Protein Family IF05749

Metagenome Isolate
191 Members
67 Samples
169 Scaffolds
310.41 Avg Length

🧬 Representative Sequence

ID
3300042600|Ga0466700_372371|Ga0466700_372371_2120_3049
Length
309 aa
Sequence
MKGLVVKNTGSWYLVKTDGGRLIETKLKGNFRLKEIKSTNPVAVGDWVLIEENQEGTAFIYEIEDRKNYIIRRSSNLSKQSHVIAANVDQAFLIVTVNYPVTTTTFIDRFLATAEAYRIPAFLFFNKMDRYSSEDREYVEALIYLYETIGYTCHKISALEDNLLFMLQLLKNKTTLFSGHSGVGKSTLINRLEPNAQLRTREISNYHNKGMHTTTFSEMIKLSGGGYIIDTPGIKGFGVFDMESVEVSHYFPEIFKFAESCKFNNCTHRKEPGCAVLQALKDNYISESRYRSYLNILDDEAGKKYREAF

📊 Sample Types

Isolate 11.5%
Metagenome 88.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 26.9%
Termitidae 26.9%
Kalotermitidae 20.9%
Unclassified 10.4%
Termopsidae 6.0%
Rhinotermitidae 4.5%
Passalidae 3.0%
Hodotermitidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 187
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
7 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
8 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
9 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
10 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
11 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
12 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
13 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
14 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
15 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
16 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
17 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
18 2923982719 Parabacteroides sp. 52 Isolate Blattidae
19 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
20 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
21 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
26 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
27 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
28 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
30 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
31 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
34 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
35 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
36 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
37 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
38 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
39 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
40 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
41 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
42 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
47 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
48 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
49 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
50 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
51 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
52 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
53 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
54 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
55 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
56 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
57 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
