Protein Family IF05814

Metagenome Isolate
188 Members
60 Samples
174 Scaffolds
149.51 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_081294|Ga0466707_081294_536_1066
Length
176 aa
Sequence
VRFFIEKIVPLQNPMKKIYLMENETTNQERIGLASDHAGYELKEFVRILLDKKGIPYIDYGTYSTESVNYAEYGHKLATAIETDEVCKGIAVCGSGNGINMTLNKHAAIRSALCWDEEITTLARQHNNANVLALPGRFLSLDLAEKMVDAFLNTPFEGGRHQTRIDMIPVQSSTIN

📊 Sample Types

Isolate 7.5%
Metagenome 92.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 27.6%
Kalotermitidae 24.1%
Unclassified 17.2%
Blattidae 10.3%
Rhinotermitidae 8.6%
Termopsidae 6.9%
Passalidae 3.4%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 183
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
2 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
3 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
4 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
19 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
20 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
23 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
26 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
29 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
30 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
31 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
32 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
33 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
34 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
35 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
36 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
37 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
38 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
39 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
40 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
41 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
42 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
43 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
44 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
45 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
46 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
47 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
48 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
49 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
50 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
51 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
52 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
53 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
54 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
55 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
56 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
57 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
58 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
59 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
60 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_178820 3300042659 Bacteria 3157
2 Ga0466701_015885 3300042598 Bacteria 21780
3 Ga0466707_081294 3300042601 Bacteria 2664
4 Ga0466719_192587 3300042606 Bacteria 4512
5 Ga0123354_10000304 3300010882 Bacteria 45275
6 Ga0466690_340718 3300042590 Bacteria 6390
7 Ga0466692_112723 3300042591 Bacteria 1252
