Protein Family IF05797

Metagenome Isolate
118 Members
49 Samples
117 Scaffolds
244.25 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_056482|Ga0466707_056482_1734_2618
Length
294 aa
Sequence
MRMNEKKMNTLKAYFIEERQAKRKGGLYHKTQVNLAYNSNRIEGSRLTEEQTRYIFETRTIGFKDEEAVPVDDIIETSNHFVAFDHLIDTIDAPLSSDLMKEFHRIVKTGTSDAVKSWFKIGDWKKLPNEVGGLKTTSPQDVEAEISELDDWYNSIGEISLENIVEHHYRFEKIHPFQDGNGRVGRLLMFRECLKNDIVPFIIDDDHKQFYYRGLKGTSKKPADKASPKREKRSLQGVNEHFHARRNAVSGVFRGALKEFASVRGNLMDTCLSAQDIYAAWIDYFYPELSCKKE

📊 Sample Types

Isolate 0.8%
Metagenome 99.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 64.6%
Kalotermitidae 22.9%
Unclassified 4.2%
Passalidae 4.2%
Termopsidae 2.1%
Rhinotermitidae 2.1%

🌳 Taxonomy

Archaea 1
Bacteria 116
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
5 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
6 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
7 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
8 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
9 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
10 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
11 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
12 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
13 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
14 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
15 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
16 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
19 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
20 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
21 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
24 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
25 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
29 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
30 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
31 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
32 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
33 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
34 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
37 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
39 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
40 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
41 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
42 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
43 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
44 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
45 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
46 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
47 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
48 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
49 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_118261 3300042611 Bacteria 2306
2 Ga0466732_271471 3300042656 Bacteria 1208
3 Ga0466732_401402 3300042656 Bacteria 6806
4 Ga0466734_130224 3300042623 Bacteria 4296
5 Ga0466702_167445 3300042635 Bacteria 1359
6 Ga0466703_006460 3300042636 Bacteria 1565
7 Ga0466703_029227 3300042636 Bacteria 5466
8 Ga0466717_197002 3300042604 Bacteria 1057
9 Ga0466721_144999 3300042608 Bacteria 2112
10 Ga0466722_009915 3300042609 Bacteria 2349
11 Ga0466705_530720 3300042612 Bacteria 1062
12 Ga0466710_070012 3300042613 Bacteria 4521
13 Ga0466718_074446 3300042617 Bacteria 6838
14 Ga0123353_10369359 3300010167 Bacteria 2152
15 Ga0466657_278548 3300042582 Bacteria 2472
16 Ga0466690_427377 3300042590 Bacteria 11784
17 Ga0466696_171313 3300042596 Bacteria 12678
18 Ga0466696_183500 3300042596 Bacteria 3766
19 JGI24696J40584_12918694 3300002834 Bacteria 1324
20 Ga0123357_10000533 3300009784 Bacteria 37401
21 Ga0466700_305077 3300042600 Bacteria 4702
22 Ga0466719_116548 3300042606 Bacteria 4705
23 Ga0466711_139446 3300042615 Bacteria 6885
24 Ga0466726_005961 3300042619 Bacteria 1877
25 Ga0466728_045596 3300042620 Bacteria 30767
26 Ga0123356_11142277 3300010049 Bacteria 946
27 Ga0123353_10364270 3300010167 Bacteria 2171
28 Ga0264413_117495 3300024493 Bacteria 14541
29 Ga0415639_165885 3300038395 Bacteria 1406
