Protein Family IF05811

Metagenome Isolate
138 Members
70 Samples
122 Scaffolds
195.91 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_076515|Ga0466707_076515_7064_7774
Length
236 aa
Sequence
LACRHLCRWRWWWIEKNFICFAKKKIIYKFALSKNKKTMAKTPQLYIISGCNGAGKTTASFTILPEILDCKEFVNADEIARGLSPFQPEKVAIEAGKIMLRRIEELLKEKTNFAIETTLASKTYKNTILSAKKNGYNITLVYFWLNSVELAKERVKTRVKEGGHNIDSEVINRRYFAGIKNLVDIYLPIVDMAMIYDNSNIKHVFVAEKEFEKNIKIIDNQIFNKILEYYDGTSKK

📊 Sample Types

Isolate 11.6%
Metagenome 88.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 27.5%
Kalotermitidae 20.3%
Blattidae 11.6%
Unclassified 8.7%
Formicidae 7.2%
Passalidae 5.8%
Culicidae 5.8%
Rhinotermitidae 4.3%
Elmidae 2.9%
Termopsidae 2.9%
Hodotermitidae 1.4%
Drosophilidae 1.4%

🌳 Taxonomy

Archaea 1
Bacteria 129
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
2 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
3 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
4 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
7 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
8 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
9 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
10 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
11 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
12 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
17 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
18 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
19 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
20 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 2922326829 Bacteroides sp. 224 Isolate Blattidae
23 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
24 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
25 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
26 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
27 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
28 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
29 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
30 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
31 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
32 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
33 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
34 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
35 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
36 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
37 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
38 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
39 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
40 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
41 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
42 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
43 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
44 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
45 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
46 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
47 2923982719 Parabacteroides sp. 52 Isolate Blattidae
48 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
49 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
50 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
51 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
52 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
53 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
54 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
55 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
56 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
57 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
58 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