8 Ga0466692_131543 3300042591 Bacteria 18183
9 Ga0466694_321259 3300042594 Bacteria 1928
10 Ga0466696_024018 3300042596 Bacteria 4351
11 Ga0466735_054398 3300042624 Bacteria 1836
12 Ga0466703_354222 3300042636 Bacteria 2475
13 Ga0466704_364403 3300042643 Bacteria 8740
14 IMNBL1DRAFT_c0030942 3300000062 Bacteria 1954
15 JGI24699J35502_11134146 3300002509 Bacteria 37464
16 Ga0466715_313220 3300042616 Bacteria 2467
17 Ga0466715_577426 3300042616 Bacteria 23723
18 Ga0466723_019514 3300042618 Bacteria 18988
19 Ga0466723_125065 3300042618 Bacteria 5490
20 Ga0466713_047571 3300042602 Bacteria 55256
21 Ga0466713_098035 3300042602 Bacteria 1365
22 Ga0466719_275937 3300042606 Bacteria 4992
23 Ga0123357_10080101 3300009784 Bacteria 4297
24 Ga0123357_10190802 3300009784 Bacteria 2362
25 Ga0123356_10609838 3300010049 Bacteria 1256
26 Ga0123354_10270559 3300010882 Bacteria 1673
27 Ga0466690_026344 3300042590 Bacteria 8824
28 Ga0466691_070467 3300042593 Bacteria 27137
29 Ga0466735_066678 3300042624 Bacteria 1436
30 Ga0466735_207707 3300042624 Bacteria 3125
31 Ga0466703_042304 3300042636 Bacteria 3162
32 Ga0466704_485980 3300042643 Bacteria 3657
33 Ga0466709_317524 3300042648 Bacteria 24158
34 Ga0466727_156594 3300042655 Bacteria 16414
35 2227625195 2225789004 Unclassified 2161
36 IMNBL1DRAFT_c0052894 3300000062 Bacteria 1269
37 JGI24702J35022_10228722 3300002462 Bacteria 1075
38 JGI24702J35022_10641450 3300002462 Bacteria 658
39 JGI24696J40584_12956209 3300002834 Bacteria 3042
40 Ga0466705_195293 3300042612 Bacteria 9820
41 Ga0466712_128976 3300042614 Bacteria 1425
42 Ga0466715_015063 3300042616 Bacteria 14765
43 Ga0466715_072985 3300042616 Bacteria 14761
44 Ga0466713_061377 3300042602 Bacteria 3194
45 Ga0466713_080452 3300042602 Bacteria 6401
46 Ga0466716_192171 3300042605 Unclassified 5293
47 Ga0123357_10122116 3300009784 Bacteria 3278
48 Ga0123356_10031295 3300010049 Bacteria 4980
49 Ga0123353_10129925 3300010167 Bacteria 4044
50 Ga0466735_098439 3300042624 Bacteria 1780
51 Ga0466727_337756 3300042655 Bacteria 3368
52 IMNBL1DRAFT_c0004404 3300000062 Bacteria 8488
53 JGI24702J35022_10002685 3300002462 Bacteria 10803
54 JGI24696J40584_12944584 3300002834 Bacteria 1818
55 Ga0105524_107082 3300007733 Bacteria 1692
56 Ga0466711_276576 3300042615 Bacteria 40894
57 Ga0466726_052749 3300042619 Bacteria 15242
58 Ga0466728_077594 3300042620 Bacteria 12127
59 Ga0466700_061727 3300042600 Bacteria 1813
60 Ga0466700_253470 3300042600 Bacteria 10880
61 Ga0466707_028892 3300042601 Bacteria 14574
62 Ga0466707_164844 3300042601 Bacteria 38674
63 Ga0466707_228637 3300042601 Bacteria 18129
64 Ga0466707_296748 3300042601 Bacteria 1634
65 Ga0466719_035507 3300042606 Bacteria 3467
66 Ga0466719_092837 3300042606 Bacteria 5518
67 Ga0466719_128512 3300042606 Bacteria 7271
68 Ga0123357_10475729 3300009784 Bacteria 1060
69 Ga0123354_10005938 3300010882 Bacteria 17964
70 Ga0123354_10037503 3300010882 Bacteria 7544
71 Ga0123354_10196051 3300010882 Bacteria 2240
72 Ga0123354_10200564 3300010882 Bacteria 2195
73 Ga0456237_0000028 3300041968 Bacteria 21979
74 Ga0466692_176840 3300042591 Bacteria 3782
75 Ga0466696_088815 3300042596 Bacteria 5607
76 Ga0466696_390997 3300042596 Bacteria 11169
77 Ga0466735_107301 3300042624 Bacteria 4068
