Protein Family IF05771

Metagenome Isolate
159 Members
60 Samples
145 Scaffolds
432.21 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_017405|Ga0466707_017405_403_1701
Length
432 aa
Sequence
MYRKAIKQLINWKLDKNKKPLIFLGARQVGKTWLIKEFGKNEYRQMAYINFDDKNAPKNMFLQNFDIKRIITELELYSGLKITPKDTLIVFDEIQSAPQGITSLKYFNENAPEYQIIAAGSLLGINIHPGESFPVGKVNYLQLYPMSFYEFLLAMGEENGLARILAEKLWEYLPSFAEKFKEFLRYYFYIGGMPEVVSVFAQDRDWKKARKIQDDILKNYQNDFSKHAPKEILPRINMVWENIPAQLAKENKKFIYGIIKEGARAKDFELAIQWLVDAGLLHKIYSVTKPALPLVAYQYLSAFKLYLGDVGLLAAMSKLNAKTLLNGDAVFTEFKGALAEQFVYQQLLLNENLSIHYFPFENSKYELDFLIQTEDDEIIPIEVKAGENLRAKSFKFFCEKYKPNKAIRTSLTDYKQESWFENVPLYLIGSYL

📊 Sample Types

Isolate 8.8%
Metagenome 91.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 46.7%
Unclassified 25.0%
Kalotermitidae 16.7%
Termopsidae 5.0%
Passalidae 3.3%
Hodotermitidae 1.7%
Rhinotermitidae 1.7%

🌳 Taxonomy

Archaea 1
Bacteria 152
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
10 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
14 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
15 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
16 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
17 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
18 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
19 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
20 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
21 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
22 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
23 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
24 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
25 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
26 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
27 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
28 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
29 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
30 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
31 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
32 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
33 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
34 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
35 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
36 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
37 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
38 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
39 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
40 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
41 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
42 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
43 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
44 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
45 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
46 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
47 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
48 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
49 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
50 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
51 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
52 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
53 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
54 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
