Protein Family IF05754
Metagenome
Isolate
324
Members
147
Samples
258
Scaffolds
194.8
Avg Length
Representative Sequence
- ID
- 3300042600|Ga0466700_419351|Ga0466700_419351_12446_13138
- Length
- 230 aa
- Sequence
- MTLTNKYKYDICCFIDFLILLQRNKIDRYRNIMNHFSENQLFNPAKTGTIEVICGSMFSGKTEELIRRMKRAQFAKQQVEIFKPAMDTRYSDESIVSHDQNEIPCTPVENSGNILLLSAERDVIGIDEAQFFDEGLPAICNQLANQGIRVIVAGLDMDYKGNPFGPMPALCAIADDITKVHAICVECGQLAGYSHRLVHNDRLVLLGEKEEYQPLCRRCFQRKQGEGVIS
Sample Types
Isolate
20.4%
Metagenome
79.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
21.0%
Unclassified
18.1%
Kalotermitidae
10.1%
Culicidae
7.2%
Elmidae
6.5%
Drosophilidae
5.1%
Formicidae
5.1%
Apidae
4.3%
Blattidae
4.3%
Rhinotermitidae
2.9%
Hydrophilidae
2.2%
Armadillidiidae
2.2%
Passalidae
2.2%
Termopsidae
2.2%
Daphniidae
1.4%
Tenebrionidae
1.4%
Cambaridae
1.4%
Syrphidae
0.7%
Hodotermitidae
0.7%
Ixodidae
0.7%
Taxonomy
Archaea
0
Bacteria
301
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 2 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 3 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 4 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 5 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 10 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 11 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 12 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 13 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 14 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 15 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 16 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 17 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 20 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 21 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 22 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 23 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 24 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 25 | 2554235371 | Spiroplasma chrysopicola DF-1 | Isolate | Unclassified |
| 26 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 27 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 28 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 29 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 33 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 34 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 35 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 36 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 37 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 38 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 39 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 40 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 41 | 8100317081 | Spiroplasma sp. Moj | Isolate | Drosophilidae |
| 42 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 43 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 44 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 45 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 46 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 47 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 48 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 49 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 50 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 51 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 52 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 53 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 54 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 55 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 56 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 57 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 58 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 59 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 60 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 61 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 62 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 63 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 64 | 2806310699 | Spiroplasma melliferum KC3 | Isolate | Unclassified |
| 65 | 8100315503 | Spiroplasma sp. hyd1 | Isolate | Drosophilidae |
| 66 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 67 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 68 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 69 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 70 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 71 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 72 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 73 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 74 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 75 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 76 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 77 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 78 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 79 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 80 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 81 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 82 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 83 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 84 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 85 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 86 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 87 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 88 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 89 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 90 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 91 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 92 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 93 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 94 | 2541047151 | Spiroplasma melliferum IPMB4A | Isolate | Apidae |
| 95 | 2554235381 | Spiroplasma syrphidicola EA-1 | Isolate | Syrphidae |