78 Ga0466735_227342 3300042624 Bacteria 16781
79 Ga0466704_379904 3300042643 Bacteria 21264
80 Ga0466709_125562 3300042648 Bacteria 2524
81 Ga0466727_082967 3300042655 Bacteria 3607
82 IMNBL1DRAFT_c0003093 3300000062 Bacteria 10976
83 IMNBL1DRAFT_c0004037 3300000062 Unclassified 9018
84 IMNBL1DRAFT_c0008162 3300000062 Bacteria 5377
85 JGI24702J35022_10084052 3300002462 Bacteria 1727
86 JGI24699J35502_11133759 3300002509 Bacteria 14944
87 Ga0068305_10354433 3300005083 Bacteria 972
88 Ga0123357_10002953 3300009784 Bacteria 19216
89 Ga0466705_084098 3300042612 Bacteria 5230
90 Ga0466711_227310 3300042615 Bacteria 1307
91 Ga0466715_309862 3300042616 Bacteria 99913
92 Ga0466723_162153 3300042618 Bacteria 20380
93 Ga0466706_169288 3300042599 Bacteria 28222
94 Ga0466700_263454 3300042600 Bacteria 1320
95 Ga0466713_094496 3300042602 Bacteria 333875
96 Ga0466714_153533 3300042603 Bacteria 6524
97 Ga0466716_187453 3300042605 Bacteria 14311
98 Ga0466722_113613 3300042609 Bacteria 129604
99 Ga0123357_10088723 3300009784 Bacteria 4039
100 Ga0123357_10213395 3300009784 Bacteria 2162
101 Ga0123356_10661269 3300010049 Bacteria 1212
102 Ga0123354_10349861 3300010882 Bacteria 1319
103 Ga0466690_008159 3300042590 Bacteria 4273
104 Ga0466690_151487 3300042590 Bacteria 12165
105 Ga0466690_276223 3300042590 Bacteria 213056
106 Ga0466691_050459 3300042593 Bacteria 6876
107 Ga0466696_097705 3300042596 Bacteria 18993
108 Ga0466735_094761 3300042624 Bacteria 5403
109 Ga0466735_098112 3300042624 Bacteria 9495
110 Ga0466703_030263 3300042636 Bacteria 2601
111 Ga0466703_110346 3300042636 Bacteria 10941
112 Ga0466703_232448 3300042636 Bacteria 16803
113 Ga0466703_275769 3300042636 Bacteria 24178
114 Ga0466704_057862 3300042643 Bacteria 4422
115 JGI24705J35276_12234460 3300002504 Bacteria 5544
116 JGI24699J35502_11134110 3300002509 Bacteria 31696
117 JGI24696J40584_12781311 3300002834 Bacteria 837
118 Ga0068305_10002901 3300005083 Bacteria 3192
119 Ga0466723_214552 3300042618 Bacteria 46791
120 Ga0466729_189225 3300042621 Bacteria 4162
121 Ga0123357_10087136 3300009784 Unclassified 4084
122 Ga0123356_10056907 3300010049 Bacteria 3644
123 Ga0123354_10026728 3300010882 Bacteria 9102
124 Ga0466690_300684 3300042590 Bacteria 9247
125 Ga0466735_076560 3300042624 Bacteria 1719
126 Ga0466704_235481 3300042643 Unclassified 3881
127 Ga0466708_401848 3300042652 Bacteria 33683
128 JGI24699J35502_11134116 3300002509 Bacteria 32708
129 Ga0466733_075564 3300042659 Bacteria 3542
130 Ga0466705_406481 3300042612 Bacteria 3519
131 Ga0466706_232222 3300042599 Bacteria 1897
132 Ga0466707_386843 3300042601 Bacteria 4903
133 Ga0466713_075045 3300042602 Bacteria 13360
134 Ga0466722_002451 3300042609 Bacteria 3773
135 Ga0466722_178696 3300042609 Bacteria 8053
136 Ga0123356_10013227 3300010049 Bacteria 7981
137 Ga0123356_10663163 3300010049 Bacteria 1211
138 Ga0123353_10254231 3300010167 Bacteria 2719
139 Ga0123354_10016643 3300010882 Bacteria 11521
140 Ga0123354_10101927 3300010882 Bacteria 3873
141 Ga0466692_179212 3300042591 Bacteria 27849
142 Ga0466692_190832 3300042591 Bacteria 7445
143 Ga0466704_155616 3300042643 Bacteria 11209
144 Ga0466727_024077 3300042655 Bacteria 10938