30 Ga0466690_254566 3300042590 Bacteria 1443
31 IMNBL1DRAFT_c0004177 3300000062 Bacteria 8781
32 Ga0466705_103561 3300042612 Bacteria 7179
33 Ga0466732_040529 3300042656 Bacteria 2508
34 Ga0466703_056377 3300042636 Bacteria 1944
35 Ga0466725_010828 3300042654 Bacteria 7538
36 Ga0466707_320715 3300042601 Bacteria 41799
37 Ga0466723_268357 3300042618 Bacteria 7801
38 Ga0123353_10144919 3300010167 Bacteria 3799
39 Ga0123353_11115742 3300010167 Bacteria 1045
40 Ga0466657_265432 3300042582 Bacteria 4571
41 Ga0466693_155022 3300042592 Bacteria 1174
42 Ga0466693_394945 3300042592 Bacteria 1469
43 Ga0466694_170489 3300042594 Bacteria 1022
44 IMNBL1DRAFT_c0025751 3300000062 Bacteria 2250
45 Ga0466733_109357 3300042659 Bacteria 4520
46 Ga0466731_158357 3300042622 Bacteria 3792
47 Ga0466704_144721 3300042643 Bacteria 5767
48 Ga0466709_202465 3300042648 Bacteria 29781
49 Ga0466724_15204 3300042649 Bacteria 4733
50 Ga0466725_447831 3300042654 Bacteria 4671
51 Ga0466707_056482 3300042601 Bacteria 2783
52 Ga0466714_096713 3300042603 Bacteria 7149
53 Ga0466717_073496 3300042604 Bacteria 3951
54 Ga0466710_068674 3300042613 Bacteria 1249
55 Ga0466711_271276 3300042615 Bacteria 11657
56 Ga0123357_10372050 3300009784 Bacteria 1338
57 Ga0123356_10118460 3300010049 Bacteria 2571
58 Ga0123354_10095532 3300010882 Bacteria 4067
59 Ga0264413_138156 3300024493 Bacteria 1213
60 Ga0466696_423047 3300042596 Bacteria 2397
61 2227605477 2225789004 Bacteria 2301
62 IMNBL1DRAFT_c0006505 3300000062 Bacteria 6369
63 JGI24702J35022_10041683 3300002462 Bacteria 2447
64 JGI24702J35022_10295290 3300002462 Bacteria 955
65 Ga0466704_101814 3300042643 Bacteria 1804
66 Ga0466725_367642 3300042654 Bacteria 2503
67 Ga0466714_062153 3300042603 Bacteria 2212
68 Ga0466714_141402 3300042603 Bacteria 1170
69 Ga0466710_252370 3300042613 Bacteria 1560
70 Ga0466726_145381 3300042619 Bacteria 2152
71 Ga0123356_10204240 3300010049 Bacteria 2018
72 Ga0123353_10018294 3300010167 Bacteria 10354
73 Ga0123353_10034996 3300010167 Bacteria 7849
74 2227491305 2225789004 Bacteria 20466
75 JGI24705J35276_12231577 3300002504 Bacteria 3986
76 Ga0466697_165680 3300042611 Bacteria 2220
77 Ga0466705_319407 3300042612 Bacteria 3602
78 Ga0466732_298036 3300042656 Unclassified 1473
79 Ga0466734_131425 3300042623 Bacteria 3064
80 Ga0466703_001338 3300042636 Bacteria 1582
81 Ga0466704_141776 3300042643 Bacteria 1488
82 Ga0466698_244211 3300042610 Bacteria 1271
83 Ga0466698_392574 3300042610 Bacteria 1675
84 Ga0466711_229722 3300042615 Bacteria 14077
85 Ga0466726_163456 3300042619 Bacteria 3495
86 Ga0123356_10421893 3300010049 Bacteria 1476
87 Ga0123356_10565438 3300010049 Bacteria 1299
88 Ga0123353_10682553 3300010167 Bacteria 1446
89 Ga0123353_11035879 3300010167 Bacteria 1098
90 2227563493 2225789004 Bacteria 54164
91 Ga0466733_009146 3300042659 Bacteria 3266
92 Ga0466704_386188 3300042643 Bacteria 3436
93 Ga0466704_608745 3300042643 Bacteria 1968
94 Ga0466725_267380 3300042654 Bacteria 2177
95 Ga0466700_277919 3300042600 Bacteria 1817
96 Ga0466717_015395 3300042604 Bacteria 5194
97 Ga0466716_546667 3300042605 Bacteria 6260
98 Ga0466697_049739 3300042611 Bacteria 2262
99 Ga0123353_10348814 3300010167 Bacteria 2231
100 Ga0123353_10351949 3300010167 Bacteria 2219
101 Ga0123353_11092773 3300010167 Bacteria 1060
102 Ga0466656_059033 3300042550 Bacteria 1629
103 Ga0466695_013987 3300042595 Bacteria 4248
104 AustNasuHG_c1005030 3300000089 Bacteria 4730
105 Ga0466703_034794 3300042636 Bacteria 1207
106 Ga0466701_040870 3300042598 Bacteria 3285
107 Ga0466700_290087 3300042600 Bacteria 1116
108 Ga0466716_195666 3300042605 Bacteria 5997
109 Ga0466719_107181 3300042606 Bacteria 1892
110 Ga0466698_394170 3300042610 Bacteria 1345
111 Ga0264413_157320 3300024493 Bacteria 3762
112 Ga0466657_024065 3300042582 Bacteria 1574
113 Ga0466694_002914 3300042594 Bacteria 1499
114 Ga0466694_406260 3300042594 Bacteria 1045
115 IMNBL1DRAFT_c0053131 3300000062 Archaea 1264
116 JGI24702J35022_10045320 3300002462 Bacteria 2343
117 Ga0072940_1265660 3300005200 Bacteria 967