59 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
60 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
61 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
62 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
63 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
64 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
65 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
66 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
67 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
68 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
69 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
70 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_041408 3300042612 Bacteria 14416
2 Ga0123356_10096428 3300010049 Bacteria 2828
3 Ga0123353_10259297 3300010167 Bacteria 2687
4 Ga0123354_10200177 3300010882 Bacteria 2198
5 IMNBGM34_c000045 3300000036 Bacteria 34859
6 JGI24696J40584_12931410 3300002834 Bacteria 1485
7 Ga0466728_083158 3300042620 Bacteria 1645
8 Ga0466706_121423 3300042599 Bacteria 8907
9 Ga0466706_179252 3300042599 Bacteria 1097
10 Ga0466706_268423 3300042599 Bacteria 4804
11 Ga0466713_077050 3300042602 Bacteria 1168
12 Ga0466731_010310 3300042622 Bacteria 1507
13 Ga0466690_150606 3300042590 Bacteria 6254
14 Ga0466733_036471 3300042659 Bacteria 12638
15 Ga0466733_162467 3300042659 Bacteria 9311
16 2227474074 2225789004 Bacteria 4734
17 CVPL010W_10001166 3300002931 Bacteria 30302
18 Ga0068305_10110809 3300005083 Bacteria 18257
19 Ga0466715_338667 3300042616 Bacteria 1222
20 Ga0466723_025566 3300042618 Bacteria 5991
21 Ga0466729_125649 3300042621 Bacteria 1329
22 Ga0466729_193841 3300042621 Bacteria 3819
23 Ga0466706_235378 3300042599 Bacteria 7023
24 Ga0466707_387850 3300042601 Bacteria 3160
25 Ga0466714_050721 3300042603 Bacteria 1701
26 Ga0466714_154171 3300042603 Bacteria 1632
27 Ga0466697_015800 3300042611 Bacteria 1322
28 Ga0466704_292184 3300042643 Bacteria 18609
29 Ga0466709_214593 3300042648 Bacteria 10045
30 Ga0466727_084888 3300042655 Bacteria 1372
31 Ga0466656_001719 3300042550 Bacteria 1052
32 Ga0466690_393445 3300042590 Bacteria 25549
33 Ga0466696_196863 3300042596 Bacteria 13125
34 Ga0123357_10393899 3300009784 Bacteria 1269
35 Ga0123356_10132696 3300010049 Bacteria 2443
36 Ga0123356_10282593 3300010049 Bacteria 1756
37 Ga0123353_10007292 3300010167 Bacteria 14907
38 Ga0123353_10364356 3300010167 Bacteria 2170
39 Ga0123353_10590622 3300010167 Bacteria 1590
40 Ga0123354_10125131 3300010882 Unclassified 3289
41 IMNBL1DRAFT_c0008751 3300000062 Bacteria 5107
42 IMNBL1DRAFT_c0019918 3300000062 Unclassified 2732
43 JGI24698J34947_10075719 3300002449 Bacteria 1599
44 Ga0104019_1005895 3300007150 Unclassified 3827
45 Ga0103267_1000392 3300007190 Bacteria 78874
46 Ga0466728_102012 3300042620 Bacteria 2019
47 Ga0466713_109686 3300042602 Bacteria 6996
48 Ga0466719_498213 3300042606 Bacteria 8798
49 Ga0466722_141086 3300042609 Bacteria 3310
50 Ga0466731_209265 3300042622 Archaea 1030
51 Ga0466735_056848 3300042624 Bacteria 3120
52 Ga0466708_213205 3300042652 Bacteria 7112
53 Ga0466656_175203 3300042550 Unclassified 1034
54 Ga0466693_228634 3300042592 Bacteria 1595
55 Ga0466701_004722 3300042598 Bacteria 1291
56 Ga0466705_147274 3300042612 Bacteria 14012
57 Ga0466733_018244 3300042659 Bacteria 41571
58 Ga0123353_10185537 3300010167 Bacteria 3289
59 Ga0123353_11234910 3300010167 Bacteria 977
60 2227035951 2225789003 Bacteria 887
61 JGI24702J35022_10076170 3300002462 Bacteria 1812
62 Ga0068305_10653294 3300005083 Unclassified 900
63 Ga0102740_1000951 3300007140 Bacteria 7772
64 Ga0466710_084195 3300042613 Bacteria 1256
65 Ga0466723_100758 3300042618 Bacteria 37867