145 Ga0466727_338836 3300042655 Bacteria 3941
146 2227480228 2225789004 Bacteria 4458
147 JGI24705J35276_12199851 3300002504 Bacteria 1592
148 Ga0466705_351659 3300042612 Bacteria 6669
149 Ga0466711_172335 3300042615 Bacteria 8197
150 Ga0466723_245376 3300042618 Bacteria 10412
151 Ga0466726_106548 3300042619 Bacteria 18359
152 Ga0466700_365612 3300042600 Bacteria 6498
153 Ga0466707_373803 3300042601 Bacteria 20483
154 Ga0466713_045750 3300042602 Bacteria 35229
155 Ga0466713_144564 3300042602 Bacteria 44905
156 Ga0466722_016629 3300042609 Bacteria 5853
157 Ga0123355_10131799 3300009826 Bacteria 3850
158 Ga0123353_10630518 3300010167 Bacteria 1523
159 Ga0123353_10714408 3300010167 Bacteria 1403
160 Ga0123354_10137986 3300010882 Bacteria 3036
161 Ga0123354_10302270 3300010882 Bacteria 1511
162 Ga0265387_1005799 3300024582 Bacteria 1665
163 Ga0466692_060366 3300042591 Bacteria 2577
164 Ga0466692_167512 3300042591 Bacteria 9598
165 Ga0466701_001128 3300042598 Bacteria 4040
166 Ga0466734_057558 3300042623 Bacteria 1216
167 Ga0466735_030281 3300042624 Bacteria 4076
168 Ga0466703_002530 3300042636 Bacteria 34046
169 Ga0466704_056912 3300042643 Bacteria 6299
170 Ga0466704_458285 3300042643 Bacteria 3893
171 IMNBL1DRAFT_c0011350 3300000062 Bacteria 4169
172 Ga0068302_10050637 3300005071 Bacteria 6420
173 Ga0068305_10816378 3300005083 Bacteria 2244
174 Ga0123357_10000970 3300009784 Bacteria 29214

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_235481 Ga0466704_235481_3448_3846 132
2 3300000062 IMNBL1DRAFT_c0011350 IMNBL1DRAFT_00113505 141
3 3300042598 Ga0466701_001128 Ga0466701_001128_1723_2148 141
4 3300042600 Ga0466700_253470 Ga0466700_253470_1710_2135 141
5 3300042621 Ga0466729_189225 Ga0466729_189225_3487_3912 141
6 3300042636 Ga0466703_002530 Ga0466703_002530_8336_8764 142
7 3300010049 Ga0123356_10609838 Ga0123356_106098381 143
8 3300010049 Ga0123356_10661269 Ga0123356_106612692 143
9 3300042594 Ga0466694_321259 Ga0466694_321259_148_579 143
10 3300042596 Ga0466696_024018 Ga0466696_024018_2405_2836 143
11 3300042652 Ga0466708_401848 Ga0466708_401848_24218_24649 143
12 3300042655 Ga0466727_338836 Ga0466727_338836_3260_3691 143
13 iso_pr_bacteria 2820741847 2820742398 143
14 iso_pr_bacteria 2820781750 2820782693 143
15 3300010049 Ga0123356_10013227 Ga0123356_100132278 144
16 3300010882 Ga0123354_10137986 Ga0123354_101379864 144
17 3300042590 Ga0466690_300684 Ga0466690_300684_3758_4192 144
18 3300042591 Ga0466692_112723 Ga0466692_112723_87_521 144
19 3300042591 Ga0466692_179212 Ga0466692_179212_16318_16752 144
20 3300042596 Ga0466696_097705 Ga0466696_097705_16278_16712 144
21 3300042599 Ga0466706_169288 Ga0466706_169288_15367_15801 144
22 3300042601 Ga0466707_296748 Ga0466707_296748_452_928 144
23 3300042605 Ga0466716_192171 Ga0466716_192171_1504_1956 144
24 3300042618 Ga0466723_125065 Ga0466723_125065_4933_5367 144
25 3300042618 Ga0466723_214552 Ga0466723_214552_7772_8206 144
26 3300002834 JGI24696J40584_12781311 JGI24696J40584_127813112 145
27 3300002834 JGI24696J40584_12944584 JGI24696J40584_129445842 145
28 3300009784 Ga0123357_10087136 Ga0123357_100871362 145
29 3300010049 Ga0123356_10056907 Ga0123356_100569074 145
30 3300010882 Ga0123354_10302270 Ga0123354_103022701 145
