Length
147 aa
Sequence
MTRVIAQQGFSRDAVRRVLEEGVTEMISLIDRNSERRRIHRRIRAKVVGSSERPRLCVYRSSQYIYAQIVDDSQGKTLVAASTVEKDLRGDGKGTGNIEASKIVGKAIAERAKAKGIETVVFDRGGYLYHGRVKAVAEAARESGLKF

📊 Sample Types

Isolate 14.9%
Metagenome 81.8%
MAG 0.0%
Metatranscriptome 3.3%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 43.9%
Unclassified 35.1%
Kalotermitidae 12.3%
Rhinotermitidae 3.5%
Apidae 1.8%
Passalidae 1.8%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 114
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820556368 Unclassified Firmicutes Emb289P3bin92 Isolate Unclassified
2 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
3 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
4 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
5 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
6 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
7 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
8 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
9 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
10 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
11 2820950349 Unclassified Acidobacteria Lab288P3bin89 Isolate Unclassified
12 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
15 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
16 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
17 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
18 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
19 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
22 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
23 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
24 2820451402 Unclassified Firmicutes Lab288P3bin174 Isolate Unclassified
25 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
29 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
30 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
31 3300021245 Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA Metatranscriptome Termitidae
32 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
33 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
34 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
35 2820711732 Unclassified Firmicutes Co191P1bin26 Isolate Unclassified
36 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
37 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
39 3300021231 Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA Metatranscriptome Termitidae
40 3300021232 Termite gut microbial communities from nest from French Guiana - FG16_14_4 mRNA SA Metatranscriptome
41 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
42 2820441105 Unclassified Firmicutes Lab288P3bin202 Isolate Unclassified
43 2820582954 Unclassified Firmicutes Emb289P3bin119 Isolate Unclassified
44 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
45 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
46 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
47 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
48 2820466401 Unclassified Firmicutes Lab288P3bin111 Isolate Unclassified
49 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
50 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
51 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
52 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
53 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
54 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
55 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
56 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
57 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
58 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
59 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466729_307232 3300042621 Bacteria 1305
2 Ga0466725_438088 3300042654 Bacteria 2316
3 Ga0466657_237836 3300042582 Unclassified 1543
4 Ga0123355_10002703 3300009826 Bacteria 25128
5 Ga0123356_10000862 3300010049 Bacteria 33705