55 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
56 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
57 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
58 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
59 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
60 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466693_397440 3300042592 Bacteria 1424
2 Ga0466694_093738 3300042594 Bacteria 1449
3 Ga0466694_173520 3300042594 Bacteria 3622
4 Ga0466710_093842 3300042613 Bacteria 3583
5 Ga0466715_273094 3300042616 Bacteria 3636
6 Ga0466731_044447 3300042622 Bacteria 1886
7 Ga0466731_091158 3300042622 Bacteria 4181
8 Ga0466709_151099 3300042648 Bacteria 4067
9 Ga0466701_059623 3300042598 Bacteria 2162
10 Ga0466706_052254 3300042599 Bacteria 103343
11 Ga0466706_229998 3300042599 Bacteria 7022
12 Ga0466713_045334 3300042602 Bacteria 15956
13 Ga0466716_417405 3300042605 Archaea 1880
14 Ga0466719_018214 3300042606 Bacteria 1941
15 Ga0466721_135818 3300042608 Bacteria 6340
16 Ga0123355_10000235 3300009826 Bacteria 70810
17 Ga0123356_10174238 3300010049 Bacteria 2166
18 Ga0123353_10127900 3300010167 Bacteria 4080
19 Ga0123353_10234111 3300010167 Unclassified 2860
20 Ga0123354_10176764 3300010882 Bacteria 2456
21 Ga0466697_190179 3300042611 Bacteria 1998
22 Ga0466697_242644 3300042611 Bacteria 1788
23 Ga0466705_207290 3300042612 Bacteria 3078
24 Ga0466733_110948 3300042659 Bacteria 5948
25 Ga0466693_250910 3300042592 Bacteria 1720
26 Ga0466693_379176 3300042592 Bacteria 1684
27 Ga0466695_296241 3300042595 Bacteria 2222
28 Ga0466715_095350 3300042616 Bacteria 10005
29 Ga0466731_218895 3300042622 Bacteria 1921
30 Ga0466703_288990 3300042636 Bacteria 14417
31 Ga0466708_327323 3300042652 Bacteria 5655
32 Ga0466708_355809 3300042652 Bacteria 1687
33 Ga0466700_170929 3300042600 Bacteria 13271
34 Ga0466714_165118 3300042603 Bacteria 3264
35 Ga0466719_099492 3300042606 Bacteria 22617
36 Ga0466719_171633 3300042606 Bacteria 1992
37 Ga0466722_097374 3300042609 Bacteria 2597
38 Ga0123357_10012311 3300009784 Bacteria 11025
39 Ga0123353_10154292 3300010167 Bacteria 3663
40 Ga0123353_10266820 3300010167 Bacteria 2640
41 Ga0123353_10342685 3300010167 Bacteria 2257
42 2227624070 2225789004 Bacteria 2168
43 JGI24695J34938_10003676 3300002450 Bacteria 10504
44 JGI24702J35022_10008278 3300002462 Unclassified 5892
45 Ga0123357_10000567 3300009784 Bacteria 36488
46 Ga0466657_060241 3300042582 Bacteria 3624
47 Ga0466699_249172 3300042597 Bacteria 1598
48 Ga0466710_023282 3300042613 Unclassified 4030
49 Ga0466711_318083 3300042615 Bacteria 4658
50 Ga0466723_194220 3300042618 Bacteria 5980
51 Ga0466700_254672 3300042600 Bacteria 254759
52 Ga0466707_017405 3300042601 Bacteria 21356
53 Ga0466713_021144 3300042602 Bacteria 13640
54 Ga0466716_276038 3300042605 Bacteria 2635
55 Ga0466698_286629 3300042610 Bacteria 3108
56 Ga0123356_10123432 3300010049 Bacteria 2524
57 Ga0123353_10063634 3300010167 Bacteria 5916
58 2227563493 2225789004 Bacteria 54164
59 IMNBL1DRAFT_c0040487 3300000062 Bacteria 1576
60 JGI24696J40584_12960477 3300002834 Bacteria 7362
61 Ga0466693_443883 3300042592 Bacteria 1893
62 Ga0466694_123844 3300042594 Bacteria 4140
63 Ga0466726_166280 3300042619 Bacteria 2385
64 Ga0466731_057286 3300042622 Bacteria 25929
65 Ga0466735_166359 3300042624 Bacteria 1647
66 Ga0466703_122199 3300042636 Bacteria 2544