| 96 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 97 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 98 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 99 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 100 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 101 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 102 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 103 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 104 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 105 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 106 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 107 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 108 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 109 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 110 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 111 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 112 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 113 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 114 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 115 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 116 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 117 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 118 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 119 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 120 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 121 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 122 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 123 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 124 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 125 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 126 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 127 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 128 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 129 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 130 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 131 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 132 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 133 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 134 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 135 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 136 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 137 | 2558860251 | Spiroplasma mirum SMCA | Isolate | Ixodidae |
| 138 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 139 | 8076013101 | Spiroplasma poulsonii sHy/REF | Isolate | Drosophilidae |
| 140 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 141 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 142 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 143 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 144 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 145 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 146 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 147 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 2 | Ga0466703_174868 | 3300042636 | Bacteria | 20647 |
| 3 | Ga0466724_56165 | 3300042649 | Bacteria | 3545 |
| 4 | Ga0466724_60944 | 3300042649 | Unclassified | 49948 |
| 5 | 2227275235 | 2225789004 | Bacteria | 30275 |
| 6 | IMNBL1DRAFT_c0014849 | 3300000062 | Bacteria | 3410 |
| 7 | IMNBL1DRAFT_c0026398 | 3300000062 | Bacteria | 2206 |
| 8 | Meta3P_1003007 | 3300002464 | Bacteria | 22763 |
| 9 | Ga0103264_1000064 | 3300007188 | Bacteria | 124097 |
| 10 | Ga0466690_162531 | 3300042590 | Bacteria | 19605 |
| 11 | Ga0466694_375417 | 3300042594 | Bacteria | 7714 |
| 12 | Ga0466695_380168 | 3300042595 | Bacteria | 1111 |
| 13 | Ga0123357_10019221 | 3300009784 | Unclassified | 9097 |
| 14 | Ga0123356_10001463 | 3300010049 | Bacteria | 26026 |
| 15 | Ga0123356_10188083 | 3300010049 | Bacteria | 2093 |
| 16 | Ga0123353_10166315 | 3300010167 | Bacteria | 3505 |
| 17 | Ga0123353_10948742 | 3300010167 | Bacteria | 1164 |
| 18 | Ga0466701_028947 | 3300042598 | Bacteria | 44242 |
| 19 | Ga0466701_035921 | 3300042598 | Bacteria | 2099 |
| 20 | Ga0466701_075478 | 3300042598 | Bacteria | 63169 |
| 21 | Ga0466706_286876 | 3300042599 | Unclassified | 6665 |
| 22 | Ga0466707_244909 | 3300042601 | Bacteria | 19983 |
| 23 | Ga0466707_252281 | 3300042601 | Bacteria | 31745 |
| 24 | Ga0466713_006207 | 3300042602 | Bacteria | 30471 |
| 25 | Ga0466713_099518 | 3300042602 | Bacteria | 11417 |
| 26 | Ga0466704_228061 | 3300042643 | Bacteria | 1466 |
| 27 | Ga0466709_161150 | 3300042648 | Bacteria | 3023 |
| 28 | Ga0466727_127654 | 3300042655 | Bacteria | 16726 |
| 29 | JGI24696J40584_12950308 | 3300002834 | Bacteria | 2140 |
| 30 | Ga0074308_1116196 | 3300005307 | Unclassified | 1195 |
| 31 | Ga0103265_1000001 | 3300007068 | Bacteria | 182519 |
| 32 | Ga0103267_1000345 | 3300007190 | Bacteria | 16085 |
| 33 | Ga0466711_264853 | 3300042615 | Bacteria | 1718 |
| 34 | Ga0466718_078939 | 3300042617 | Bacteria | 1552 |
| 35 | Ga0466657_398260 | 3300042582 | Bacteria | 14596 |
| 36 | Ga0466692_084653 | 3300042591 | Bacteria | 16158 |
| 37 | Ga0466694_061481 | 3300042594 | Bacteria | 40983 |
| 38 | Ga0466699_257936 | 3300042597 | Bacteria | 2274 |
| 39 | Ga0123357_10012959 | 3300009784 | Bacteria | 10778 |
| 40 | Ga0123357_10052006 | 3300009784 | Bacteria | 5533 |
| 41 | Ga0123353_10000528 | 3300010167 | Bacteria | 47327 |
| 42 | Ga0123353_10466668 | 3300010167 | Bacteria | 1853 |
| 43 | Ga0466706_032867 | 3300042599 | Bacteria | 71416 |
| 44 | Ga0466706_172865 | 3300042599 | Bacteria | 71053 |
| 45 | Ga0466706_191057 | 3300042599 | Bacteria | 1733 |
| 46 | Ga0466706_281392 | 3300042599 | Bacteria | 3420 |
| 47 | Ga0466700_303542 | 3300042600 | Bacteria | 18342 |
| 48 | Ga0466713_013156 | 3300042602 | Bacteria | 2300 |
| 49 | Ga0466713_111742 | 3300042602 | Bacteria | 33326 |