66 Ga0466728_395146 3300042620 Bacteria 1040
67 Ga0466707_237051 3300042601 Bacteria 11862
68 Ga0466716_298958 3300042605 Bacteria 1345
69 Ga0466709_156220 3300042648 Bacteria 5745
70 Ga0466708_427078 3300042652 Bacteria 18369
71 Ga0466725_438103 3300042654 Bacteria 1585
72 Ga0466690_060068 3300042590 Bacteria 8528
73 Ga0123356_10266305 3300010049 Bacteria 1801
74 Ga0123353_10190168 3300010167 Bacteria 3241
75 IMNBL1DRAFT_c0000468 3300000062 Bacteria 33779
76 IMNBL1DRAFT_c0024038 3300000062 Bacteria 2371
77 JGI24702J35022_10056810 3300002462 Bacteria 2088
78 Ga0466713_061265 3300042602 Bacteria 21524
79 Ga0466717_249134 3300042604 Bacteria 1832
80 Ga0466716_417458 3300042605 Bacteria 20964
81 Ga0466721_108856 3300042608 Bacteria 12823
82 Ga0466722_058663 3300042609 Bacteria 2616
83 Ga0466731_089956 3300042622 Bacteria 5250
84 Ga0466703_121262 3300042636 Bacteria 12072
85 Ga0466727_332884 3300042655 Bacteria 3157
86 Ga0265387_1002997 3300024582 Bacteria 2362
87 Ga0466733_141966 3300042659 Unclassified 15450
88 Ga0123356_10018263 3300010049 Bacteria 6660
89 Ga0123356_10537215 3300010049 Bacteria 1329
90 Ga0123353_10342561 3300010167 Bacteria 2257
91 Ga0123353_10548723 3300010167 Bacteria 1668
92 JGI24705J35276_12075236 3300002504 Unclassified 962
93 Ga0068305_10209390 3300005083 Unclassified 2352
94 Ga0102734_1000097 3300007129 Bacteria 28598
95 Ga0466715_588616 3300042616 Bacteria 5488
96 Ga0466728_092626 3300042620 Bacteria 3043
97 Ga0466706_156837 3300042599 Bacteria 4582
98 Ga0466713_088803 3300042602 Bacteria 9205
99 Ga0466722_114362 3300042609 Bacteria 1412
100 Ga0466692_005895 3300042591 Bacteria 2886
101 Ga0466696_093203 3300042596 Bacteria 40523
102 Ga0466697_183473 3300042611 Bacteria 1148
103 Ga0123357_10424536 3300009784 Bacteria 1182
104 Ga0123356_10001857 3300010049 Bacteria 22879
105 2227507952 2225789004 Bacteria 69718
106 Ga0466710_043848 3300042613 Bacteria 1272
107 Ga0466707_076515 3300042601 Bacteria 11196
108 Ga0466707_215837 3300042601 Bacteria 3257
109 Ga0160448_101007 3300012854 Bacteria 9412
110 Ga0466690_051570 3300042590 Bacteria 2442
111 Ga0466733_048197 3300042659 Bacteria 1092
112 Ga0123356_10892318 3300010049 Bacteria 1060
113 Ga0103267_1000174 3300007190 Bacteria 32636
114 Ga0103268_1000206 3300007192 Bacteria 19490
115 Ga0466710_409040 3300042613 Bacteria 2276
116 Ga0466711_155252 3300042615 Bacteria 12007
117 Ga0466715_070965 3300042616 Bacteria 6493
118 Ga0466723_127056 3300042618 Bacteria 25983
119 Ga0466713_005490 3300042602 Bacteria 25065
120 Ga0466735_178212 3300042624 Bacteria 1091
121 Ga0466725_027894 3300042654 Bacteria 47713
122 Ga0466691_039793 3300042593 Bacteria 13926

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042659 Ga0466733_036471 Ga0466733_036471_4015_4515 166
2 iso_pr_bacteria 2923982719 2923984411 188
3 2225789004 2227507952 2227998270 189
4 3300010167 Ga0123353_10190168 Ga0123353_101901683 189
5 3300010882 Ga0123354_10200177 Ga0123354_102001774 189
6 3300042550 Ga0466656_175203 Ga0466656_175203_254_823 189
7 3300042608 Ga0466721_108856 Ga0466721_108856_1139_1708 189
8 3300042611 Ga0466697_183473 Ga0466697_183473_522_1091 189
9 3300042615 Ga0466711_155252 Ga0466711_155252_4269_4838 189
10 iso_pr_bacteria 2820767225 2820768590 189
11 iso_pr_bacteria 2820772500 2820773626 189
12 3300000062 IMNBL1DRAFT_c0019918 IMNBL1DRAFT_00199183 190
13 3300002462 JGI24702J35022_10076170 JGI24702J35022_100761701 190
14 3300010049 Ga0123356_10001857 Ga0123356_100018572 190
15 3300010049 Ga0123356_10096428 Ga0123356_100964284 190
16 3300010167 Ga0123353_10007292 Ga0123353_100072926 190
17 3300010167 Ga0123353_10185537 Ga0123353_101855372 190