58 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
59 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
60 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
61 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
62 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
63 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
64 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
65 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
66 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
67 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466693_209038 3300042592 Bacteria 3455
2 Ga0466691_089505 3300042593 Bacteria 2595
3 Ga0466700_034471 3300042600 Bacteria 17094
4 Ga0466716_302468 3300042605 Bacteria 23384
5 Ga0123356_10005302 3300010049 Bacteria 13145
6 IMNBL1DRAFT_c0005689 3300000062 Bacteria 7038
7 Ga0466723_113565 3300042618 Bacteria 1976
8 Ga0466726_350196 3300042619 Bacteria 1884
9 Ga0466735_013961 3300042624 Bacteria 4005
10 Ga0466703_135491 3300042636 Bacteria 2922
11 Ga0466725_183038 3300042654 Bacteria 1791
12 Ga0466727_042345 3300042655 Bacteria 13374
13 Ga0466706_034341 3300042599 Bacteria 6872
14 Ga0466700_102266 3300042600 Bacteria 11894
15 Ga0466707_010780 3300042601 Bacteria 2007
16 Ga0466707_058532 3300042601 Bacteria 2511
17 Ga0466707_104360 3300042601 Bacteria 4998
18 Ga0466707_115472 3300042601 Bacteria 2507
19 Ga0466719_187556 3300042606 Bacteria 2610
20 Ga0123357_10010334 3300009784 Bacteria 11862
21 IMNBL1DRAFT_c0000550 3300000062 Bacteria 30486
22 IMNBL1DRAFT_c0007528 3300000062 Bacteria 5707
23 Ga0466711_036479 3300042615 Bacteria 1943
24 Ga0466715_229277 3300042616 Bacteria 9485
25 Ga0466726_440172 3300042619 Bacteria 1356
26 Ga0466705_284343 3300042612 Bacteria 14433
27 Ga0466734_154640 3300042623 Bacteria 2508
28 Ga0466703_069218 3300042636 Bacteria 5838
29 Ga0466703_076148 3300042636 Bacteria 31788
30 Ga0466704_397789 3300042643 Bacteria 8757
31 Ga0466704_504980 3300042643 Bacteria 9197
32 Ga0466709_218965 3300042648 Bacteria 23200
33 Ga0466727_164388 3300042655 Bacteria 3664
34 Ga0466727_272373 3300042655 Bacteria 4367
35 Ga0466690_145185 3300042590 Bacteria 12761
36 Ga0466690_218433 3300042590 Bacteria 3017
37 Ga0466690_340718 3300042590 Bacteria 6390
38 Ga0466696_010174 3300042596 Bacteria 34499
39 Ga0466696_345175 3300042596 Bacteria 10393
40 Ga0466713_015028 3300042602 Bacteria 18923
41 Ga0466713_068915 3300042602 Bacteria 3944
42 Ga0466722_058847 3300042609 Bacteria 5707
43 Ga0466722_150021 3300042609 Bacteria 11279
44 Ga0123357_10064151 3300009784 Bacteria 4910
45 Ga0123354_10332567 3300010882 Bacteria 1382
46 IMNBL1DRAFT_c0000378 3300000062 Bacteria 38118
47 IMNBL1DRAFT_c0000967 3300000062 Bacteria 22204
48 JGI24702J35022_10004410 3300002462 Bacteria 8359
49 JGI24699J35502_11134056 3300002509 Bacteria 27277
50 JGI24696J40584_12955073 3300002834 Bacteria 2756
51 Ga0123357_10001231 3300009784 Bacteria 26869
52 Ga0466711_432914 3300042615 Bacteria 1511
53 Ga0466715_231121 3300042616 Bacteria 27941
54 Ga0466726_113886 3300042619 Unclassified 1167