6 Ga0123353_10054737 3300010167 Bacteria 6382
7 Ga0123353_10108940 3300010167 Bacteria 4463
8 Ga0123353_10171526 3300010167 Unclassified 3443
9 Ga0072941_1007162 3300005201 Bacteria 33370
10 Ga0072941_1213253 3300005201 Bacteria 5781
11 Ga0466705_445586 3300042612 Bacteria 19081
12 Ga0123357_10183998 3300009784 Bacteria 2430
13 Ga0123355_10000459 3300009826 Bacteria 53637
14 Ga0123355_10176176 3300009826 Bacteria 3184
15 Ga0123355_10298040 3300009826 Bacteria 2202
16 Ga0466706_284824 3300042599 Bacteria 3250
17 Ga0466707_244286 3300042601 Bacteria 9221
18 Ga0466707_375112 3300042601 Bacteria 17480
19 Ga0466722_163622 3300042609 Bacteria 1314
20 Ga0466734_006468 3300042623 Bacteria 11947
21 Ga0466693_291235 3300042592 Bacteria 1047
22 Ga0123355_10254859 3300009826 Bacteria 2464
23 Ga0123355_10395302 3300009826 Bacteria 1788
24 Ga0123355_11574411 3300009826 Bacteria 635
25 Ga0123356_10244836 3300010049 Bacteria 1867
26 Ga0123356_12589095 3300010049 Bacteria 635
27 Ga0123353_10950744 3300010167 Bacteria 1162
28 Ga0123353_11708507 3300010167 Bacteria 788
29 Ga0068305_10006665 3300005083 Bacteria 2741
30 Ga0466713_053517 3300042602 Bacteria 29963
31 Ga0466714_014133 3300042603 Bacteria 1059
32 Ga0466698_264987 3300042610 Bacteria 1164
33 Ga0466730_095681 3300042625 Bacteria 1471
34 Ga0223682_1075793 3300021231 Bacteria 720
35 Ga0123355_10002085 3300009826 Bacteria 28219
36 Ga0123355_10013785 3300009826 Bacteria 12596
37 Ga0123355_10124558 3300009826 Bacteria 3986
38 Ga0123355_11125152 3300009826 Unclassified 813
39 Ga0123356_10705081 3300010049 Unclassified 1178
40 Ga0123353_10001469 3300010167 Bacteria 28892
41 Ga0123353_10917210 3300010167 Bacteria 1190
42 Ga0072940_1129984 3300005200 Bacteria 2377
43 Ga0466697_076652 3300042611 Bacteria 1066
44 Ga0466713_019526 3300042602 Bacteria 2717
45 Ga0466714_041056 3300042603 Bacteria 12167
46 Ga0223676_1010014 3300021232 Bacteria 728
47 Ga0123355_10004431 3300009826 Bacteria 20424
48 Ga0123355_10024121 3300009826 Bacteria 9770
49 Ga0123355_11289926 3300009826 Bacteria 734
50 Ga0123355_11566459 3300009826 Bacteria 637
51 Ga0123356_10023435 3300010049 Bacteria 5809
52 Ga0123353_10023187 3300010167 Bacteria 9391
53 Ga0123353_10257255 3300010167 Bacteria 2699
54 Ga0072941_1232609 3300005201 Bacteria 2321
55 Ga0466710_030387 3300042613 Bacteria 1180
56 Ga0466718_164187 3300042617 Unclassified 1438
57 Ga0466728_051687 3300042620 Unclassified 2706
58 Ga0466701_101169 3300042598 Bacteria 66668
59 Ga0466700_407610 3300042600 Bacteria 3958
60 Ga0466713_052692 3300042602 Bacteria 2330
61 Ga0466703_190061 3300042636 Bacteria 90552
62 Ga0466709_418050 3300042648 Bacteria 6526
63 Ga0223682_1002744 3300021231 Bacteria 637
64 Ga0223683_1059763 3300021245 Bacteria 548
65 Ga0415639_221784 3300038395 Bacteria 1008
66 Ga0123355_10067585 3300009826 Bacteria 5750
67 Ga0123356_10013255 3300010049 Bacteria 7967
68 JGI24695J34938_10082315 3300002450 Bacteria 1328
69 JGI24700J35501_10930659 3300002508 Bacteria 17918
70 Ga0466728_062989 3300042620 Bacteria 2759
71 Ga0466728_127136 3300042620 Bacteria 23734
72 Ga0466734_055330 3300042623 Bacteria 4215
73 Ga0466704_368016 3300042643 Bacteria 2313
74 Ga0123356_10262829 3300010049 Bacteria 1811
75 Ga0123356_11034614 3300010049 Bacteria 991
76 Ga0123353_10009745 3300010167 Bacteria 13303
77 Ga0123353_10038872 3300010167 Bacteria 7484
78 Ga0123353_10577017 3300010167 Bacteria 1615
79 Ga0123353_11556735 3300010167 Bacteria 838
80 Ga0123353_12201175 3300010167 Bacteria 667
81 Ga0123353_12584805 3300010167 Bacteria 601
82 IMNBL1DRAFT_c0000103 3300000062 Bacteria 74715
83 JGI24700J35501_10857150 3300002508 Bacteria 2053
84 Ga0466705_403255 3300042612 Bacteria 37741
85 Ga0466711_322571 3300042615 Bacteria 3767
86 Ga0466723_223639 3300042618 Bacteria 19566
87 Ga0466707_091590 3300042601 Bacteria 17398
88 Ga0466725_288258 3300042654 Bacteria 2296