| 50 | Ga0466722_177930 | 3300042609 | Bacteria | 5579 |
| 51 | Ga0466735_019003 | 3300042624 | Bacteria | 2380 |
| 52 | Ga0466735_145310 | 3300042624 | Bacteria | 1785 |
| 53 | Ga0466703_370626 | 3300042636 | Bacteria | 1504 |
| 54 | Ga0466724_28958 | 3300042649 | Unclassified | 7094 |
| 55 | IMNBL1DRAFT_c0009268 | 3300000062 | Bacteria | 4881 |
| 56 | JGI24702J35022_10026621 | 3300002462 | Bacteria | 3114 |
| 57 | JGI24702J35022_10115934 | 3300002462 | Bacteria | 1476 |
| 58 | JGI24699J35502_11134119 | 3300002509 | Bacteria | 33315 |
| 59 | JGI24696J40584_12888302 | 3300002834 | Unclassified | 1117 |
| 60 | Ga0102736_1000793 | 3300007052 | Bacteria | 6595 |
| 61 | Ga0104045_1075146 | 3300007085 | Bacteria | 2162 |
| 62 | Ga0104041_1000691 | 3300007106 | Unclassified | 4605 |
| 63 | Ga0466710_106444 | 3300042613 | Bacteria | 8565 |
| 64 | Ga0466726_160838 | 3300042619 | Bacteria | 5380 |
| 65 | Ga0160441_100077 | 3300012825 | Bacteria | 120763 |
| 66 | Ga0160472_102652 | 3300012839 | Unclassified | 3923 |
| 67 | Ga0160460_100029 | 3300012845 | Bacteria | 324685 |
| 68 | Ga0466693_112230 | 3300042592 | Bacteria | 1092 |
| 69 | Ga0466691_002343 | 3300042593 | Bacteria | 2238 |
| 70 | Ga0466696_277581 | 3300042596 | Bacteria | 21940 |
| 71 | Ga0123356_10387765 | 3300010049 | Bacteria | 1531 |
| 72 | Ga0123353_10007052 | 3300010167 | Bacteria | 15115 |
| 73 | Ga0123353_10458598 | 3300010167 | Bacteria | 1874 |
| 74 | Ga0123353_10559107 | 3300010167 | Bacteria | 1648 |
| 75 | Ga0123353_11607419 | 3300010167 | Bacteria | 820 |
| 76 | Ga0123354_10000043 | 3300010882 | Bacteria | 94179 |
| 77 | Ga0466706_054763 | 3300042599 | Bacteria | 1999 |
| 78 | Ga0466713_007739 | 3300042602 | Bacteria | 4886 |
| 79 | Ga0466713_056151 | 3300042602 | Bacteria | 40882 |
| 80 | Ga0466713_058747 | 3300042602 | Bacteria | 2591 |
| 81 | Ga0466716_033455 | 3300042605 | Bacteria | 5469 |
| 82 | Ga0466716_114809 | 3300042605 | Unclassified | 5381 |
| 83 | Ga0466719_405085 | 3300042606 | Bacteria | 19326 |
| 84 | Ga0466722_192083 | 3300042609 | Bacteria | 1216 |
| 85 | Ga0466705_032521 | 3300042612 | Bacteria | 7211 |
| 86 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 87 | Ga0466731_224932 | 3300042622 | Bacteria | 4112 |
| 88 | Ga0466735_052457 | 3300042624 | Bacteria | 4797 |
| 89 | Ga0466703_038894 | 3300042636 | Bacteria | 5250 |
| 90 | Ga0466724_28891 | 3300042649 | Bacteria | 455231 |
| 91 | Ga0466724_63811 | 3300042649 | Bacteria | 2170 |
| 92 | Ga0466727_189586 | 3300042655 | Bacteria | 2015 |
| 93 | 2227489928 | 2225789004 | Bacteria | 4120 |
| 94 | IMNBL1DRAFT_c0000081 | 3300000062 | Bacteria | 85805 |
| 95 | IMNBL1DRAFT_c0002779 | 3300000062 | Bacteria | 11876 |
| 96 | JGI24702J35022_10001162 | 3300002462 | Bacteria | 16378 |
| 97 | JGI24702J35022_10004721 | 3300002462 | Bacteria | 8066 |
| 98 | JGI24705J35276_12227610 | 3300002504 | Bacteria | 3033 |
| 99 | JGI24696J40584_12960779 | 3300002834 | Bacteria | 8504 |
| 100 | Ga0068305_10001719 | 3300005083 | Bacteria | 59866 |
| 101 | Ga0102739_1000038 | 3300007095 | Bacteria | 37666 |
| 102 | Ga0102740_1000283 | 3300007140 | Bacteria | 14468 |
| 103 | Ga0123357_10001231 | 3300009784 | Bacteria | 26869 |
| 104 | Ga0466710_181773 | 3300042613 | Bacteria | 3155 |
| 105 | Ga0466715_113213 | 3300042616 | Bacteria | 91663 |
| 106 | Ga0466726_421340 | 3300042619 | Bacteria | 1464 |
| 107 | Ga0160432_100030 | 3300012818 | Bacteria | 235484 |
| 108 | Ga0466657_090962 | 3300042582 | Bacteria | 14991 |
| 109 | Ga0466690_012092 | 3300042590 | Bacteria | 14071 |
| 110 | Ga0466690_203626 | 3300042590 | Bacteria | 18251 |
| 111 | Ga0466693_373203 | 3300042592 | Bacteria | 1352 |
| 112 | Ga0466696_009426 | 3300042596 | Bacteria | 3537 |
| 113 | Ga0123357_10122554 | 3300009784 | Bacteria | 3270 |
| 114 | Ga0123356_10028523 | 3300010049 | Bacteria | 5230 |
| 115 | Ga0123356_10134293 | 3300010049 | Bacteria | 2429 |
| 116 | Ga0123356_10843014 | 3300010049 | Bacteria | 1088 |
| 117 | Ga0123356_11366462 | 3300010049 | Bacteria | 870 |
| 118 | Ga0123353_10215798 | 3300010167 | Bacteria | 3005 |
| 119 | Ga0123353_10482513 | 3300010167 | Bacteria | 1813 |
| 120 | Ga0123353_12140660 | 3300010167 | Bacteria | 679 |
| 121 | Ga0123354_10310127 | 3300010882 | Bacteria | 1475 |
| 122 | Ga0466706_053011 | 3300042599 | Bacteria | 30273 |
| 123 | Ga0466706_135634 | 3300042599 | Bacteria | 14355 |
| 124 | Ga0466706_244354 | 3300042599 | Bacteria | 7184 |
| 125 | Ga0466700_419351 | 3300042600 | Bacteria | 22548 |
| 126 | Ga0466707_088296 | 3300042601 | Bacteria | 21052 |
| 127 | Ga0466713_036864 | 3300042602 | Bacteria | 8349 |
| 128 | Ga0466717_174880 | 3300042604 | Bacteria | 2302 |
| 129 | Ga0466719_488422 | 3300042606 | Unclassified | 1138 |
| 130 | Ga0466698_124554 | 3300042610 | Bacteria | 2637 |
| 131 | Ga0466697_011718 | 3300042611 | Unclassified | 1120 |
| 132 | Ga0466697_161901 | 3300042611 | Bacteria | 3475 |
| 133 | Ga0466734_038934 | 3300042623 | Bacteria | 1315 |
| 134 | Ga0466734_070646 | 3300042623 | Bacteria | 5698 |
| 135 | Ga0466735_209311 | 3300042624 | Bacteria | 1695 |
| 136 | Ga0466735_234785 | 3300042624 | Bacteria | 1986 |
| 137 | Ga0466730_030722 | 3300042625 | Bacteria | 1135247 |
| 138 | Ga0466703_359837 | 3300042636 | Unclassified | 1026 |
| 139 | Ga0466725_038933 | 3300042654 | Bacteria | 1763 |
| 140 | Ga0466727_113322 | 3300042655 | Bacteria | 53270 |
| 141 | 2227538527 | 2225789004 | Bacteria | 15798 |
| 142 | Ga0072941_1317171 | 3300005201 | Bacteria | 2023 |
| 143 | Ga0104045_1002977 | 3300007085 | Bacteria | 3136 |
| 144 | Ga0104041_1001347 | 3300007106 | Bacteria | 11357 |
| 145 | Ga0102734_1000010 | 3300007129 | Bacteria | 79566 |
| 146 | Ga0123357_10001395 | 3300009784 | Bacteria | 25599 |
| 147 | Ga0466710_124271 | 3300042613 | Bacteria | 9334 |
| 148 | Ga0466715_415746 | 3300042616 | Bacteria | 2599 |
| 149 | Ga0466715_461898 | 3300042616 | Bacteria | 12878 |