31 3300024582 Ga0265387_1005799 Ga0265387_10057991 145
32 3300042591 Ga0466692_060366 Ga0466692_060366_23_460 145
33 3300042591 Ga0466692_176840 Ga0466692_176840_2732_3169 145
34 3300042593 Ga0466691_050459 Ga0466691_050459_3581_4018 145
35 3300042596 Ga0466696_088815 Ga0466696_088815_1782_2219 145
36 3300042600 Ga0466700_061727 Ga0466700_061727_689_1126 145
37 3300042602 Ga0466713_075045 Ga0466713_075045_11468_11905 145
38 3300042602 Ga0466713_080452 Ga0466713_080452_5667_6104 145
39 3300042609 Ga0466722_113613 Ga0466722_113613_116818_117255 145
40 3300042636 Ga0466703_275769 Ga0466703_275769_19499_19936 145
41 3300042659 Ga0466733_178820 Ga0466733_178820_1577_2014 145
42 iso_pr_bacteria 2820759988 2820762068 145
43 3300000062 IMNBL1DRAFT_c0052894 IMNBL1DRAFT_00528942 146
44 3300002462 JGI24702J35022_10084052 JGI24702J35022_100840521 146
45 3300002504 JGI24705J35276_12234460 JGI24705J35276_122344602 146
46 3300002509 JGI24699J35502_11133759 JGI24699J35502_111337598 146
47 3300002509 JGI24699J35502_11134146 JGI24699J35502_111341462 146
48 3300005083 Ga0068305_10354433 Ga0068305_103544331 146
49 3300007733 Ga0105524_107082 Ga0105524_1070823 146
50 3300009784 Ga0123357_10000970 Ga0123357_1000097021 146
51 3300009784 Ga0123357_10002953 Ga0123357_100029536 146
52 3300009784 Ga0123357_10122116 Ga0123357_101221162 146
53 3300009784 Ga0123357_10190802 Ga0123357_101908022 146
54 3300009784 Ga0123357_10475729 Ga0123357_104757291 146
55 3300010049 Ga0123356_10031295 Ga0123356_100312952 146
56 3300010167 Ga0123353_10630518 Ga0123353_106305183 146
57 3300010882 Ga0123354_10000304 Ga0123354_1000030426 146
58 3300010882 Ga0123354_10005938 Ga0123354_100059387 146
59 3300010882 Ga0123354_10026728 Ga0123354_100267282 146
60 3300010882 Ga0123354_10037503 Ga0123354_100375038 146
61 3300010882 Ga0123354_10196051 Ga0123354_101960511 146
62 3300010882 Ga0123354_10270559 Ga0123354_102705592 146
63 3300042590 Ga0466690_008159 Ga0466690_008159_3555_3995 146
64 3300042601 Ga0466707_386843 Ga0466707_386843_2020_2460 146
65 3300042609 Ga0466722_178696 Ga0466722_178696_3929_4369 146
66 3300042614 Ga0466712_128976 Ga0466712_128976_790_1230 146
67 3300042616 Ga0466715_309862 Ga0466715_309862_45118_45558 146
68 3300042616 Ga0466715_313220 Ga0466715_313220_1901_2341 146
69 3300042643 Ga0466704_056912 Ga0466704_056912_2615_3055 146
70 3300042643 Ga0466704_364403 Ga0466704_364403_3349_3789 146
71 iso_pr_bacteria 2820757377 2820758779 146
72 3300002509 JGI24699J35502_11134116 JGI24699J35502_1113411622 147
73 3300010049 Ga0123356_10663163 Ga0123356_106631632 147
74 3300010167 Ga0123353_10254231 Ga0123353_102542313 147
75 3300042596 Ga0466696_390997 Ga0466696_390997_7226_7669 147
76 3300042602 Ga0466713_045750 Ga0466713_045750_3034_3477 147
77 3300042602 Ga0466713_061377 Ga0466713_061377_265_708 147
78 3300042602 Ga0466713_144564 Ga0466713_144564_298_741 147
79 3300042603 Ga0466714_153533 Ga0466714_153533_2422_2865 147
80 3300042655 Ga0466727_082967 Ga0466727_082967_1500_1943 147
81 3300005083 Ga0068305_10816378 Ga0068305_108163783 148
82 3300041968 Ga0456237_0000028 Ga0456237_0000028_11056_11502 148
83 3300042590 Ga0466690_026344 Ga0466690_026344_2773_3219 148
84 3300042600 Ga0466700_263454 Ga0466700_263454_215_661 148