18 3300010167 Ga0123353_10259297 Ga0123353_102592974 190
19 3300024582 Ga0265387_1002997 Ga0265387_10029972 190
20 3300042599 Ga0466706_156837 Ga0466706_156837_2836_3408 190
21 3300042601 Ga0466707_215837 Ga0466707_215837_512_1084 190
22 3300042602 Ga0466713_077050 Ga0466713_077050_349_921 190
23 3300042603 Ga0466714_050721 Ga0466714_050721_1073_1645 190
24 3300042603 Ga0466714_154171 Ga0466714_154171_522_1094 190
25 3300042622 Ga0466731_209265 Ga0466731_209265_395_967 190
26 3300042624 Ga0466735_056848 Ga0466735_056848_2042_2614 190
27 3300042624 Ga0466735_178212 Ga0466735_178212_59_631 190
28 3300042655 Ga0466727_332884 Ga0466727_332884_677_1249 190
29 3300042659 Ga0466733_018244 Ga0466733_018244_25531_26103 190
30 3300042659 Ga0466733_141966 Ga0466733_141966_12420_12992 190
31 3300010049 Ga0123356_10018263 Ga0123356_100182635 191
32 3300042590 Ga0466690_051570 Ga0466690_051570_920_1495 191
33 3300042590 Ga0466690_393445 Ga0466690_393445_19828_20403 191
34 3300042596 Ga0466696_196863 Ga0466696_196863_10483_11058 191
35 3300042605 Ga0466716_417458 Ga0466716_417458_5967_6542 191
36 3300042612 Ga0466705_147274 Ga0466705_147274_9179_9754 191
37 3300042616 Ga0466715_070965 Ga0466715_070965_2405_2980 191
38 3300042618 Ga0466723_100758 Ga0466723_100758_33581_34156 191
39 3300042618 Ga0466723_127056 Ga0466723_127056_11389_11964 191
40 3300042636 Ga0466703_121262 Ga0466703_121262_6409_6984 191
41 3300042648 Ga0466709_214593 Ga0466709_214593_7807_8382 191
42 3300042659 Ga0466733_162467 Ga0466733_162467_6692_7267 191
43 iso_pr_bacteria 2940195863 2940197195 191
44 iso_pr_bacteria 2940199050 2940202048 191
45 iso_pr_bacteria 2940202316 2940204665 191
46 iso_pr_bacteria 2940209341 2940210720 191
47 iso_pr_bacteria 2940346213 2940349073 191
48 iso_pr_bacteria 2940371297 2940373785 191
49 3300000062 IMNBL1DRAFT_c0000468 IMNBL1DRAFT_000046819 192
50 3300000062 IMNBL1DRAFT_c0008751 IMNBL1DRAFT_00087516 192
51 3300002449 JGI24698J34947_10075719 JGI24698J34947_100757191 192
52 3300002462 JGI24702J35022_10056810 JGI24702J35022_100568104 192
53 3300005083 Ga0068305_10110809 Ga0068305_1011080915 192
54 3300010049 Ga0123356_10266305 Ga0123356_102663055 192
55 3300042604 Ga0466717_249134 Ga0466717_249134_533_1111 192
56 3300002504 JGI24705J35276_12075236 JGI24705J35276_120752362 193
57 3300010049 Ga0123356_10892318 Ga0123356_108923182 193
58 3300042550 Ga0466656_001719 Ga0466656_001719_95_676 193
59 3300042602 Ga0466713_088803 Ga0466713_088803_915_1496 193
60 2225789003 2227035951 2227396651 194
61 3300005083 Ga0068305_10209390 Ga0068305_102093903 194
62 3300005083 Ga0068305_10653294 Ga0068305_106532941 194
63 3300007129 Ga0102734_1000097 Ga0102734_100009728 194
64 3300007140 Ga0102740_1000951 Ga0102740_10009512 194
65 3300007192 Ga0103268_1000206 Ga0103268_10002069 194
66 3300042599 Ga0466706_179252 Ga0466706_179252_458_1042 194
67 3300042602 Ga0466713_005490 Ga0466713_005490_4030_4614 194
68 3300042616 Ga0466715_338667 Ga0466715_338667_85_669 194
69 3300042654 Ga0466725_027894 Ga0466725_027894_11765_12349 194
70 3300000036 IMNBGM34_c000045 IMNBGM34_00004517 195
71 3300010167 Ga0123353_10548723 Ga0123353_105487233 195
72 3300042591 Ga0466692_005895 Ga0466692_005895_26_613 195
73 3300042592 Ga0466693_228634 Ga0466693_228634_539_1126 195
74 3300042596 Ga0466696_093203 Ga0466696_093203_13540_14127 195
75 3300042605 Ga0466716_298958 Ga0466716_298958_162_749 195
76 3300042606 Ga0466719_498213 Ga0466719_498213_825_1412 195
77 3300042613 Ga0466710_084195 Ga0466710_084195_411_998 195
78 3300042620 Ga0466728_083158 Ga0466728_083158_159_746 195
79 3300042620 Ga0466728_395146 Ga0466728_395146_148_735 195