89 Ga0466699_285273 3300042597 Bacteria 1023
90 Ga0123355_10000566 3300009826 Bacteria 49780
91 Ga0123355_10001214 3300009826 Bacteria 35876
92 Ga0123355_10078415 3300009826 Bacteria 5278
93 Ga0123355_10385012 3300009826 Bacteria 1823
94 Ga0123355_10402691 3300009826 Bacteria 1764
95 Ga0123355_10764039 3300009826 Unclassified 1089
96 Ga0123355_10946404 3300009826 Bacteria 926
97 Ga0123356_10574431 3300010049 Bacteria 1290
98 Ga0123353_10021043 3300010167 Bacteria 9773
99 Ga0123353_10139446 3300010167 Bacteria 3886
100 Ga0123353_10867939 3300010167 Bacteria 1234
101 JGI24702J35022_10005551 3300002462 Bacteria 7357
102 JGI24700J35501_10930794 3300002508 Bacteria 24253
103 JGI24696J40584_12844029 3300002834 Bacteria 962

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_11556735 Ga0123353_115567352 109
2 3300042582 Ga0466657_237836 Ga0466657_237836_388_744 118
3 3300042654 Ga0466725_288258 Ga0466725_288258_258_614 118
4 3300042599 Ga0466706_284824 Ga0466706_284824_2689_3048 119
5 3300042613 Ga0466710_030387 Ga0466710_030387_630_989 119
6 3300042625 Ga0466730_095681 Ga0466730_095681_934_1293 119
7 3300000062 IMNBL1DRAFT_c0000103 IMNBL1DRAFT_000010331 120
8 3300010049 Ga0123356_11034614 Ga0123356_110346142 120
9 3300010167 Ga0123353_10171526 Ga0123353_101715262 120
10 3300042602 Ga0466713_052692 Ga0466713_052692_771_1133 120
11 3300042603 Ga0466714_014133 Ga0466714_014133_68_430 120
12 3300042611 Ga0466697_076652 Ga0466697_076652_630_992 120
13 3300042612 Ga0466705_403255 Ga0466705_403255_17365_17727 120
14 3300042636 Ga0466703_190061 Ga0466703_190061_75690_76052 120
15 iso_pr_bacteria 2820441105 2820441463 120
16 iso_pr_bacteria 2820556368 2820556576 120
17 3300009826 Ga0123355_10395302 Ga0123355_103953023 121
18 3300009826 Ga0123355_10946404 Ga0123355_109464042 121
19 3300010049 Ga0123356_10000862 Ga0123356_1000086231 121
20 3300010049 Ga0123356_10244836 Ga0123356_102448362 121
21 3300010049 Ga0123356_10262829 Ga0123356_102628294 121
22 3300010167 Ga0123353_10001469 Ga0123353_100014694 121
23 3300010167 Ga0123353_10021043 Ga0123353_1002104313 121
24 3300010167 Ga0123353_10139446 Ga0123353_101394462 121
25 3300010167 Ga0123353_12584805 Ga0123353_125848052 121
26 3300042618 Ga0466723_223639 Ga0466723_223639_11611_11976 121
27 3300042620 Ga0466728_051687 Ga0466728_051687_1195_1560 121
28 3300042620 Ga0466728_062989 Ga0466728_062989_1201_1566 121
29 3300042648 Ga0466709_418050 Ga0466709_418050_5135_5500 121
30 3300009826 Ga0123355_10024121 Ga0123355_100241214 122
31 3300021231 Ga0223682_1002744 Ga0223682_10027442 122
32 3300021231 Ga0223682_1075793 Ga0223682_10757932 122
33 3300021232 Ga0223676_1010014 Ga0223676_10100142 122
34 3300021245 Ga0223683_1059763 Ga0223683_10597631 122
35 3300038395 Ga0415639_221784 Ga0415639_221784_234_602 122
36 3300042592 Ga0466693_291235 Ga0466693_291235_110_478 122
37 3300042597 Ga0466699_285273 Ga0466699_285273_528_896 122
38 3300042598 Ga0466701_101169 Ga0466701_101169_19449_19817 122
39 3300042600 Ga0466700_407610 Ga0466700_407610_1264_1632 122
40 3300042601 Ga0466707_244286 Ga0466707_244286_5771_6139 122
41 3300042601 Ga0466707_375112 Ga0466707_375112_9085_9453 122
42 3300042602 Ga0466713_019526 Ga0466713_019526_1114_1482 122
43 3300042602 Ga0466713_053517 Ga0466713_053517_8978_9346 122
44 3300042603 Ga0466714_041056 Ga0466714_041056_7267_7635 122
45 3300042612 Ga0466705_445586 Ga0466705_445586_12093_12461 122
46 3300042615 Ga0466711_322571 Ga0466711_322571_375_743 122
47 3300042617 Ga0466718_164187 Ga0466718_164187_179_547 122
48 3300042623 Ga0466734_006468 Ga0466734_006468_8318_8686 122
49 3300042623 Ga0466734_055330 Ga0466734_055330_2398_2766 122
50 3300042643 Ga0466704_368016 Ga0466704_368016_714_1082 122
51 3300042654 Ga0466725_438088 Ga0466725_438088_25_393 122
52 iso_pr_bacteria 2820303403 2820305689 122
53 iso_pr_bacteria 2820309449 2820311050 122
54 iso_pr_bacteria 2820398208 2820400324 122