55 Ga0466726_266114 3300042619 Bacteria 14251
56 Ga0466705_043883 3300042612 Bacteria 44680
57 Ga0466735_098167 3300042624 Bacteria 1805
58 Ga0466735_136106 3300042624 Bacteria 20578
59 Ga0466703_081086 3300042636 Bacteria 13969
60 Ga0466704_073513 3300042643 Bacteria 6622
61 Ga0466704_162591 3300042643 Bacteria 14624
62 Ga0466708_175500 3300042652 Bacteria 17846
63 Ga0466727_259633 3300042655 Bacteria 12651
64 Ga0466690_404209 3300042590 Bacteria 3172
65 Ga0466692_181143 3300042591 Bacteria 18569
66 Ga0466691_195452 3300042593 Bacteria 11459
67 Ga0466700_036651 3300042600 Bacteria 2758
68 Ga0466707_111695 3300042601 Bacteria 37145
69 Ga0466707_227488 3300042601 Bacteria 8168
70 Ga0466707_305705 3300042601 Bacteria 37461
71 Ga0466713_117267 3300042602 Bacteria 44157
72 Ga0466719_219052 3300042606 Bacteria 2872
73 Ga0466722_136436 3300042609 Bacteria 9717
74 Ga0466722_172122 3300042609 Bacteria 4339
75 Ga0466698_327631 3300042610 Bacteria 1883
76 Ga0123354_10017098 3300010882 Bacteria 11360
77 2227080821 2225789004 Bacteria 10122
78 IMNBL1DRAFT_c0009894 3300000062 Bacteria 4640
79 JGI24699J35502_11134045 3300002509 Bacteria 26658
80 JGI24696J40584_12951810 3300002834 Bacteria 2280
81 Ga0466715_222839 3300042616 Bacteria 6079
82 Ga0466715_484239 3300042616 Bacteria 11010
83 Ga0466697_080810 3300042611 Bacteria 1598
84 Ga0466735_072645 3300042624 Bacteria 6232
85 Ga0466703_116337 3300042636 Bacteria 5231
86 Ga0466704_210305 3300042643 Bacteria 5928
87 Ga0466704_557681 3300042643 Bacteria 20638
88 Ga0466709_083260 3300042648 Bacteria 4447
89 Ga0466709_281727 3300042648 Bacteria 6076
90 Ga0466733_053829 3300042659 Bacteria 74295
91 Ga0466690_061290 3300042590 Bacteria 39636
92 Ga0466696_374554 3300042596 Bacteria 7120
93 Ga0466713_044168 3300042602 Bacteria 23186
94 Ga0466713_137512 3300042602 Bacteria 13469
95 Ga0466716_281169 3300042605 Bacteria 5161
96 Ga0466719_043916 3300042606 Bacteria 13096
97 Ga0466719_372237 3300042606 Bacteria 8104
98 Ga0466719_379862 3300042606 Bacteria 2643
99 Ga0466722_165113 3300042609 Bacteria 35000
100 Ga0123357_10048971 3300009784 Bacteria 5724
101 Ga0123354_10001542 3300010882 Bacteria 28227
102 2227661312 2225789004 Bacteria 1946
103 Ga0466723_250630 3300042618 Bacteria 3025
104 Ga0466728_155675 3300042620 Bacteria 7340
105 Ga0466735_166303 3300042624 Bacteria 1863
106 Ga0466704_404355 3300042643 Bacteria 3624
107 Ga0466709_285479 3300042648 Bacteria 36223
108 Ga0415639_045760 3300038395 Bacteria 3223
109 Ga0466694_227896 3300042594 Bacteria 2670
110 Ga0466696_289866 3300042596 Bacteria 18784
111 Ga0466706_038521 3300042599 Bacteria 2347
112 Ga0466706_206937 3300042599 Bacteria 3552
113 Ga0466716_177205 3300042605 Bacteria 3277
114 Ga0466722_081713 3300042609 Bacteria 4561
115 Ga0123357_10008613 3300009784 Bacteria 12765
116 Ga0123357_10030231 3300009784 Bacteria 7343
117 Ga0123353_10100763 3300010167 Bacteria 4656
118 Ga0123353_10121192 3300010167 Bacteria 4206
119 Ga0123354_10039470 3300010882 Bacteria 7317
120 Ga0123354_10236051 3300010882 Bacteria 1896
121 IMNBL1DRAFT_c0022945 3300000062 Bacteria 2456
122 JGI24702J35022_10001025 3300002462 Bacteria 17489