67 Ga0466709_033285 3300042648 Bacteria 1872
68 Ga0466708_466392 3300042652 Bacteria 1632
69 Ga0466727_125117 3300042655 Bacteria 15260
70 Ga0466701_023633 3300042598 Bacteria 21206
71 Ga0466707_203571 3300042601 Bacteria 51511
72 Ga0466714_111209 3300042603 Bacteria 1913
73 Ga0466717_031517 3300042604 Bacteria 3344
74 Ga0466717_219464 3300042604 Bacteria 1773
75 Ga0466698_335354 3300042610 Bacteria 1542
76 Ga0123357_10044974 3300009784 Bacteria 5992
77 2227089154 2225789004 Bacteria 9879
78 JGI24702J35022_10067196 3300002462 Bacteria 1925
79 Ga0466697_235363 3300042611 Bacteria 3187
80 Ga0466733_163995 3300042659 Bacteria 1566
81 Ga0466690_101951 3300042590 Bacteria 4966
82 Ga0466694_144355 3300042594 Bacteria 2172
83 Ga0466711_091757 3300042615 Bacteria 11740
84 Ga0466735_120505 3300042624 Bacteria 9667
85 Ga0466724_32484 3300042649 Bacteria 4908
86 Ga0466725_043009 3300042654 Bacteria 4236
87 Ga0466727_116418 3300042655 Bacteria 2731
88 Ga0466727_152394 3300042655 Bacteria 1894
89 Ga0466717_065132 3300042604 Bacteria 4299
90 Ga0123357_10091293 3300009784 Bacteria 3967
91 Ga0123357_10144231 3300009784 Bacteria 2915
92 Ga0123357_10244192 3300009784 Bacteria 1937
93 Ga0123356_10010064 3300010049 Bacteria 9299
94 Ga0123356_10046603 3300010049 Bacteria 4034
95 Ga0123356_10215008 3300010049 Bacteria 1974
96 Ga0123353_10000175 3300010167 Bacteria 81609
97 Ga0123353_10228040 3300010167 Unclassified 2906
98 Ga0123353_10536914 3300010167 Unclassified 1691
99 Ga0123354_10012147 3300010882 Bacteria 13338
100 IMNBL1DRAFT_c0027857 3300000062 Bacteria 2118
101 Ga0466697_148928 3300042611 Bacteria 1486
102 Ga0415639_030414 3300038395 Bacteria 12975
103 Ga0466710_385217 3300042613 Bacteria 2111
104 Ga0466710_435156 3300042613 Bacteria 1888
105 Ga0466715_070176 3300042616 Bacteria 53352
106 Ga0466715_318162 3300042616 Bacteria 1784
107 Ga0466700_322058 3300042600 Bacteria 12846
108 Ga0466707_397395 3300042601 Bacteria 2263
109 Ga0466714_052802 3300042603 Bacteria 11571
110 Ga0466719_275407 3300042606 Bacteria 2168
111 Ga0123357_10003885 3300009784 Bacteria 17329
112 Ga0123354_10085097 3300010882 Bacteria 4433
113 JGI24702J35022_10035715 3300002462 Unclassified 2658
114 JGI24696J40584_12960428 3300002834 Bacteria 7193
115 Ga0466697_186890 3300042611 Bacteria 2609
116 Ga0466705_270455 3300042612 Bacteria 3854
117 Ga0466733_113728 3300042659 Bacteria 3424
118 Ga0466695_032185 3300042595 Bacteria 1537
119 Ga0466710_055955 3300042613 Bacteria 11348
120 Ga0466731_423609 3300042622 Bacteria 6003
121 Ga0466701_021476 3300042598 Bacteria 1724
122 Ga0466707_043718 3300042601 Bacteria 9822
123 Ga0123357_10156088 3300009784 Bacteria 2752
124 Ga0123356_10000234 3300010049 Bacteria 64081
125 Ga0123353_10001992 3300010167 Bacteria 25232
126 2227485751 2225789004 Bacteria 21283
127 JGI24702J35022_10044075 3300002462 Bacteria 2377
128 JGI24702J35022_10108625 3300002462 Bacteria 1524
129 Ga0123357_10000530 3300009784 Bacteria 37490
130 Ga0466657_274305 3300042582 Bacteria 3351
131 Ga0466712_052605 3300042614 Bacteria 1388
132 Ga0466715_151713 3300042616 Bacteria 9966
133 Ga0466734_173777 3300042623 Bacteria 1971
134 Ga0466708_358292 3300042652 Bacteria 25849
135 Ga0466708_361052 3300042652 Bacteria 8255
136 Ga0466714_013023 3300042603 Bacteria 2511
137 Ga0466717_159827 3300042604 Bacteria 1902
138 Ga0466722_104649 3300042609 Bacteria 7087