55 iso_pr_bacteria 2820422691 2820424057 122
56 iso_pr_bacteria 2820451402 2820452450 122
57 iso_pr_bacteria 2820459456 2820459616 122
58 iso_pr_bacteria 2820466401 2820466591 122
59 iso_pr_bacteria 2820547636 2820548034 122
60 iso_pr_bacteria 2820582954 2820583166 122
61 iso_pr_bacteria 2820602899 2820603400 122
62 iso_pr_bacteria 2820711732 2820711913 122
63 iso_pr_bacteria 2820950349 2820950710 122
64 iso_pr_bacteria 2971438493 2971439345 122
65 3300002450 JGI24695J34938_10082315 JGI24695J34938_100823153 123
66 3300002462 JGI24702J35022_10005551 JGI24702J35022_100055519 123
67 3300002508 JGI24700J35501_10857150 JGI24700J35501_108571503 123
68 3300002508 JGI24700J35501_10930659 JGI24700J35501_1093065929 123
69 3300002508 JGI24700J35501_10930794 JGI24700J35501_1093079425 123
70 3300002834 JGI24696J40584_12844029 JGI24696J40584_128440292 123
71 3300005200 Ga0072940_1129984 Ga0072940_11299844 123
72 3300005201 Ga0072941_1007162 Ga0072941_100716221 123
73 3300005201 Ga0072941_1213253 Ga0072941_12132535 123
74 3300005201 Ga0072941_1232609 Ga0072941_12326095 123
75 3300009784 Ga0123357_10183998 Ga0123357_101839985 123
76 3300009826 Ga0123355_10000459 Ga0123355_1000045951 123
77 3300009826 Ga0123355_10001214 Ga0123355_1000121418 123
78 3300009826 Ga0123355_10004431 Ga0123355_1000443121 123
79 3300009826 Ga0123355_10176176 Ga0123355_101761764 123
80 3300009826 Ga0123355_10298040 Ga0123355_102980405 123
81 3300009826 Ga0123355_11125152 Ga0123355_111251522 123
82 3300009826 Ga0123355_11566459 Ga0123355_115664591 123
83 3300009826 Ga0123355_11574411 Ga0123355_115744112 123
84 3300010049 Ga0123356_10013255 Ga0123356_1001325516 123
85 3300010049 Ga0123356_10023435 Ga0123356_100234354 123
86 3300010049 Ga0123356_10574431 Ga0123356_105744311 123
87 3300010049 Ga0123356_10705081 Ga0123356_107050812 123
88 3300010049 Ga0123356_12589095 Ga0123356_125890952 123
89 3300010167 Ga0123353_10009745 Ga0123353_1000974510 123
90 3300010167 Ga0123353_10023187 Ga0123353_1002318718 123
91 3300010167 Ga0123353_10038872 Ga0123353_100388727 123
92 3300010167 Ga0123353_10054737 Ga0123353_1005473713 123
93 3300010167 Ga0123353_10108940 Ga0123353_101089407 123
94 3300010167 Ga0123353_10257255 Ga0123353_102572555 123
95 3300010167 Ga0123353_10577017 Ga0123353_105770173 123
96 3300010167 Ga0123353_10867939 Ga0123353_108679392 123
97 3300010167 Ga0123353_10917210 Ga0123353_109172102 123
98 3300010167 Ga0123353_10950744 Ga0123353_109507442 123
99 3300010167 Ga0123353_11708507 Ga0123353_117085072 123
100 3300010167 Ga0123353_12201175 Ga0123353_122011752 123
101 3300042620 Ga0466728_127136 Ga0466728_127136_10074_10445 123
102 iso_pr_bacteria 2820513949 2820515039 123
103 iso_pr_bacteria 2820600392 2820601640 123
104 iso_pr_bacteria 2820623020 2820624360 123
105 3300005083 Ga0068305_10006665 Ga0068305_100066652 124
106 3300009826 Ga0123355_10000566 Ga0123355_1000056639 124
107 3300009826 Ga0123355_10002085 Ga0123355_1000208520 124
108 3300009826 Ga0123355_10002703 Ga0123355_100027038 124
109 3300009826 Ga0123355_10013785 Ga0123355_100137858 124
110 3300009826 Ga0123355_10067585 Ga0123355_1006758510 124
111 3300009826 Ga0123355_10078415 Ga0123355_100784155 124
112 3300009826 Ga0123355_10124558 Ga0123355_101245584 124
113 3300009826 Ga0123355_10254859 Ga0123355_102548594 124
114 3300009826 Ga0123355_10385012 Ga0123355_103850123 124
115 3300009826 Ga0123355_10764039 Ga0123355_107640393 124
116 3300009826 Ga0123355_11289926 Ga0123355_112899261 124
117 3300042610 Ga0466698_264987 Ga0466698_264987_120_494 124
118 3300042609 Ga0466722_163622 Ga0466722_163622_587_964 125
119 3300009826 Ga0123355_10402691 Ga0123355_104026911 133
120 3300042621 Ga0466729_307232 Ga0466729_307232_105_536 143
121 3300042601 Ga0466707_091590 Ga0466707_091590_7902_8345 147

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast 31 147 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.