123 JGI24699J35502_11127536 3300002509 Bacteria 4176
124 Ga0466711_490041 3300042615 Bacteria 3963
125 Ga0466715_355335 3300042616 Bacteria 7535
126 Ga0466729_239996 3300042621 Bacteria 15530
127 Ga0466703_385649 3300042636 Bacteria 2630
128 Ga0466727_124126 3300042655 Bacteria 7801
129 Ga0466732_439102 3300042656 Bacteria 1749
130 Ga0466692_042719 3300042591 Bacteria 5683
131 Ga0466692_163838 3300042591 Bacteria 4088
132 Ga0466707_093234 3300042601 Bacteria 3556
133 Ga0466713_034284 3300042602 Bacteria 9067
134 Ga0466713_045654 3300042602 Bacteria 11902
135 2227507408 2225789004 Bacteria 3639
136 Ga0068302_10002731 3300005071 Unclassified 1954
137 Ga0466715_076359 3300042616 Bacteria 15631
138 Ga0466715_120453 3300042616 Unclassified 2215
139 Ga0466729_157648 3300042621 Bacteria 1338
140 Ga0466735_054067 3300042624 Bacteria 2389
141 Ga0466704_298510 3300042643 Bacteria 23069
142 Ga0466704_561838 3300042643 Bacteria 29338
143 Ga0466708_126656 3300042652 Bacteria 27676
144 Ga0466690_266719 3300042590 Bacteria 2839
145 Ga0466692_067548 3300042591 Bacteria 10110
146 Ga0466692_106596 3300042591 Bacteria 5339
147 Ga0466701_061816 3300042598 Bacteria 14165
148 Ga0466701_079535 3300042598 Bacteria 72629
149 Ga0466700_372371 3300042600 Bacteria 3166
150 Ga0466707_263999 3300042601 Bacteria 16080
151 Ga0466707_337815 3300042601 Bacteria 18263
152 Ga0466713_056151 3300042602 Bacteria 40882
153 Ga0466716_467442 3300042605 Bacteria 25909
154 Ga0466722_206920 3300042609 Bacteria 1887
155 Ga0123353_10438278 3300010167 Bacteria 1929
156 Ga0123354_10005342 3300010882 Bacteria 18635
157 Ga0123354_10019502 3300010882 Bacteria 10651
158 Ga0123354_10082299 3300010882 Bacteria 4539
159 Ga0123354_10182274 3300010882 Unclassified 2391
160 2227572419 2225789004 Bacteria 2600
161 Ga0068305_10321584 3300005083 Bacteria 7639
162 Ga0123357_10003012 3300009784 Bacteria 19070
163 Ga0466705_391529 3300042612 Bacteria 3302
164 Ga0466715_119675 3300042616 Bacteria 3063
165 Ga0466726_316828 3300042619 Bacteria 2528
166 Ga0466703_058449 3300042636 Bacteria 2569
167 Ga0466703_261320 3300042636 Bacteria 41798
168 Ga0466704_397024 3300042643 Bacteria 8534
169 Ga0466727_311789 3300042655 Bacteria 6585

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_284343 Ga0466705_284343_3252_4142 296
2 3300042619 Ga0466726_113886 Ga0466726_113886_259_1152 297
3 3300042615 Ga0466711_490041 Ga0466711_490041_1891_2823 302
4 3300010882 Ga0123354_10182274 Ga0123354_101822741 303
5 3300002834 JGI24696J40584_12951810 JGI24696J40584_129518103 307
6 3300038395 Ga0415639_045760 Ga0415639_045760_42_965 307
7 3300042601 Ga0466707_227488 Ga0466707_227488_1496_2419 307
8 3300042616 Ga0466715_231121 Ga0466715_231121_7970_8893 307
9 3300042619 Ga0466726_440172 Ga0466726_440172_86_1009 307
10 3300042648 Ga0466709_285479 Ga0466709_285479_28532_29455 307
11 3300042654 Ga0466725_183038 Ga0466725_183038_422_1345 307
12 iso_pr_bacteria 2940193328 2940194704 307
13 iso_pr_bacteria 2940336608 2940337981 307
14 3300002834 JGI24696J40584_12955073 JGI24696J40584_129550731 308