139 Ga0466722_229738 3300042609 Bacteria 42096
140 Ga0123356_10000643 3300010049 Bacteria 38403
141 Ga0123356_10389251 3300010049 Bacteria 1529
142 IMNBL1DRAFT_c0000378 3300000062 Bacteria 38118
143 JGI24702J35022_10005536 3300002462 Bacteria 7365
144 JGI24702J35022_10020649 3300002462 Bacteria 3574
145 JGI24702J35022_10031354 3300002462 Bacteria 2849

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042614 Ga0466712_052605 Ga0466712_052605_156_1328 390
2 iso_pr_bacteria 2820772500 2820773919 394
3 3300042613 Ga0466710_385217 Ga0466710_385217_692_1885 397
4 3300042652 Ga0466708_466392 Ga0466708_466392_55_1263 402
5 3300042592 Ga0466693_397440 Ga0466693_397440_27_1241 404
6 3300042616 Ga0466715_318162 Ga0466715_318162_552_1772 406
7 3300042652 Ga0466708_361052 Ga0466708_361052_787_2067 426
8 3300042603 Ga0466714_165118 Ga0466714_165118_1726_3009 427
9 3300042597 Ga0466699_249172 Ga0466699_249172_141_1430 429
10 3300042606 Ga0466719_099492 Ga0466719_099492_700_1989 429
11 2225789004 2227563493 2228102098 430
12 3300010167 Ga0123353_10063634 Ga0123353_100636343 430
13 3300010167 Ga0123353_10127900 Ga0123353_101279002 430
14 3300010882 Ga0123354_10085097 Ga0123354_100850971 430
15 3300042592 Ga0466693_250910 Ga0466693_250910_283_1575 430
16 3300042594 Ga0466694_093738 Ga0466694_093738_20_1312 430
17 3300042594 Ga0466694_123844 Ga0466694_123844_2081_3373 430
18 3300042594 Ga0466694_144355 Ga0466694_144355_327_1619 430
19 3300042594 Ga0466694_173520 Ga0466694_173520_1944_3236 430
20 3300042599 Ga0466706_052254 Ga0466706_052254_84167_85459 430
21 3300042599 Ga0466706_229998 Ga0466706_229998_2306_3598 430
22 3300042601 Ga0466707_043718 Ga0466707_043718_223_1515 430
23 3300042601 Ga0466707_397395 Ga0466707_397395_953_2245 430
24 3300042603 Ga0466714_052802 Ga0466714_052802_6332_7624 430
25 3300042604 Ga0466717_031517 Ga0466717_031517_1950_3242 430
26 3300042604 Ga0466717_065132 Ga0466717_065132_979_2271 430
27 3300042604 Ga0466717_159827 Ga0466717_159827_149_1441 430
28 3300042605 Ga0466716_417405 Ga0466716_417405_374_1666 430
29 3300042606 Ga0466719_171633 Ga0466719_171633_513_1805 430
30 3300042611 Ga0466697_190179 Ga0466697_190179_269_1561 430
31 3300042613 Ga0466710_055955 Ga0466710_055955_4709_6001 430
32 3300042613 Ga0466710_093842 Ga0466710_093842_1805_3097 430
33 3300042616 Ga0466715_095350 Ga0466715_095350_6927_8219 430
34 3300042622 Ga0466731_057286 Ga0466731_057286_985_2277 430
35 3300042622 Ga0466731_423609 Ga0466731_423609_887_2179 430
36 3300042624 Ga0466735_166359 Ga0466735_166359_78_1370 430
37 3300042659 Ga0466733_113728 Ga0466733_113728_1520_2812 430
38 iso_pr_bacteria 2820740053 2820740160 430
39 iso_pr_bacteria 2820741847 2820744460 430
40 iso_pr_bacteria 2820753519 2820753828 430
41 iso_pr_bacteria 2820755292 2820756691 430
42 iso_pr_bacteria 2820778767 2820779498 430
43 iso_pr_bacteria 2820797595 2820798473 430
44 iso_pr_bacteria 2820797595 2820798476 430
45 iso_pr_bacteria 2967483437 2967483909 430
46 3300002450 JGI24695J34938_10003676 JGI24695J34938_100036768 431
47 3300002462 JGI24702J35022_10008278 JGI24702J35022_100082782 431
48 3300002462 JGI24702J35022_10044075 JGI24702J35022_100440751 431
49 3300002834 JGI24696J40584_12960428 JGI24696J40584_129604286 431
50 3300002834 JGI24696J40584_12960477 JGI24696J40584_129604776 431
51 3300009784 Ga0123357_10000567 Ga0123357_100005677 431