| 150 | Ga0466726_010759 | 3300042619 | Bacteria | 6254 |
| 151 | Ga0466729_188376 | 3300042621 | Bacteria | 1327 |
| 152 | Ga0160441_100017 | 3300012825 | Bacteria | 294372 |
| 153 | Ga0160436_1013526 | 3300012861 | Bacteria | 1699 |
| 154 | Ga0466694_025681 | 3300042594 | Bacteria | 6210 |
| 155 | Ga0466694_208284 | 3300042594 | Bacteria | 1206 |
| 156 | Ga0123356_10242969 | 3300010049 | Bacteria | 1873 |
| 157 | Ga0123353_10000970 | 3300010167 | Bacteria | 35107 |
| 158 | Ga0123354_10335349 | 3300010882 | Bacteria | 1372 |
| 159 | Ga0160470_100037 | 3300012813 | Bacteria | 198767 |
| 160 | Ga0466701_048232 | 3300042598 | Bacteria | 4584 |
| 161 | Ga0466701_064984 | 3300042598 | Bacteria | 24009 |
| 162 | Ga0466706_033379 | 3300042599 | Bacteria | 4232 |
| 163 | Ga0466706_233448 | 3300042599 | Bacteria | 1911 |
| 164 | Ga0466707_413318 | 3300042601 | Bacteria | 8671 |
| 165 | Ga0466719_516457 | 3300042606 | Bacteria | 1046 |
| 166 | Ga0466720_023256 | 3300042607 | Bacteria | 2268 |
| 167 | Ga0466698_204559 | 3300042610 | Bacteria | 4613 |
| 168 | Ga0466705_071483 | 3300042612 | Bacteria | 9744 |
| 169 | Ga0466733_007592 | 3300042659 | Bacteria | 10605 |
| 170 | Ga0466735_041373 | 3300042624 | Bacteria | 1377 |
| 171 | Ga0466703_066221 | 3300042636 | Bacteria | 1479 |
| 172 | Ga0466703_312900 | 3300042636 | Bacteria | 1675 |
| 173 | Ga0466704_407929 | 3300042643 | Bacteria | 7255 |
| 174 | Ga0466704_579485 | 3300042643 | Bacteria | 4445 |
| 175 | Ga0466725_444258 | 3300042654 | Bacteria | 46059 |
| 176 | IMNBL1DRAFT_c0000636 | 3300000062 | Bacteria | 28047 |
| 177 | JGI24705J35276_12175107 | 3300002504 | Unclassified | 1322 |
| 178 | JGI24696J40584_12961669 | 3300002834 | Bacteria | 31265 |
| 179 | Ga0068305_10157667 | 3300005083 | Bacteria | 5403 |
| 180 | Ga0104045_1028620 | 3300007085 | Unclassified | 5544 |
| 181 | Ga0466715_273928 | 3300042616 | Bacteria | 5514 |
| 182 | Ga0466715_302938 | 3300042616 | Bacteria | 11702 |
| 183 | Ga0466715_376224 | 3300042616 | Bacteria | 43713 |
| 184 | Ga0466728_259710 | 3300042620 | Bacteria | 3759 |
| 185 | Ga0160468_100149 | 3300012819 | Bacteria | 61401 |
| 186 | Ga0160433_100091 | 3300012846 | Bacteria | 91670 |
| 187 | Ga0160447_100018 | 3300012849 | Bacteria | 260737 |
| 188 | Ga0466657_403214 | 3300042582 | Bacteria | 3244 |
| 189 | Ga0466693_052107 | 3300042592 | Bacteria | 1028 |
| 190 | Ga0123357_10165777 | 3300009784 | Bacteria | 2632 |
| 191 | Ga0123357_10254478 | 3300009784 | Bacteria | 1871 |
| 192 | Ga0123356_11556708 | 3300010049 | Unclassified | 817 |
| 193 | Ga0123354_10000098 | 3300010882 | Bacteria | 64634 |
| 194 | Ga0123354_10005583 | 3300010882 | Bacteria | 18345 |
| 195 | Ga0466701_062333 | 3300042598 | Bacteria | 75358 |
| 196 | Ga0466701_070616 | 3300042598 | Bacteria | 1906 |
| 197 | Ga0466706_014702 | 3300042599 | Bacteria | 1066 |
| 198 | Ga0466706_104377 | 3300042599 | Bacteria | 7399 |
| 199 | Ga0466707_226787 | 3300042601 | Bacteria | 17750 |
| 200 | Ga0466719_036058 | 3300042606 | Bacteria | 2183 |
| 201 | Ga0466721_268412 | 3300042608 | Bacteria | 22898 |
| 202 | Ga0466697_066144 | 3300042611 | Bacteria | 115209 |
| 203 | Ga0466729_248084 | 3300042621 | Bacteria | 4247 |
| 204 | Ga0466731_422518 | 3300042622 | Bacteria | 9244 |
| 205 | Ga0466703_104988 | 3300042636 | Bacteria | 39552 |
| 206 | Ga0466704_492877 | 3300042643 | Bacteria | 18854 |
| 207 | Ga0466724_07109 | 3300042649 | Bacteria | 285871 |
| 208 | Ga0466708_194922 | 3300042652 | Bacteria | 24599 |
| 209 | 2227535763 | 2225789004 | Bacteria | 15927 |
| 210 | JGI24702J35022_10014868 | 3300002462 | Bacteria | 4287 |
| 211 | Ga0072941_1036274 | 3300005201 | Unclassified | 2528 |
| 212 | Ga0466710_418920 | 3300042613 | Bacteria | 3475 |
| 213 | Ga0466718_093322 | 3300042617 | Bacteria | 1858 |
| 214 | Ga0466692_066788 | 3300042591 | Bacteria | 1174 |
| 215 | Ga0466695_247672 | 3300042595 | Bacteria | 1462 |
| 216 | Ga0466696_414634 | 3300042596 | Bacteria | 1546 |
| 217 | Ga0466701_007668 | 3300042598 | Bacteria | 1939 |
| 218 | Ga0466706_039565 | 3300042599 | Bacteria | 1917 |
| 219 | Ga0466713_018694 | 3300042602 | Bacteria | 10231 |
| 220 | Ga0466713_070245 | 3300042602 | Bacteria | 20718 |
| 221 | Ga0466719_102777 | 3300042606 | Bacteria | 6865 |
| 222 | Ga0466722_263769 | 3300042609 | Unclassified | 2312 |
| 223 | Ga0466697_168258 | 3300042611 | Bacteria | 4127 |
| 224 | Ga0466705_073548 | 3300042612 | Unclassified | 1832 |
| 225 | Ga0466733_040859 | 3300042659 | Bacteria | 9545 |
| 226 | Ga0466735_091338 | 3300042624 | Bacteria | 2824 |
| 227 | Ga0466735_093689 | 3300042624 | Bacteria | 3765 |
| 228 | Ga0466735_136038 | 3300042624 | Bacteria | 2914 |
| 229 | IMNBGM34_c001356 | 3300000036 | Bacteria | 4322 |
| 230 | HBC_ctgsDRAFT_1000002 | 3300000333 | Bacteria | 67449 |
| 231 | JGI24702J35022_10159453 | 3300002462 | Unclassified | 1270 |
| 232 | JGI24702J35022_10172269 | 3300002462 | Bacteria | 1225 |
| 233 | JGI24702J35022_10180146 | 3300002462 | Bacteria | 1200 |
| 234 | JGI24705J35276_11705242 | 3300002504 | Unclassified | 635 |
| 235 | JGI24705J35276_12234764 | 3300002504 | Unclassified | 5818 |
| 236 | JGI24699J35502_11133131 | 3300002509 | Bacteria | 8859 |
| 237 | Ga0104050_1200095 | 3300007153 | Bacteria | 2736 |
| 238 | Ga0466710_120413 | 3300042613 | Bacteria | 17283 |
| 239 | Ga0466710_368784 | 3300042613 | Bacteria | 2024 |
| 240 | Ga0466715_634316 | 3300042616 | Bacteria | 1188 |
| 241 | Ga0466723_365028 | 3300042618 | Bacteria | 3116 |
| 242 | Ga0466729_153704 | 3300042621 | Bacteria | 53339 |
| 243 | Ga0160443_100015 | 3300012848 | Bacteria | 436093 |
| 244 | Ga0466657_028767 | 3300042582 | Bacteria | 2086 |
| 245 | Ga0466692_030773 | 3300042591 | Bacteria | 1805 |
| 246 | Ga0466692_130475 | 3300042591 | Bacteria | 5658 |
| 247 | Ga0466691_152991 | 3300042593 | Bacteria | 4995 |