15 3300042590 Ga0466690_061290 Ga0466690_061290_6325_7251 308
16 3300042606 Ga0466719_379862 Ga0466719_379862_628_1554 308
17 3300042590 Ga0466690_145185 Ga0466690_145185_3467_4396 309
18 3300042600 Ga0466700_372371 Ga0466700_372371_2120_3049 309
19 3300042602 Ga0466713_068915 Ga0466713_068915_917_1846 309
20 3300042609 Ga0466722_058847 Ga0466722_058847_2281_3210 309
21 3300042643 Ga0466704_397024 Ga0466704_397024_4144_5073 309
22 iso_pr_bacteria 2910926975 2910930064 309
23 2225789004 2227080821 2227455036 310
24 2225789004 2227507408 2227996382 310
25 2225789004 2227572419 2228118556 310
26 2225789004 2227661312 2228262108 310
27 3300042590 Ga0466690_218433 Ga0466690_218433_882_1814 310
28 3300042590 Ga0466690_266719 Ga0466690_266719_1774_2706 310
29 3300042590 Ga0466690_340718 Ga0466690_340718_355_1287 310
30 3300042590 Ga0466690_404209 Ga0466690_404209_1496_2428 310
31 3300042591 Ga0466692_042719 Ga0466692_042719_4057_4989 310
32 3300042591 Ga0466692_067548 Ga0466692_067548_4087_5019 310
33 3300042591 Ga0466692_106596 Ga0466692_106596_2448_3380 310
34 3300042591 Ga0466692_163838 Ga0466692_163838_2196_3128 310
35 3300042591 Ga0466692_181143 Ga0466692_181143_13150_14082 310
36 3300042592 Ga0466693_209038 Ga0466693_209038_1929_2861 310
37 3300042594 Ga0466694_227896 Ga0466694_227896_151_1083 310
38 3300042596 Ga0466696_010174 Ga0466696_010174_30831_31763 310
39 3300042596 Ga0466696_289866 Ga0466696_289866_5289_6221 310
40 3300042596 Ga0466696_345175 Ga0466696_345175_7699_8631 310
41 3300042596 Ga0466696_374554 Ga0466696_374554_2618_3550 310
42 3300042598 Ga0466701_061816 Ga0466701_061816_10644_11576 310
43 3300042598 Ga0466701_079535 Ga0466701_079535_50788_51720 310
44 3300042599 Ga0466706_034341 Ga0466706_034341_2616_3548 310
45 3300042599 Ga0466706_038521 Ga0466706_038521_140_1072 310
46 3300042599 Ga0466706_206937 Ga0466706_206937_1240_2172 310
47 3300042600 Ga0466700_034471 Ga0466700_034471_7793_8725 310
48 3300042600 Ga0466700_036651 Ga0466700_036651_1590_2522 310
49 3300042600 Ga0466700_102266 Ga0466700_102266_4888_5820 310
50 3300042601 Ga0466707_010780 Ga0466707_010780_107_1039 310
51 3300042601 Ga0466707_058532 Ga0466707_058532_557_1489 310
52 3300042601 Ga0466707_093234 Ga0466707_093234_1172_2104 310
53 3300042601 Ga0466707_111695 Ga0466707_111695_3170_4102 310
54 3300042601 Ga0466707_115472 Ga0466707_115472_1196_2128 310
55 3300042601 Ga0466707_263999 Ga0466707_263999_6871_7803 310
56 3300042601 Ga0466707_337815 Ga0466707_337815_1739_2671 310
57 3300042602 Ga0466713_015028 Ga0466713_015028_4087_5019 310
58 3300042602 Ga0466713_034284 Ga0466713_034284_3786_4718 310
59 3300042602 Ga0466713_044168 Ga0466713_044168_4591_5523 310
60 3300042602 Ga0466713_045654 Ga0466713_045654_2487_3419 310
61 3300042602 Ga0466713_117267 Ga0466713_117267_13568_14500 310
62 3300042602 Ga0466713_137512 Ga0466713_137512_5828_6760 310
63 3300042605 Ga0466716_177205 Ga0466716_177205_1513_2445 310
64 3300042605 Ga0466716_302468 Ga0466716_302468_10882_11814 310
65 3300042605 Ga0466716_467442 Ga0466716_467442_18454_19386 310
66 3300042606 Ga0466719_043916 Ga0466719_043916_8609_9541 310