52 3300010049 Ga0123356_10046603 Ga0123356_100466033 431
53 3300010049 Ga0123356_10174238 Ga0123356_101742382 431
54 3300010167 Ga0123353_10228040 Ga0123353_102280401 431
55 3300010167 Ga0123353_10266820 Ga0123353_102668202 431
56 3300010167 Ga0123353_10536914 Ga0123353_105369141 431
57 3300042582 Ga0466657_274305 Ga0466657_274305_1107_2402 431
58 3300042592 Ga0466693_443883 Ga0466693_443883_584_1879 431
59 3300042602 Ga0466713_045334 Ga0466713_045334_5186_6481 431
60 3300042612 Ga0466705_207290 Ga0466705_207290_1561_2856 431
61 3300042616 Ga0466715_151713 Ga0466715_151713_7150_8445 431
62 3300042622 Ga0466731_091158 Ga0466731_091158_336_1631 431
63 3300042623 Ga0466734_173777 Ga0466734_173777_528_1823 431
64 3300042649 Ga0466724_32484 Ga0466724_32484_3339_4634 431
65 3300042652 Ga0466708_327323 Ga0466708_327323_3907_5202 431
66 3300042652 Ga0466708_358292 Ga0466708_358292_12741_14036 431
67 iso_pr_bacteria 2820789850 2820790609 431
68 3300000062 IMNBL1DRAFT_c0040487 IMNBL1DRAFT_00404872 432
69 3300002462 JGI24702J35022_10035715 JGI24702J35022_100357154 432
70 3300009784 Ga0123357_10012311 Ga0123357_100123112 432
71 3300009784 Ga0123357_10144231 Ga0123357_101442313 432
72 3300010049 Ga0123356_10123432 Ga0123356_101234322 432
73 3300010049 Ga0123356_10215008 Ga0123356_102150082 432
74 3300010167 Ga0123353_10342685 Ga0123353_103426852 432
75 3300042595 Ga0466695_296241 Ga0466695_296241_587_1885 432
76 3300042598 Ga0466701_059623 Ga0466701_059623_654_1952 432
77 3300042600 Ga0466700_170929 Ga0466700_170929_5911_7209 432
78 3300042601 Ga0466707_017405 Ga0466707_017405_403_1701 432
79 3300042606 Ga0466719_275407 Ga0466719_275407_859_2157 432
80 3300042609 Ga0466722_097374 Ga0466722_097374_501_1799 432
81 3300042609 Ga0466722_229738 Ga0466722_229738_447_1745 432
82 3300042613 Ga0466710_023282 Ga0466710_023282_2660_3958 432
83 3300042616 Ga0466715_070176 Ga0466715_070176_21113_22411 432
84 3300042616 Ga0466715_273094 Ga0466715_273094_1996_3294 432
85 3300042619 Ga0466726_166280 Ga0466726_166280_241_1539 432
86 3300042622 Ga0466731_218895 Ga0466731_218895_65_1363 432
87 3300042655 Ga0466727_152394 Ga0466727_152394_264_1562 432
88 iso_pr_bacteria 2820744581 2820746084 432
89 3300002462 JGI24702J35022_10020649 JGI24702J35022_100206492 433
90 3300002462 JGI24702J35022_10108625 JGI24702J35022_101086251 433
91 3300009784 Ga0123357_10044974 Ga0123357_100449747 433
92 3300010167 Ga0123353_10154292 Ga0123353_101542924 433
93 3300042582 Ga0466657_060241 Ga0466657_060241_323_1624 433
94 3300042600 Ga0466700_254672 Ga0466700_254672_84926_86227 433
95 3300042609 Ga0466722_104649 Ga0466722_104649_5591_6892 433
96 3300042611 Ga0466697_186890 Ga0466697_186890_72_1373 433
97 3300042612 Ga0466705_270455 Ga0466705_270455_525_1826 433
98 3300042618 Ga0466723_194220 Ga0466723_194220_475_1776 433
99 3300042622 Ga0466731_044447 Ga0466731_044447_466_1767 433
100 3300009784 Ga0123357_10003885 Ga0123357_100038857 434
101 3300009784 Ga0123357_10156088 Ga0123357_101560882 434
102 3300010049 Ga0123356_10000234 Ga0123356_100002341 434
103 3300010167 Ga0123353_10001992 Ga0123353_1000199218 434
104 3300038395 Ga0415639_030414 Ga0415639_030414_1851_3155 434
105 3300042592 Ga0466693_379176 Ga0466693_379176_60_1364 434
106 3300042601 Ga0466707_203571 Ga0466707_203571_28470_29774 434