85 3300042606 Ga0466719_128512 Ga0466719_128512_3471_3917 148
86 3300042616 Ga0466715_577426 Ga0466715_577426_22468_22914 148
87 3300042624 Ga0466735_094761 Ga0466735_094761_4226_4672 148
88 3300042636 Ga0466703_030263 Ga0466703_030263_741_1187 148
89 iso_pr_bacteria 2910942425 2910945062 148
90 iso_pr_bacteria 2940244548 2940245027 148
91 iso_pr_bacteria 2940248789 2940249267 148
92 iso_pr_bacteria 2940253009 2940256197 148
93 iso_pr_bacteria 2940257232 2940257233 148
94 iso_pr_bacteria 643348524 643423064 148
95 3300000062 IMNBL1DRAFT_c0003093 IMNBL1DRAFT_000309311 149
96 3300009784 Ga0123357_10213395 Ga0123357_102133953 149
97 3300010167 Ga0123353_10129925 Ga0123353_101299254 149
98 3300010882 Ga0123354_10016643 Ga0123354_100166437 149
99 3300042598 Ga0466701_015885 Ga0466701_015885_2375_2824 149
100 3300042600 Ga0466700_365612 Ga0466700_365612_4181_4630 149
101 3300042601 Ga0466707_164844 Ga0466707_164844_3051_3500 149
102 3300042602 Ga0466713_094496 Ga0466713_094496_277870_278319 149
103 3300042624 Ga0466735_054398 Ga0466735_054398_642_1091 149
104 iso_pr_bacteria 2820762746 2820764053 149
105 iso_pr_bacteria 2940216256 2940217770 149
106 3300000062 IMNBL1DRAFT_c0030942 IMNBL1DRAFT_00309423 150
107 3300002462 JGI24702J35022_10641450 JGI24702J35022_106414502 150
108 3300002509 JGI24699J35502_11134110 JGI24699J35502_1113411023 150
109 3300009784 Ga0123357_10088723 Ga0123357_100887233 150
110 3300009826 Ga0123355_10131799 Ga0123355_101317994 150
111 3300042590 Ga0466690_340718 Ga0466690_340718_2734_3186 150
112 3300042591 Ga0466692_167512 Ga0466692_167512_7324_7776 150
113 3300042599 Ga0466706_232222 Ga0466706_232222_13_465 150
114 3300042606 Ga0466719_192587 Ga0466719_192587_2029_2481 150
115 3300042612 Ga0466705_406481 Ga0466705_406481_2666_3118 150
116 3300042618 Ga0466723_019514 Ga0466723_019514_3073_3525 150
117 3300042618 Ga0466723_245376 Ga0466723_245376_1473_1925 150
118 3300042619 Ga0466726_052749 Ga0466726_052749_10505_10957 150
119 3300042624 Ga0466735_098112 Ga0466735_098112_892_1344 150
120 3300042624 Ga0466735_227342 Ga0466735_227342_15468_15920 150
121 3300042643 Ga0466704_485980 Ga0466704_485980_2018_2488 150
122 3300042659 Ga0466733_075564 Ga0466733_075564_697_1149 150
123 iso_pr_bacteria 2967483437 2967485372 150
124 3300002462 JGI24702J35022_10002685 JGI24702J35022_100026856 151
125 3300002462 JGI24702J35022_10228722 JGI24702J35022_102287222 151
126 3300002504 JGI24705J35276_12199851 JGI24705J35276_121998511 151
127 3300002834 JGI24696J40584_12956209 JGI24696J40584_129562093 151
128 3300005071 Ga0068302_10050637 Ga0068302_100506374 151
129 3300010167 Ga0123353_10714408 Ga0123353_107144082 151
130 3300042590 Ga0466690_151487 Ga0466690_151487_6732_7187 151
131 3300042605 Ga0466716_187453 Ga0466716_187453_10306_10761 151
132 3300042612 Ga0466705_195293 Ga0466705_195293_4050_4505 151
133 3300042618 Ga0466723_162153 Ga0466723_162153_3233_3688 151
134 3300042636 Ga0466703_042304 Ga0466703_042304_2349_2804 151
135 3300042636 Ga0466703_354222 Ga0466703_354222_1057_1512 151
136 3300042643 Ga0466704_057862 Ga0466704_057862_3893_4348 151
137 3300042655 Ga0466727_024077 Ga0466727_024077_679_1134 151
138 3300042655 Ga0466727_156594 Ga0466727_156594_3455_3910 151