| 248 | Ga0466691_194048 | 3300042593 | Unclassified | 2365 |
| 249 | Ga0466696_079957 | 3300042596 | Bacteria | 7777 |
| 250 | Ga0123357_10058714 | 3300009784 | Bacteria | 5165 |
| 251 | Ga0123357_10320571 | 3300009784 | Bacteria | 1532 |
| 252 | Ga0123355_11230463 | 3300009826 | Bacteria | 760 |
| 253 | Ga0123356_10346968 | 3300010049 | Unclassified | 1607 |
| 254 | Ga0123353_10005456 | 3300010167 | Bacteria | 16705 |
| 255 | Ga0466701_036771 | 3300042598 | Bacteria | 249987 |
| 256 | Ga0466701_040490 | 3300042598 | Bacteria | 26650 |
| 257 | Ga0466706_047505 | 3300042599 | Bacteria | 4496 |
| 258 | Ga0466717_149280 | 3300042604 | Bacteria | 1217 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300002504 | JGI24705J35276_11705242 | JGI24705J35276_117052421 | 172 |
| 2 | 3300042622 | Ga0466731_224932 | Ga0466731_224932_12_530 | 172 |
| 3 | 3300042611 | Ga0466697_011718 | Ga0466697_011718_39_560 | 173 |
| 4 | iso_pr_bacteria | 2590828803 | 2592927463 | 185 |
| 5 | 3300005201 | Ga0072941_1036274 | Ga0072941_10362741 | 186 |
| 6 | 3300042596 | Ga0466696_277581 | Ga0466696_277581_4565_5128 | 187 |
| 7 | 3300042608 | Ga0466721_268412 | Ga0466721_268412_20915_21478 | 187 |
| 8 | 3300042612 | Ga0466705_071483 | Ga0466705_071483_3469_4032 | 187 |
| 9 | 3300042612 | Ga0466705_073548 | Ga0466705_073548_741_1304 | 187 |
| 10 | 3300042643 | Ga0466704_228061 | Ga0466704_228061_436_999 | 187 |
| 11 | 3300009784 | Ga0123357_10254478 | Ga0123357_102544783 | 188 |
| 12 | 3300010049 | Ga0123356_10242969 | Ga0123356_102429692 | 188 |
| 13 | 3300010049 | Ga0123356_10346968 | Ga0123356_103469682 | 188 |
| 14 | 3300010049 | Ga0123356_10843014 | Ga0123356_108430141 | 188 |
| 15 | 3300010167 | Ga0123353_10466668 | Ga0123353_104666683 | 188 |
| 16 | 3300042592 | Ga0466693_112230 | Ga0466693_112230_458_1024 | 188 |
| 17 | 3300042599 | Ga0466706_033379 | Ga0466706_033379_1726_2292 | 188 |
| 18 | 3300042599 | Ga0466706_047505 | Ga0466706_047505_204_770 | 188 |
| 19 | 3300042599 | Ga0466706_281392 | Ga0466706_281392_1822_2388 | 188 |
| 20 | 3300042600 | Ga0466700_303542 | Ga0466700_303542_861_1427 | 188 |
| 21 | 3300042611 | Ga0466697_066144 | Ga0466697_066144_27690_28256 | 188 |
| 22 | 3300042613 | Ga0466710_120413 | Ga0466710_120413_11375_11941 | 188 |
| 23 | 3300042659 | Ga0466733_040859 | Ga0466733_040859_6765_7331 | 188 |
| 24 | iso_pr_bacteria | 2820736622 | 2820737026 | 188 |
| 25 | iso_pr_bacteria | 2820740053 | 2820740848 | 188 |
| 26 | 3300002462 | JGI24702J35022_10001162 | JGI24702J35022_100011622 | 189 |
| 27 | 3300012861 | Ga0160436_1013526 | Ga0160436_10135263 | 189 |
| 28 | 3300042590 | Ga0466690_012092 | Ga0466690_012092_13482_14051 | 189 |
| 29 | 3300042598 | Ga0466701_070616 | Ga0466701_070616_271_840 | 189 |
| 30 | 3300042649 | Ga0466724_28958 | Ga0466724_28958_3127_3696 | 189 |
| 31 | 3300007085 | Ga0104045_1028620 | Ga0104045_10286204 | 190 |
| 32 | 3300042598 | Ga0466701_040490 | Ga0466701_040490_17974_18546 | 190 |
| 33 | 3300042601 | Ga0466707_244909 | Ga0466707_244909_13698_14270 | 190 |
| 34 | 3300042605 | Ga0466716_114809 | Ga0466716_114809_2579_3151 | 190 |
| 35 | 3300042613 | Ga0466710_106444 | Ga0466710_106444_7872_8444 | 190 |
| 36 | 3300042623 | Ga0466734_070646 | Ga0466734_070646_4299_4871 | 190 |
| 37 | 3300042624 | Ga0466735_091338 | Ga0466735_091338_353_925 | 190 |
| 38 | 3300042624 | Ga0466735_093689 | Ga0466735_093689_1288_1860 | 190 |
| 39 | 3300042649 | Ga0466724_63811 | Ga0466724_63811_617_1189 | 190 |
| 40 | 3300042654 | Ga0466725_038933 | Ga0466725_038933_815_1387 | 190 |
| 41 | 2225789004 | 2227535763 | 2228053351 | 191 |
| 42 | 3300042590 | Ga0466690_203626 | Ga0466690_203626_11883_12458 | 191 |
| 43 | 3300042599 | Ga0466706_032867 | Ga0466706_032867_17397_17972 | 191 |
| 44 | 3300042601 | Ga0466707_226787 | Ga0466707_226787_8090_8665 | 191 |
| 45 | 3300042606 | Ga0466719_036058 | Ga0466719_036058_473_1048 | 191 |
| 46 | 3300042606 | Ga0466719_488422 | Ga0466719_488422_60_635 | 191 |
| 47 | 3300042613 | Ga0466710_124271 | Ga0466710_124271_250_825 | 191 |
| 48 | 3300042613 | Ga0466710_368784 | Ga0466710_368784_1000_1575 | 191 |
| 49 | 3300042616 | Ga0466715_415746 | Ga0466715_415746_1342_1917 | 191 |
| 50 | 3300042616 | Ga0466715_634316 | Ga0466715_634316_95_670 | 191 |
| 51 | 3300042617 | Ga0466718_093322 | Ga0466718_093322_1074_1649 | 191 |
| 52 | 3300042624 | Ga0466735_234785 | Ga0466735_234785_30_605 | 191 |
| 53 | 3300042648 | Ga0466709_161150 | Ga0466709_161150_1074_1649 | 191 |
| 54 | 3300042652 | Ga0466708_194922 | Ga0466708_194922_10228_10803 | 191 |
| 55 | 3300042659 | Ga0466733_007592 | Ga0466733_007592_2477_3052 | 191 |
| 56 | iso_pr_bacteria | 2820735654 | 2820736416 | 191 |
| 57 | 2225789004 | 2227489928 | 2227960614 | 192 |
| 58 | 3300000036 | IMNBGM34_c001356 | IMNBGM34_0013563 | 192 |
| 59 | 3300000062 | IMNBL1DRAFT_c0000636 | IMNBL1DRAFT_000063615 | 192 |
| 60 | 3300000062 | IMNBL1DRAFT_c0014849 | IMNBL1DRAFT_00148493 | 192 |
| 61 | 3300000062 | IMNBL1DRAFT_c0026398 | IMNBL1DRAFT_00263982 | 192 |
| 62 | 3300002462 | JGI24702J35022_10004721 | JGI24702J35022_100047216 | 192 |
| 63 | 3300002462 | JGI24702J35022_10172269 | JGI24702J35022_101722692 | 192 |
| 64 | 3300012813 | Ga0160470_100037 | Ga0160470_10003787 | 192 |
| 65 | 3300012819 | Ga0160468_100149 | Ga0160468_10014947 | 192 |
| 66 | 3300012846 | Ga0160433_100091 | Ga0160433_10009118 | 192 |
| 67 | 3300042582 | Ga0466657_090962 | Ga0466657_090962_11921_12499 | 192 |
| 68 | 3300042599 | Ga0466706_104377 | Ga0466706_104377_6504_7082 | 192 |
| 69 | 3300042602 | Ga0466713_036864 | Ga0466713_036864_3328_3906 | 192 |
| 70 | 3300042613 | Ga0466710_418920 | Ga0466710_418920_1514_2092 | 192 |
| 71 | 3300042615 | Ga0466711_264853 | Ga0466711_264853_1120_1698 | 192 |
| 72 | 3300042616 | Ga0466715_461898 | Ga0466715_461898_10573_11151 | 192 |
| 73 | 3300042624 | Ga0466735_136038 | Ga0466735_136038_874_1452 | 192 |