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042608 Ga0466721_144999 Ga0466721_144999_81_782 233
2 3300042619 Ga0466726_005961 Ga0466726_005961_439_1149 236
3 3300024493 Ga0264413_138156 Ga0264413_1381561 238
4 3300042596 Ga0466696_171313 Ga0466696_171313_8444_9160 238
5 3300042601 Ga0466707_320715 Ga0466707_320715_4111_4827 238
6 3300042605 Ga0466716_546667 Ga0466716_546667_946_1662 238
7 3300005200 Ga0072940_1265660 Ga0072940_12656601 239
8 3300010167 Ga0123353_10682553 Ga0123353_106825532 239
9 3300042590 Ga0466690_427377 Ga0466690_427377_1099_1818 239
10 3300042594 Ga0466694_002914 Ga0466694_002914_599_1318 239
11 3300042600 Ga0466700_277919 Ga0466700_277919_1044_1763 239
12 3300042604 Ga0466717_197002 Ga0466717_197002_192_911 239
13 3300042620 Ga0466728_045596 Ga0466728_045596_11197_11916 239
14 3300042636 Ga0466703_034794 Ga0466703_034794_88_807 239
15 3300042643 Ga0466704_386188 Ga0466704_386188_769_1488 239
16 3300010167 Ga0123353_11115742 Ga0123353_111157421 240
17 3300024493 Ga0264413_157320 Ga0264413_1573202 240
18 3300042596 Ga0466696_183500 Ga0466696_183500_1878_2600 240
19 3300042600 Ga0466700_290087 Ga0466700_290087_176_898 240
20 3300042605 Ga0466716_195666 Ga0466716_195666_5080_5802 240
21 3300042613 Ga0466710_070012 Ga0466710_070012_1986_2708 240
22 3300042659 Ga0466733_009146 Ga0466733_009146_560_1282 240
23 3300042659 Ga0466733_109357 Ga0466733_109357_1617_2339 240
24 iso_pr_bacteria 2820776227 2820776641 240
25 3300000062 IMNBL1DRAFT_c0025751 IMNBL1DRAFT_00257513 241
26 3300009784 Ga0123357_10000533 Ga0123357_1000053330 241
27 3300010049 Ga0123356_10204240 Ga0123356_102042402 241
28 3300010049 Ga0123356_10421893 Ga0123356_104218932 241
29 3300010167 Ga0123353_10018294 Ga0123353_1001829412 241
30 3300010167 Ga0123353_11092773 Ga0123353_110927732 241
31 3300024493 Ga0264413_117495 Ga0264413_1174957 241
32 3300042550 Ga0466656_059033 Ga0466656_059033_551_1276 241
33 3300042582 Ga0466657_278548 Ga0466657_278548_305_1030 241
34 3300042594 Ga0466694_170489 Ga0466694_170489_112_837 241
35 3300042598 Ga0466701_040870 Ga0466701_040870_358_1083 241
36 3300042604 Ga0466717_015395 Ga0466717_015395_2882_3607 241
37 3300042610 Ga0466698_392574 Ga0466698_392574_680_1405 241
38 3300042610 Ga0466698_394170 Ga0466698_394170_409_1134 241
39 3300042612 Ga0466705_319407 Ga0466705_319407_784_1509 241
40 3300042615 Ga0466711_271276 Ga0466711_271276_4585_5310 241
41 3300042619 Ga0466726_145381 Ga0466726_145381_146_871 241
42 3300042656 Ga0466732_271471 Ga0466732_271471_232_957 241
43 3300000089 AustNasuHG_c1005030 AustNasuHG_10050303 242
44 3300009784 Ga0123357_10372050 Ga0123357_103720502 242
45 3300010049 Ga0123356_10118460 Ga0123356_101184602 242
46 3300010049 Ga0123356_10565438 Ga0123356_105654382 242
47 3300010167 Ga0123353_10348814 Ga0123353_103488143 242
48 3300010167 Ga0123353_11035879 Ga0123353_110358792 242
49 3300010882 Ga0123354_10095532 Ga0123354_100955322 242
50 3300042594 Ga0466694_406260 Ga0466694_406260_25_753 242
51 3300042603 Ga0466714_141402 Ga0466714_141402_352_1080 242
52 3300042606 Ga0466719_116548 Ga0466719_116548_3494_4222 242
53 3300042611 Ga0466697_049739 Ga0466697_049739_1424_2152 242
54 3300042612 Ga0466705_103561 Ga0466705_103561_6206_6934 242
55 3300042612 Ga0466705_530720 Ga0466705_530720_74_802 242
56 3300042613 Ga0466710_252370 Ga0466710_252370_144_872 242
57 3300042615 Ga0466711_229722 Ga0466711_229722_13302_14030 242
58 3300042623 Ga0466734_131425 Ga0466734_131425_167_895 242
59 3300042643 Ga0466704_144721 Ga0466704_144721_3392_4120 242
60 3300042648 Ga0466709_202465 Ga0466709_202465_19930_20658 242