107 3300042608 Ga0466721_135818 Ga0466721_135818_4034_5338 434
108 3300042610 Ga0466698_286629 Ga0466698_286629_1503_2807 434
109 3300042611 Ga0466697_242644 Ga0466697_242644_196_1500 434
110 3300042615 Ga0466711_318083 Ga0466711_318083_729_2033 434
111 iso_pr_bacteria 2820770630 2820771355 434
112 2225789004 2227089154 2227467350 435
113 2225789004 2227485751 2227951648 435
114 3300000062 IMNBL1DRAFT_c0000378 IMNBL1DRAFT_000037834 435
115 3300009784 Ga0123357_10244192 Ga0123357_102441923 435
116 3300010049 Ga0123356_10389251 Ga0123356_103892511 435
117 3300010167 Ga0123353_10000175 Ga0123353_100001754 435
118 3300042595 Ga0466695_032185 Ga0466695_032185_60_1367 435
119 3300042603 Ga0466714_013023 Ga0466714_013023_246_1553 435
120 3300042611 Ga0466697_148928 Ga0466697_148928_117_1424 435
121 3300042624 Ga0466735_120505 Ga0466735_120505_4266_5573 435
122 3300042636 Ga0466703_288990 Ga0466703_288990_10483_11790 435
123 iso_pr_bacteria 2820785563 2820786153 435
124 3300000062 IMNBL1DRAFT_c0027857 IMNBL1DRAFT_00278573 436
125 3300002462 JGI24702J35022_10005536 JGI24702J35022_100055361 436
126 3300009826 Ga0123355_10000235 Ga0123355_1000023519 436
127 3300010167 Ga0123353_10234111 Ga0123353_102341113 436
128 3300010882 Ga0123354_10012147 Ga0123354_1001214712 436
129 3300042598 Ga0466701_023633 Ga0466701_023633_18964_20274 436
130 3300042603 Ga0466714_111209 Ga0466714_111209_303_1613 436
131 3300042611 Ga0466697_235363 Ga0466697_235363_1574_2884 436
132 3300042613 Ga0466710_435156 Ga0466710_435156_77_1387 436
133 3300042655 Ga0466727_116418 Ga0466727_116418_973_2283 436
134 3300002462 JGI24702J35022_10067196 JGI24702J35022_100671962 437
135 3300009784 Ga0123357_10000530 Ga0123357_1000053020 437
136 3300010049 Ga0123356_10000643 Ga0123356_1000064326 437
137 3300042598 Ga0466701_021476 Ga0466701_021476_118_1431 437
138 3300042600 Ga0466700_322058 Ga0466700_322058_9987_11300 437
139 3300042602 Ga0466713_021144 Ga0466713_021144_9452_10765 437
140 3300042606 Ga0466719_018214 Ga0466719_018214_119_1432 437
141 3300002462 JGI24702J35022_10031354 JGI24702J35022_100313543 438
142 3300042615 Ga0466711_091757 Ga0466711_091757_1820_3136 438
143 3300042652 Ga0466708_355809 Ga0466708_355809_59_1375 438
144 3300042659 Ga0466733_163995 Ga0466733_163995_111_1427 438
145 2225789004 2227624070 2228204420 439
146 3300009784 Ga0123357_10091293 Ga0123357_100912933 439
147 3300042605 Ga0466716_276038 Ga0466716_276038_141_1460 439
148 3300042654 Ga0466725_043009 Ga0466725_043009_2283_3602 439
149 3300042610 Ga0466698_335354 Ga0466698_335354_12_1334 440
150 iso_pr_bacteria 2820781750 2820782599 440
151 3300010049 Ga0123356_10010064 Ga0123356_100100647 441
152 3300010882 Ga0123354_10176764 Ga0123354_101767642 442
153 3300042590 Ga0466690_101951 Ga0466690_101951_3321_4649 442
154 3300042636 Ga0466703_122199 Ga0466703_122199_1011_2339 442
155 3300042648 Ga0466709_151099 Ga0466709_151099_112_1440 442
156 3300042604 Ga0466717_219464 Ga0466717_219464_218_1549 443
157 3300042655 Ga0466727_125117 Ga0466727_125117_8648_9979 443
158 3300042648 Ga0466709_033285 Ga0466709_033285_472_1824 450
159 3300042659 Ga0466733_110948 Ga0466733_110948_2893_4305 470

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13635 DUF4143 Domain of unknown function (DUF4143) 221 386 0.98
PF13173 AAA_14 AAA domain 18 152 0.9

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.