| 74 | 3300042636 | Ga0466703_066221 | Ga0466703_066221_811_1389 | 192 |
| 75 | 3300056842 | Ga0562377_0004 | Ga0562377_0004_1394049_1394627 | 192 |
| 76 | iso_pr_bacteria | 2820750388 | 2820751355 | 192 |
| 77 | iso_pr_bacteria | 2864836148 | 2864837810 | 192 |
| 78 | 3300002462 | JGI24702J35022_10180146 | JGI24702J35022_101801462 | 193 |
| 79 | 3300005201 | Ga0072941_1317171 | Ga0072941_13171712 | 193 |
| 80 | 3300007068 | Ga0103265_1000001 | Ga0103265_1000001155 | 193 |
| 81 | 3300010049 | Ga0123356_10387765 | Ga0123356_103877652 | 193 |
| 82 | 3300010167 | Ga0123353_11607419 | Ga0123353_116074191 | 193 |
| 83 | 3300010167 | Ga0123353_12140660 | Ga0123353_121406601 | 193 |
| 84 | 3300012818 | Ga0160432_100030 | Ga0160432_10003017 | 193 |
| 85 | 3300042590 | Ga0466690_162531 | Ga0466690_162531_16724_17305 | 193 |
| 86 | 3300042591 | Ga0466692_084653 | Ga0466692_084653_14938_15519 | 193 |
| 87 | 3300042591 | Ga0466692_130475 | Ga0466692_130475_2001_2582 | 193 |
| 88 | 3300042592 | Ga0466693_373203 | Ga0466693_373203_603_1184 | 193 |
| 89 | 3300042594 | Ga0466694_025681 | Ga0466694_025681_103_684 | 193 |
| 90 | 3300042594 | Ga0466694_061481 | Ga0466694_061481_11393_11974 | 193 |
| 91 | 3300042594 | Ga0466694_208284 | Ga0466694_208284_85_666 | 193 |
| 92 | 3300042594 | Ga0466694_375417 | Ga0466694_375417_4789_5370 | 193 |
| 93 | 3300042595 | Ga0466695_247672 | Ga0466695_247672_582_1163 | 193 |
| 94 | 3300042598 | Ga0466701_048232 | Ga0466701_048232_1236_1817 | 193 |
| 95 | 3300042598 | Ga0466701_064984 | Ga0466701_064984_2404_2985 | 193 |
| 96 | 3300042599 | Ga0466706_135634 | Ga0466706_135634_8142_8723 | 193 |
| 97 | 3300042601 | Ga0466707_088296 | Ga0466707_088296_18347_18928 | 193 |
| 98 | 3300042601 | Ga0466707_252281 | Ga0466707_252281_28032_28613 | 193 |
| 99 | 3300042602 | Ga0466713_058747 | Ga0466713_058747_1438_2019 | 193 |
| 100 | 3300042604 | Ga0466717_149280 | Ga0466717_149280_591_1172 | 193 |
| 101 | 3300042605 | Ga0466716_033455 | Ga0466716_033455_3532_4113 | 193 |
| 102 | 3300042606 | Ga0466719_102777 | Ga0466719_102777_3900_4481 | 193 |
| 103 | 3300042609 | Ga0466722_192083 | Ga0466722_192083_143_724 | 193 |
| 104 | 3300042616 | Ga0466715_273928 | Ga0466715_273928_3252_3833 | 193 |
| 105 | 3300042616 | Ga0466715_376224 | Ga0466715_376224_10739_11320 | 193 |
| 106 | 3300042617 | Ga0466718_078939 | Ga0466718_078939_62_643 | 193 |
| 107 | 3300042619 | Ga0466726_010759 | Ga0466726_010759_4633_5214 | 193 |
| 108 | 3300042619 | Ga0466726_160838 | Ga0466726_160838_1041_1622 | 193 |
| 109 | 3300042624 | Ga0466735_019003 | Ga0466735_019003_348_929 | 193 |
| 110 | 3300042624 | Ga0466735_041373 | Ga0466735_041373_94_675 | 193 |
| 111 | 3300042624 | Ga0466735_052457 | Ga0466735_052457_1166_1747 | 193 |
| 112 | 3300042624 | Ga0466735_209311 | Ga0466735_209311_704_1285 | 193 |
| 113 | 3300042625 | Ga0466730_030722 | Ga0466730_030722_1123430_1124011 | 193 |
| 114 | 3300042655 | Ga0466727_113322 | Ga0466727_113322_12764_13345 | 193 |
| 115 | 3300042655 | Ga0466727_127654 | Ga0466727_127654_4486_5067 | 193 |
| 116 | 3300042655 | Ga0466727_189586 | Ga0466727_189586_1201_1782 | 193 |
| 117 | iso_pr_bacteria | 2820778767 | 2820781348 | 193 |
| 118 | iso_pr_bacteria | 2820783511 | 2820783892 | 193 |
| 119 | iso_pr_bacteria | 2820797595 | 2820799359 | 193 |
| 120 | iso_pr_bacteria | 2873776654 | 2873780291 | 193 |
| 121 | 2225789004 | 2227538527 | 2228058173 | 194 |
| 122 | 3300002462 | JGI24702J35022_10115934 | JGI24702J35022_101159342 | 194 |
| 123 | 3300002462 | JGI24702J35022_10159453 | JGI24702J35022_101594532 | 194 |
| 124 | 3300002504 | JGI24705J35276_12234764 | JGI24705J35276_122347642 | 194 |
| 125 | 3300002834 | JGI24696J40584_12888302 | JGI24696J40584_128883022 | 194 |
| 126 | 3300002834 | JGI24696J40584_12950308 | JGI24696J40584_129503082 | 194 |
| 127 | 3300002834 | JGI24696J40584_12961669 | JGI24696J40584_1296166911 | 194 |
| 128 | 3300009784 | Ga0123357_10058714 | Ga0123357_100587144 | 194 |
| 129 | 3300009784 | Ga0123357_10122554 | Ga0123357_101225542 | 194 |
| 130 | 3300010049 | Ga0123356_10001463 | Ga0123356_100014636 | 194 |
| 131 | 3300010049 | Ga0123356_10028523 | Ga0123356_100285233 | 194 |
| 132 | 3300010167 | Ga0123353_10007052 | Ga0123353_100070528 | 194 |
| 133 | 3300010167 | Ga0123353_10166315 | Ga0123353_101663152 | 194 |
| 134 | 3300010882 | Ga0123354_10005583 | Ga0123354_1000558316 | 194 |
| 135 | 3300010882 | Ga0123354_10335349 | Ga0123354_103353492 | 194 |
| 136 | 3300012825 | Ga0160441_100017 | Ga0160441_100017188 | 194 |
| 137 | 3300012825 | Ga0160441_100077 | Ga0160441_10007775 | 194 |
| 138 | 3300012839 | Ga0160472_102652 | Ga0160472_1026522 | 194 |
| 139 | 3300012845 | Ga0160460_100029 | Ga0160460_10002985 | 194 |
| 140 | 3300012849 | Ga0160447_100018 | Ga0160447_10001815 | 194 |
| 141 | 3300042593 | Ga0466691_152991 | Ga0466691_152991_2420_3004 | 194 |
| 142 | 3300042597 | Ga0466699_257936 | Ga0466699_257936_589_1173 | 194 |
| 143 | 3300042599 | Ga0466706_039565 | Ga0466706_039565_466_1050 | 194 |
| 144 | 3300042599 | Ga0466706_053011 | Ga0466706_053011_5781_6365 | 194 |
| 145 | 3300042599 | Ga0466706_054763 | Ga0466706_054763_130_714 | 194 |
| 146 | 3300042599 | Ga0466706_191057 | Ga0466706_191057_808_1392 | 194 |
| 147 | 3300042599 | Ga0466706_233448 | Ga0466706_233448_776_1360 | 194 |
| 148 | 3300042599 | Ga0466706_286876 | Ga0466706_286876_1156_1740 | 194 |
| 149 | 3300042601 | Ga0466707_413318 | Ga0466707_413318_6477_7061 | 194 |
| 150 | 3300042602 | Ga0466713_099518 | Ga0466713_099518_6142_6726 | 194 |
| 151 | 3300042606 | Ga0466719_405085 | Ga0466719_405085_5402_5986 | 194 |
| 152 | 3300042606 | Ga0466719_516457 | Ga0466719_516457_312_896 | 194 |
| 153 | 3300042607 | Ga0466720_023256 | Ga0466720_023256_1317_1901 | 194 |
| 154 | 3300042611 | Ga0466697_168258 | Ga0466697_168258_1045_1629 | 194 |