139 iso_pr_bacteria 8100166142 8100167192 151
140 3300042601 Ga0466707_028892 Ga0466707_028892_2540_2998 152
141 3300042601 Ga0466707_228637 Ga0466707_228637_13492_13950 152
142 3300042601 Ga0466707_373803 Ga0466707_373803_6650_7108 152
143 3300042609 Ga0466722_002451 Ga0466722_002451_2554_3012 152
144 3300042616 Ga0466715_072985 Ga0466715_072985_5934_6392 152
145 3300042623 Ga0466734_057558 Ga0466734_057558_323_781 152
146 3300042624 Ga0466735_098439 Ga0466735_098439_610_1068 152
147 3300042591 Ga0466692_131543 Ga0466692_131543_14365_14826 153
148 3300042602 Ga0466713_098035 Ga0466713_098035_352_813 153
149 3300042615 Ga0466711_227310 Ga0466711_227310_40_501 153
150 3300042655 Ga0466727_337756 Ga0466727_337756_415_876 153
151 3300010882 Ga0123354_10349861 Ga0123354_103498612 154
152 3300042615 Ga0466711_172335 Ga0466711_172335_399_863 154
153 3300042615 Ga0466711_276576 Ga0466711_276576_14762_15226 154
154 3300000062 IMNBL1DRAFT_c0004404 IMNBL1DRAFT_00044042 155
155 3300000062 IMNBL1DRAFT_c0008162 IMNBL1DRAFT_00081627 155
156 3300005083 Ga0068305_10002901 Ga0068305_100029013 155
157 3300009784 Ga0123357_10080101 Ga0123357_100801014 155
158 3300010882 Ga0123354_10200564 Ga0123354_102005641 155
159 3300042590 Ga0466690_276223 Ga0466690_276223_70482_70949 155
160 3300042602 Ga0466713_047571 Ga0466713_047571_19332_19799 155
161 3300042616 Ga0466715_015063 Ga0466715_015063_3680_4147 155
162 3300042619 Ga0466726_106548 Ga0466726_106548_2195_2662 155
163 3300042624 Ga0466735_030281 Ga0466735_030281_1051_1518 155
164 3300042624 Ga0466735_076560 Ga0466735_076560_893_1360 155
165 3300042636 Ga0466703_232448 Ga0466703_232448_15613_16080 155
166 2225789004 2227625195 2228206311 156
167 3300042593 Ga0466691_070467 Ga0466691_070467_21639_22109 156
168 3300042620 Ga0466728_077594 Ga0466728_077594_5562_6032 156
169 3300042624 Ga0466735_207707 Ga0466735_207707_1645_2115 156
170 3300000062 IMNBL1DRAFT_c0004037 IMNBL1DRAFT_00040372 157
171 3300042643 Ga0466704_379904 Ga0466704_379904_14065_14538 157
172 3300042648 Ga0466709_125562 Ga0466709_125562_178_651 157
173 3300042648 Ga0466709_317524 Ga0466709_317524_14996_15469 157
174 3300042606 Ga0466719_092837 Ga0466719_092837_4888_5364 158
175 2225789004 2227480228 2227939908 159
176 3300042624 Ga0466735_107301 Ga0466735_107301_3135_3614 159
177 3300042643 Ga0466704_155616 Ga0466704_155616_6326_6805 159
178 3300042606 Ga0466719_035507 Ga0466719_035507_174_656 160
179 3300042609 Ga0466722_016629 Ga0466722_016629_4794_5276 160
180 3300042612 Ga0466705_351659 Ga0466705_351659_6078_6560 160
181 3300042624 Ga0466735_066678 Ga0466735_066678_287_769 160
182 3300010882 Ga0123354_10101927 Ga0123354_101019274 161
183 3300042612 Ga0466705_084098 Ga0466705_084098_3651_4136 161
184 3300042643 Ga0466704_458285 Ga0466704_458285_710_1195 161
185 3300042606 Ga0466719_275937 Ga0466719_275937_2265_2762 165
186 3300042591 Ga0466692_190832 Ga0466692_190832_3948_4463 171
187 3300042636 Ga0466703_110346 Ga0466703_110346_5576_6097 173
188 3300042601 Ga0466707_081294 Ga0466707_081294_536_1066 176

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02502 LacAB_rpiB Ribose/Galactose Isomerase 31 168 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.