61 2225789004 2227491305 2227963579 243
62 2225789004 2227563493 2228102107 243
63 2225789004 2227605477 2228174180 243
64 3300000062 IMNBL1DRAFT_c0006505 IMNBL1DRAFT_00065058 243
65 3300010049 Ga0123356_11142277 Ga0123356_111422771 243
66 3300010167 Ga0123353_10369359 Ga0123353_103693591 243
67 3300042582 Ga0466657_024065 Ga0466657_024065_250_981 243
68 3300042595 Ga0466695_013987 Ga0466695_013987_3384_4115 243
69 3300042596 Ga0466696_423047 Ga0466696_423047_580_1311 243
70 3300042611 Ga0466697_118261 Ga0466697_118261_723_1454 243
71 3300042615 Ga0466711_139446 Ga0466711_139446_5510_6241 243
72 3300042643 Ga0466704_101814 Ga0466704_101814_657_1388 243
73 3300000062 IMNBL1DRAFT_c0004177 IMNBL1DRAFT_00041776 244
74 3300002462 JGI24702J35022_10295290 JGI24702J35022_102952901 244
75 3300010167 Ga0123353_10144919 Ga0123353_101449193 244
76 3300010167 Ga0123353_10351949 Ga0123353_103519494 244
77 3300042592 Ga0466693_155022 Ga0466693_155022_186_920 244
78 3300042603 Ga0466714_096713 Ga0466714_096713_1629_2363 244
79 3300042609 Ga0466722_009915 Ga0466722_009915_595_1329 244
80 3300042610 Ga0466698_244211 Ga0466698_244211_47_781 244
81 3300042619 Ga0466726_163456 Ga0466726_163456_778_1512 244
82 3300042636 Ga0466703_006460 Ga0466703_006460_368_1102 244
83 3300042643 Ga0466704_141776 Ga0466704_141776_365_1099 244
84 3300042654 Ga0466725_447831 Ga0466725_447831_3272_4006 244
85 3300042656 Ga0466732_298036 Ga0466732_298036_507_1241 244
86 3300000062 IMNBL1DRAFT_c0053131 IMNBL1DRAFT_00531312 245
87 3300002834 JGI24696J40584_12918694 JGI24696J40584_129186941 245
88 3300042582 Ga0466657_265432 Ga0466657_265432_2285_3025 246
89 3300042623 Ga0466734_130224 Ga0466734_130224_660_1400 246
90 3300042635 Ga0466702_167445 Ga0466702_167445_497_1237 246
91 3300042636 Ga0466703_001338 Ga0466703_001338_429_1169 246
92 3300042636 Ga0466703_029227 Ga0466703_029227_282_1022 246
93 3300042636 Ga0466703_056377 Ga0466703_056377_1183_1923 246
94 3300042654 Ga0466725_010828 Ga0466725_010828_1839_2579 246
95 3300042654 Ga0466725_267380 Ga0466725_267380_1210_1950 246
96 3300042656 Ga0466732_040529 Ga0466732_040529_1274_2014 246
97 3300002462 JGI24702J35022_10045320 JGI24702J35022_100453202 247
98 3300002504 JGI24705J35276_12231577 JGI24705J35276_122315776 247
99 3300010167 Ga0123353_10034996 Ga0123353_100349966 247
100 3300038395 Ga0415639_165885 Ga0415639_165885_226_969 247
101 3300042649 Ga0466724_15204 Ga0466724_15204_489_1232 247
102 3300042654 Ga0466725_367642 Ga0466725_367642_273_1016 247
103 3300042617 Ga0466718_074446 Ga0466718_074446_5518_6264 248
104 3300042618 Ga0466723_268357 Ga0466723_268357_4731_5477 248
105 3300010167 Ga0123353_10364270 Ga0123353_103642701 250
106 3300042606 Ga0466719_107181 Ga0466719_107181_976_1728 250
107 3300042643 Ga0466704_608745 Ga0466704_608745_1009_1761 250
108 3300002462 JGI24702J35022_10041683 JGI24702J35022_100416832 252
109 3300042622 Ga0466731_158357 Ga0466731_158357_273_1031 252
110 3300042600 Ga0466700_305077 Ga0466700_305077_2277_3038 253
111 3300042656 Ga0466732_401402 Ga0466732_401402_3757_4521 254
112 3300042611 Ga0466697_165680 Ga0466697_165680_1404_2171 255
113 3300042613 Ga0466710_068674 Ga0466710_068674_183_950 255
114 3300042592 Ga0466693_394945 Ga0466693_394945_391_1179 262
115 3300042603 Ga0466714_062153 Ga0466714_062153_1234_2025 263
116 3300042590 Ga0466690_254566 Ga0466690_254566_494_1288 264
117 3300042604 Ga0466717_073496 Ga0466717_073496_185_1003 272
118 3300042601 Ga0466707_056482 Ga0466707_056482_1734_2618 294

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02661 Fic Fic/DOC family 94 190 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.