| 155 | 3300042612 | Ga0466705_032521 | Ga0466705_032521_4480_5064 | 194 |
| 156 | 3300042636 | Ga0466703_038894 | Ga0466703_038894_3592_4176 | 194 |
| 157 | 3300042636 | Ga0466703_104988 | Ga0466703_104988_3640_4224 | 194 |
| 158 | 3300042636 | Ga0466703_174868 | Ga0466703_174868_546_1130 | 194 |
| 159 | 3300042636 | Ga0466703_312900 | Ga0466703_312900_531_1115 | 194 |
| 160 | 3300042636 | Ga0466703_370626 | Ga0466703_370626_633_1217 | 194 |
| 161 | 3300042643 | Ga0466704_407929 | Ga0466704_407929_4450_5034 | 194 |
| 162 | 3300042643 | Ga0466704_579485 | Ga0466704_579485_2202_2786 | 194 |
| 163 | iso_pr_bacteria | 2541047151 | 2542000017 | 194 |
| 164 | iso_pr_bacteria | 2554235371 | 2555765269 | 194 |
| 165 | iso_pr_bacteria | 2554235381 | 2555814269 | 194 |
| 166 | iso_pr_bacteria | 2558860251 | 2559327088 | 194 |
| 167 | iso_pr_bacteria | 2695420931 | 2698111201 | 194 |
| 168 | iso_pr_bacteria | 2806310699 | 2807278160 | 194 |
| 169 | iso_pr_bacteria | 2820751898 | 2820753257 | 194 |
| 170 | iso_pr_bacteria | 2820753519 | 2820754976 | 194 |
| 171 | iso_pr_bacteria | 2820755292 | 2820755377 | 194 |
| 172 | iso_pr_bacteria | 2820759988 | 2820760428 | 194 |
| 173 | iso_pr_bacteria | 2820776227 | 2820776972 | 194 |
| 174 | iso_pr_bacteria | 8076013101 | 8076014184 | 194 |
| 175 | iso_pr_bacteria | 8100315503 | 8100316723 | 194 |
| 176 | iso_pr_bacteria | 8100317081 | 8100317506 | 194 |
| 177 | 3300002462 | JGI24702J35022_10026621 | JGI24702J35022_100266213 | 195 |
| 178 | 3300002504 | JGI24705J35276_12227610 | JGI24705J35276_122276102 | 195 |
| 179 | 3300002509 | JGI24699J35502_11133131 | JGI24699J35502_111331316 | 195 |
| 180 | 3300007095 | Ga0102739_1000038 | Ga0102739_100003838 | 195 |
| 181 | 3300007140 | Ga0102740_1000283 | Ga0102740_100028311 | 195 |
| 182 | 3300007188 | Ga0103264_1000064 | Ga0103264_100006414 | 195 |
| 183 | 3300009784 | Ga0123357_10001395 | Ga0123357_100013959 | 195 |
| 184 | 3300009784 | Ga0123357_10019221 | Ga0123357_100192218 | 195 |
| 185 | 3300010167 | Ga0123353_10215798 | Ga0123353_102157984 | 195 |
| 186 | 3300010167 | Ga0123353_10458598 | Ga0123353_104585982 | 195 |
| 187 | 3300010882 | Ga0123354_10000098 | Ga0123354_100000988 | 195 |
| 188 | 3300012848 | Ga0160443_100015 | Ga0160443_100015150 | 195 |
| 189 | 3300042582 | Ga0466657_028767 | Ga0466657_028767_154_741 | 195 |
| 190 | 3300042582 | Ga0466657_398260 | Ga0466657_398260_5531_6118 | 195 |
| 191 | 3300042591 | Ga0466692_066788 | Ga0466692_066788_149_736 | 195 |
| 192 | 3300042592 | Ga0466693_052107 | Ga0466693_052107_231_818 | 195 |
| 193 | 3300042595 | Ga0466695_380168 | Ga0466695_380168_258_845 | 195 |
| 194 | 3300042596 | Ga0466696_079957 | Ga0466696_079957_4124_4711 | 195 |
| 195 | 3300042598 | Ga0466701_007668 | Ga0466701_007668_17_604 | 195 |
| 196 | 3300042598 | Ga0466701_028947 | Ga0466701_028947_27942_28529 | 195 |
| 197 | 3300042598 | Ga0466701_062333 | Ga0466701_062333_33408_33995 | 195 |
| 198 | 3300042602 | Ga0466713_006207 | Ga0466713_006207_21672_22259 | 195 |
| 199 | 3300042602 | Ga0466713_111742 | Ga0466713_111742_3264_3851 | 195 |
| 200 | 3300042604 | Ga0466717_174880 | Ga0466717_174880_963_1550 | 195 |
| 201 | 3300042609 | Ga0466722_263769 | Ga0466722_263769_1122_1709 | 195 |
| 202 | 3300042610 | Ga0466698_124554 | Ga0466698_124554_766_1353 | 195 |
| 203 | 3300042613 | Ga0466710_181773 | Ga0466710_181773_2370_2957 | 195 |
| 204 | 3300042616 | Ga0466715_302938 | Ga0466715_302938_3278_3865 | 195 |
| 205 | 3300042621 | Ga0466729_153704 | Ga0466729_153704_2915_3502 | 195 |
| 206 | 3300042621 | Ga0466729_188376 | Ga0466729_188376_13_600 | 195 |
| 207 | 3300042621 | Ga0466729_248084 | Ga0466729_248084_1130_1717 | 195 |
| 208 | 3300042625 | Ga0466730_071786 | Ga0466730_071786_178499_179086 | 195 |
| 209 | 3300042636 | Ga0466703_359837 | Ga0466703_359837_124_711 | 195 |
| 210 | 3300042649 | Ga0466724_60944 | Ga0466724_60944_17747_18334 | 195 |
| 211 | iso_pr_bacteria | 2687453786 | 2690172940 | 195 |
| 212 | iso_pr_bacteria | 2695420317 | 2695484147 | 195 |
| 213 | iso_pr_bacteria | 2718218155 | 2720329111 | 195 |
| 214 | iso_pr_bacteria | 2864831662 | 2864835252 | 195 |
| 215 | iso_pr_bacteria | 2873600114 | 2873603487 | 195 |
| 216 | iso_pr_bacteria | 2873610414 | 2873613878 | 195 |
| 217 | iso_pr_bacteria | 2896330536 | 2896330772 | 195 |
| 218 | iso_pr_bacteria | 2896350215 | 2896350453 | 195 |
| 219 | iso_pr_bacteria | 2898741527 | 2898742776 | 195 |
| 220 | iso_pr_bacteria | 2904728850 | 2904730908 | 195 |
| 221 | iso_pr_bacteria | 2922326829 | 2922327251 | 195 |
| 222 | iso_pr_bacteria | 2958471994 | 2958473719 | 195 |
| 223 | iso_pr_bacteria | 2998907766 | 2998910607 | 195 |
| 224 | iso_pr_bacteria | 8100157865 | 8100161762 | 195 |
| 225 | 3300000062 | IMNBL1DRAFT_c0009268 | IMNBL1DRAFT_00092685 | 196 |
| 226 | 3300002462 | JGI24702J35022_10014868 | JGI24702J35022_100148682 | 196 |
| 227 | 3300002504 | JGI24705J35276_12175107 | JGI24705J35276_121751072 | 196 |
| 228 | 3300002509 | JGI24699J35502_11134119 | JGI24699J35502_1113411916 | 196 |
| 229 | 3300007106 | Ga0104041_1001347 | Ga0104041_10013479 | 196 |
| 230 | 3300007129 | Ga0102734_1000010 | Ga0102734_100001085 | 196 |
| 231 | 3300009784 | Ga0123357_10001231 | Ga0123357_100012315 | 196 |
| 232 | 3300009784 | Ga0123357_10012959 | Ga0123357_100129593 | 196 |
| 233 | 3300009784 | Ga0123357_10165777 | Ga0123357_101657773 | 196 |
| 234 | 3300010049 | Ga0123356_10134293 | Ga0123356_101342932 | 196 |
| 235 | 3300010049 | Ga0123356_10188083 | Ga0123356_101880832 | 196 |
| 236 | 3300010049 | Ga0123356_11556708 | Ga0123356_115567082 | 196 |
| 237 | 3300010167 | Ga0123353_10005456 | Ga0123353_1000545613 | 196 |
| 238 | 3300010167 | Ga0123353_10482513 | Ga0123353_104825132 | 196 |
| 239 | 3300010167 | Ga0123353_10559107 | Ga0123353_105591071 | 196 |
| 240 | 3300010167 | Ga0123353_10948742 | Ga0123353_109487422 | 196 |