80 3300042648 Ga0466709_156220 Ga0466709_156220_35_622 195
81 iso_pr_bacteria 2847090942 2847092465 195
82 iso_pr_bacteria 2922326829 2922330285 195
83 iso_pr_bacteria 8020009074 8020010311 195
84 iso_pr_bacteria 8114076984 8114079980 195
85 3300007190 Ga0103267_1000174 Ga0103267_100017434 196
86 3300010049 Ga0123356_10282593 Ga0123356_102825932 196
87 3300012854 Ga0160448_101007 Ga0160448_1010077 196
88 3300042599 Ga0466706_235378 Ga0466706_235378_1351_1941 196
89 3300042599 Ga0466706_268423 Ga0466706_268423_355_945 196
90 3300042613 Ga0466710_043848 Ga0466710_043848_351_941 196
91 3300042620 Ga0466728_102012 Ga0466728_102012_1354_1944 196
92 3300042621 Ga0466729_193841 Ga0466729_193841_3104_3694 196
93 3300042652 Ga0466708_213205 Ga0466708_213205_5807_6397 196
94 3300042652 Ga0466708_427078 Ga0466708_427078_3631_4221 196
95 3300010049 Ga0123356_10132696 Ga0123356_101326963 197
96 3300010049 Ga0123356_10537215 Ga0123356_105372151 197
97 3300010167 Ga0123353_11234910 Ga0123353_112349101 197
98 3300010882 Ga0123354_10125131 Ga0123354_101251313 197
99 3300042590 Ga0466690_060068 Ga0466690_060068_4547_5140 197
100 3300042590 Ga0466690_150606 Ga0466690_150606_4962_5555 197
101 3300042593 Ga0466691_039793 Ga0466691_039793_7217_7810 197
102 3300042613 Ga0466710_409040 Ga0466710_409040_1216_1809 197
103 3300042616 Ga0466715_588616 Ga0466715_588616_866_1459 197
104 3300042618 Ga0466723_025566 Ga0466723_025566_1875_2468 197
105 3300042622 Ga0466731_010310 Ga0466731_010310_695_1288 197
106 3300042655 Ga0466727_084888 Ga0466727_084888_216_809 197
107 3300007150 Ga0104019_1005895 Ga0104019_10058954 198
108 3300042598 Ga0466701_004722 Ga0466701_004722_534_1130 198
109 3300042601 Ga0466707_237051 Ga0466707_237051_4407_5003 198
110 3300042609 Ga0466722_058663 Ga0466722_058663_1583_2179 198
111 3300042609 Ga0466722_141086 Ga0466722_141086_1199_1795 198
112 3300042611 Ga0466697_015800 Ga0466697_015800_663_1259 198
113 3300042622 Ga0466731_089956 Ga0466731_089956_3869_4465 198
114 3300000062 IMNBL1DRAFT_c0024038 IMNBL1DRAFT_00240381 199
115 3300009784 Ga0123357_10393899 Ga0123357_103938992 199
116 3300009784 Ga0123357_10424536 Ga0123357_104245362 199
117 3300010167 Ga0123353_10364356 Ga0123353_103643562 199
118 3300042599 Ga0466706_121423 Ga0466706_121423_3042_3641 199
119 3300002834 JGI24696J40584_12931410 JGI24696J40584_129314103 200
120 iso_pr_bacteria 2820748953 2820749084 201
121 3300010167 Ga0123353_10342561 Ga0123353_103425613 202
122 3300002931 CVPL010W_10001166 CVPL010W_1000116619 205
123 3300007190 Ga0103267_1000392 Ga0103267_100039220 205
124 3300042612 Ga0466705_041408 Ga0466705_041408_9266_9886 206
125 3300042621 Ga0466729_125649 Ga0466729_125649_12_632 206
126 iso_pr_bacteria 2864878056 2864878204 207
127 iso_pr_bacteria 2864886855 2864888110 207
128 3300010167 Ga0123353_10590622 Ga0123353_105906222 209
129 3300042643 Ga0466704_292184 Ga0466704_292184_10138_10770 210
130 3300042602 Ga0466713_061265 Ga0466713_061265_19263_19901 212
131 3300042654 Ga0466725_438103 Ga0466725_438103_177_815 212
132 3300042601 Ga0466707_387850 Ga0466707_387850_1639_2280 213
133 3300042620 Ga0466728_092626 Ga0466728_092626_2258_2899 213
134 3300042659 Ga0466733_048197 Ga0466733_048197_21_680 219
135 3300042609 Ga0466722_114362 Ga0466722_114362_310_990 226
136 2225789004 2227474074 2227923658 228
137 3300042602 Ga0466713_109686 Ga0466713_109686_5953_6645 230
138 3300042601 Ga0466707_076515 Ga0466707_076515_7064_7774 236

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13671 AAA_33 AAA domain 46 172 0.82
PF06414 Zeta_toxin Zeta toxin 35 204 0.79

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.