67 3300042606 Ga0466719_187556 Ga0466719_187556_1490_2422 310
68 3300042606 Ga0466719_219052 Ga0466719_219052_1436_2368 310
69 3300042609 Ga0466722_081713 Ga0466722_081713_924_1856 310
70 3300042609 Ga0466722_136436 Ga0466722_136436_8177_9109 310
71 3300042609 Ga0466722_150021 Ga0466722_150021_5549_6481 310
72 3300042609 Ga0466722_165113 Ga0466722_165113_13123_14055 310
73 3300042609 Ga0466722_172122 Ga0466722_172122_3152_4084 310
74 3300042609 Ga0466722_206920 Ga0466722_206920_309_1241 310
75 3300042610 Ga0466698_327631 Ga0466698_327631_911_1843 310
76 3300042611 Ga0466697_080810 Ga0466697_080810_174_1106 310
77 3300042612 Ga0466705_043883 Ga0466705_043883_26912_27844 310
78 3300042612 Ga0466705_391529 Ga0466705_391529_1200_2132 310
79 3300042615 Ga0466711_036479 Ga0466711_036479_499_1431 310
80 3300042615 Ga0466711_432914 Ga0466711_432914_512_1444 310
81 3300042616 Ga0466715_119675 Ga0466715_119675_1803_2735 310
82 3300042616 Ga0466715_120453 Ga0466715_120453_929_1861 310
83 3300042616 Ga0466715_222839 Ga0466715_222839_3953_4885 310
84 3300042616 Ga0466715_229277 Ga0466715_229277_7531_8463 310
85 3300042616 Ga0466715_355335 Ga0466715_355335_4925_5857 310
86 3300042618 Ga0466723_250630 Ga0466723_250630_806_1738 310
87 3300042619 Ga0466726_266114 Ga0466726_266114_9076_10008 310
88 3300042619 Ga0466726_316828 Ga0466726_316828_1049_1981 310
89 3300042619 Ga0466726_350196 Ga0466726_350196_463_1395 310
90 3300042620 Ga0466728_155675 Ga0466728_155675_5205_6137 310
91 3300042621 Ga0466729_157648 Ga0466729_157648_266_1198 310
92 3300042621 Ga0466729_239996 Ga0466729_239996_1539_2471 310
93 3300042623 Ga0466734_154640 Ga0466734_154640_50_982 310
94 3300042624 Ga0466735_013961 Ga0466735_013961_132_1064 310
95 3300042624 Ga0466735_072645 Ga0466735_072645_843_1775 310
96 3300042624 Ga0466735_098167 Ga0466735_098167_277_1209 310
97 3300042624 Ga0466735_136106 Ga0466735_136106_12025_12957 310
98 3300042624 Ga0466735_166303 Ga0466735_166303_348_1280 310
99 3300042636 Ga0466703_058449 Ga0466703_058449_349_1281 310
100 3300042636 Ga0466703_069218 Ga0466703_069218_873_1805 310
101 3300042636 Ga0466703_081086 Ga0466703_081086_8887_9819 310
102 3300042636 Ga0466703_116337 Ga0466703_116337_2685_3617 310
103 3300042636 Ga0466703_135491 Ga0466703_135491_1385_2317 310
104 3300042636 Ga0466703_261320 Ga0466703_261320_26304_27236 310
105 3300042643 Ga0466704_162591 Ga0466704_162591_2940_3872 310
106 3300042643 Ga0466704_298510 Ga0466704_298510_3754_4686 310
107 3300042643 Ga0466704_397789 Ga0466704_397789_2569_3501 310
108 3300042643 Ga0466704_404355 Ga0466704_404355_1057_1989 310
109 3300042643 Ga0466704_504980 Ga0466704_504980_1609_2541 310
110 3300042643 Ga0466704_557681 Ga0466704_557681_3950_4882 310
111 3300042643 Ga0466704_561838 Ga0466704_561838_23000_23932 310
112 3300042648 Ga0466709_083260 Ga0466709_083260_2715_3647 310
113 3300042648 Ga0466709_218965 Ga0466709_218965_3685_4617 310
114 3300042648 Ga0466709_281727 Ga0466709_281727_2020_2952 310
115 3300042652 Ga0466708_126656 Ga0466708_126656_9687_10619 310
116 3300042652 Ga0466708_175500 Ga0466708_175500_9152_10084 310