| 241 | 3300010882 | Ga0123354_10000043 | Ga0123354_1000004358 | 196 |
| 242 | 3300042596 | Ga0466696_009426 | Ga0466696_009426_1325_1915 | 196 |
| 243 | 3300042598 | Ga0466701_035921 | Ga0466701_035921_162_752 | 196 |
| 244 | 3300042602 | Ga0466713_007739 | Ga0466713_007739_252_842 | 196 |
| 245 | 3300042602 | Ga0466713_013156 | Ga0466713_013156_312_902 | 196 |
| 246 | 3300042602 | Ga0466713_018694 | Ga0466713_018694_2342_2932 | 196 |
| 247 | 3300042609 | Ga0466722_177930 | Ga0466722_177930_2400_2990 | 196 |
| 248 | 3300042610 | Ga0466698_204559 | Ga0466698_204559_3727_4317 | 196 |
| 249 | 3300042611 | Ga0466697_161901 | Ga0466697_161901_1107_1697 | 196 |
| 250 | 3300042618 | Ga0466723_365028 | Ga0466723_365028_1634_2224 | 196 |
| 251 | 3300042649 | Ga0466724_56165 | Ga0466724_56165_248_838 | 196 |
| 252 | iso_pr_bacteria | 2864822740 | 2864825124 | 196 |
| 253 | iso_pr_bacteria | 2864882932 | 2864885315 | 196 |
| 254 | iso_pr_bacteria | 2864891731 | 2864893960 | 196 |
| 255 | iso_pr_bacteria | 2910949487 | 2910952513 | 196 |
| 256 | 3300002834 | JGI24696J40584_12960779 | JGI24696J40584_129607794 | 197 |
| 257 | 3300007052 | Ga0102736_1000793 | Ga0102736_10007933 | 197 |
| 258 | 3300007190 | Ga0103267_1000345 | Ga0103267_10003455 | 197 |
| 259 | 3300009826 | Ga0123355_11230463 | Ga0123355_112304631 | 197 |
| 260 | 3300010167 | Ga0123353_10000528 | Ga0123353_1000052838 | 197 |
| 261 | 3300010167 | Ga0123353_10000970 | Ga0123353_1000097015 | 197 |
| 262 | 3300010882 | Ga0123354_10310127 | Ga0123354_103101271 | 197 |
| 263 | 3300042591 | Ga0466692_030773 | Ga0466692_030773_1191_1784 | 197 |
| 264 | 3300042593 | Ga0466691_002343 | Ga0466691_002343_1407_2000 | 197 |
| 265 | 3300042596 | Ga0466696_414634 | Ga0466696_414634_179_772 | 197 |
| 266 | 3300042599 | Ga0466706_014702 | Ga0466706_014702_259_852 | 197 |
| 267 | 3300042602 | Ga0466713_056151 | Ga0466713_056151_35877_36470 | 197 |
| 268 | 3300042616 | Ga0466715_113213 | Ga0466715_113213_39233_39826 | 197 |
| 269 | 3300042622 | Ga0466731_422518 | Ga0466731_422518_3632_4225 | 197 |
| 270 | 3300042623 | Ga0466734_038934 | Ga0466734_038934_497_1090 | 197 |
| 271 | 3300042624 | Ga0466735_145310 | Ga0466735_145310_1137_1730 | 197 |
| 272 | 3300042649 | Ga0466724_07109 | Ga0466724_07109_58448_59041 | 197 |
| 273 | 3300042654 | Ga0466725_444258 | Ga0466725_444258_33617_34210 | 197 |
| 274 | iso_pr_bacteria | 2529292732 | 2529759153 | 197 |
| 275 | iso_pr_bacteria | 2811995047 | 2812946901 | 197 |
| 276 | iso_pr_bacteria | 2830041218 | 2830045267 | 197 |
| 277 | iso_pr_bacteria | 2847090942 | 2847093344 | 197 |
| 278 | iso_pr_bacteria | 2864788197 | 2864791220 | 197 |
| 279 | iso_pr_bacteria | 2864923010 | 2864926034 | 197 |
| 280 | iso_pr_bacteria | 2864948220 | 2864951242 | 197 |
| 281 | iso_pr_bacteria | 2921902974 | 2921904608 | 197 |
| 282 | iso_pr_bacteria | 3004672520 | 3004673446 | 197 |
| 283 | iso_pr_bacteria | 8020009074 | 8020010140 | 197 |
| 284 | iso_pr_bacteria | 8114076984 | 8114078967 | 197 |
| 285 | 3300002464 | Meta3P_1003007 | Meta3P_100300723 | 198 |
| 286 | 3300005083 | Ga0068305_10157667 | Ga0068305_101576674 | 198 |
| 287 | 3300010049 | Ga0123356_11366462 | Ga0123356_113664621 | 198 |
| 288 | 3300042599 | Ga0466706_172865 | Ga0466706_172865_39634_40230 | 198 |
| 289 | iso_pr_bacteria | 2940195863 | 2940197863 | 198 |
| 290 | 3300007153 | Ga0104050_1200095 | Ga0104050_12000953 | 199 |
| 291 | 3300009784 | Ga0123357_10320571 | Ga0123357_103205712 | 199 |
| 292 | 3300042643 | Ga0466704_492877 | Ga0466704_492877_3159_3758 | 199 |
| 293 | iso_pr_bacteria | 2820792843 | 2820793669 | 199 |
| 294 | iso_pr_bacteria | 2820795054 | 2820796803 | 199 |
| 295 | iso_pr_bacteria | 2832298047 | 2832298199 | 199 |
| 296 | iso_pr_bacteria | 3004677695 | 3004679776 | 199 |
| 297 | 3300000062 | IMNBL1DRAFT_c0002779 | IMNBL1DRAFT_00027798 | 200 |
| 298 | 3300009784 | Ga0123357_10052006 | Ga0123357_100520062 | 200 |
| 299 | iso_pr_bacteria | 2832343623 | 2832344461 | 200 |
| 300 | iso_pr_bacteria | 2832372155 | 2832373327 | 200 |
| 301 | iso_pr_bacteria | 3004667792 | 3004668688 | 200 |
| 302 | 3300042620 | Ga0466728_259710 | Ga0466728_259710_391_996 | 201 |
| 303 | iso_pr_bacteria | 2785510743 | 2785735328 | 201 |
| 304 | iso_pr_bacteria | 2799112231 | 2799233259 | 201 |
| 305 | 3300000333 | HBC_ctgsDRAFT_1000002 | HBC_ctgsDRAFT_100000246 | 202 |
| 306 | 3300005083 | Ga0068305_10001719 | Ga0068305_100017192 | 202 |
| 307 | iso_pr_bacteria | 2899132286 | 2899132502 | 202 |
| 308 | 2225789004 | 2227275235 | 2227725994 | 203 |
| 309 | 3300042598 | Ga0466701_036771 | Ga0466701_036771_70488_71099 | 203 |
| 310 | 3300000062 | IMNBL1DRAFT_c0000081 | IMNBL1DRAFT_000008123 | 204 |
| 311 | 3300005307 | Ga0074308_1116196 | Ga0074308_11161962 | 204 |
| 312 | 3300007085 | Ga0104045_1002977 | Ga0104045_10029772 | 204 |
| 313 | 3300007085 | Ga0104045_1075146 | Ga0104045_10751463 | 204 |
| 314 | 3300007106 | Ga0104041_1000691 | Ga0104041_10006911 | 204 |
| 315 | 3300042598 | Ga0466701_075478 | Ga0466701_075478_37255_37887 | 210 |
| 316 | 3300042649 | Ga0466724_28891 | Ga0466724_28891_34308_34940 | 210 |
| 317 | 3300042593 | Ga0466691_194048 | Ga0466691_194048_1248_1883 | 211 |
| 318 | iso_pr_bacteria | 2894649344 | 2894650013 | 214 |
| 319 | 3300042599 | Ga0466706_244354 | Ga0466706_244354_1490_2137 | 215 |
| 320 | 3300042582 | Ga0466657_403214 | Ga0466657_403214_1187_1846 | 219 |
| 321 | 3300042619 | Ga0466726_421340 | Ga0466726_421340_279_962 | 227 |
| 322 | iso_pr_bacteria | 2864886855 | 2864888154 | 227 |
| 323 | 3300042600 | Ga0466700_419351 | Ga0466700_419351_12446_13138 | 230 |
| 324 | 3300042602 | Ga0466713_070245 | Ga0466713_070245_6945_7682 | 245 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00265 | TK | Thymidine kinase | 48 | 220 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.74 | 0.84 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.