117 3300042655 Ga0466727_042345 Ga0466727_042345_1800_2732 310
118 3300042655 Ga0466727_124126 Ga0466727_124126_5232_6164 310
119 3300042655 Ga0466727_164388 Ga0466727_164388_1974_2906 310
120 3300042655 Ga0466727_259633 Ga0466727_259633_9052_9984 310
121 3300042655 Ga0466727_272373 Ga0466727_272373_2571_3503 310
122 3300042655 Ga0466727_311789 Ga0466727_311789_1498_2430 310
123 3300042656 Ga0466732_439102 Ga0466732_439102_90_1022 310
124 3300042659 Ga0466733_053829 Ga0466733_053829_56472_57404 310
125 iso_pr_bacteria 2820759988 2820761585 310
126 iso_pr_bacteria 2820762746 2820763893 310
127 iso_pr_bacteria 2820778767 2820780621 310
128 iso_pr_bacteria 2923982719 2923984462 310
129 iso_pr_bacteria 2940195863 2940196321 310
130 iso_pr_bacteria 2940212447 2940216066 310
131 iso_pr_bacteria 2940216256 2940217538 310
132 iso_pr_bacteria 2940298504 2940302120 310
133 iso_pr_bacteria 2940302308 2940305922 310
134 iso_pr_bacteria 2940306115 2940309770 310
135 iso_pr_bacteria 2940309933 2940313555 310
136 iso_pr_bacteria 2940313741 2940317421 310
137 iso_pr_bacteria 2940317558 2940321234 310
138 iso_pr_bacteria 2940321370 2940325047 310
139 iso_pr_bacteria 2940325180 2940328792 310
140 iso_pr_bacteria 2940328985 2940332601 310
141 iso_pr_bacteria 2940332795 2940336472 310
142 iso_pr_bacteria 2940371297 2940372314 310
143 iso_pr_bacteria 2967483437 2967483597 310
144 3300000062 IMNBL1DRAFT_c0000378 IMNBL1DRAFT_000037828 311
145 3300000062 IMNBL1DRAFT_c0000550 IMNBL1DRAFT_000055018 311
146 3300000062 IMNBL1DRAFT_c0000967 IMNBL1DRAFT_000096720 311
147 3300000062 IMNBL1DRAFT_c0005689 IMNBL1DRAFT_00056896 311
148 3300000062 IMNBL1DRAFT_c0007528 IMNBL1DRAFT_00075282 311
149 3300000062 IMNBL1DRAFT_c0009894 IMNBL1DRAFT_00098942 311
150 3300000062 IMNBL1DRAFT_c0022945 IMNBL1DRAFT_00229454 311
151 3300002462 JGI24702J35022_10001025 JGI24702J35022_100010252 311
152 3300002509 JGI24699J35502_11127536 JGI24699J35502_111275363 311
153 3300002509 JGI24699J35502_11134045 JGI24699J35502_111340459 311
154 3300002509 JGI24699J35502_11134056 JGI24699J35502_111340567 311
155 3300005071 Ga0068302_10002731 Ga0068302_100027311 311
156 3300009784 Ga0123357_10001231 Ga0123357_1000123112 311
157 3300009784 Ga0123357_10003012 Ga0123357_100030126 311
158 3300009784 Ga0123357_10008613 Ga0123357_100086137 311
159 3300009784 Ga0123357_10010334 Ga0123357_100103343 311
160 3300009784 Ga0123357_10030231 Ga0123357_100302316 311
161 3300009784 Ga0123357_10048971 Ga0123357_100489714 311
162 3300009784 Ga0123357_10064151 Ga0123357_100641512 311
163 3300010049 Ga0123356_10005302 Ga0123356_100053029 311
164 3300010167 Ga0123353_10100763 Ga0123353_101007631 311
165 3300010167 Ga0123353_10121192 Ga0123353_101211923 311
166 3300010167 Ga0123353_10438278 Ga0123353_104382783 311
167 3300010882 Ga0123354_10001542 Ga0123354_1000154215 311
168 3300010882 Ga0123354_10005342 Ga0123354_1000534212 311
169 3300010882 Ga0123354_10017098 Ga0123354_100170987 311
170 3300010882 Ga0123354_10019502 Ga0123354_100195024 311
171 3300010882 Ga0123354_10039470 Ga0123354_100394703 311
172 3300010882 Ga0123354_10082299 Ga0123354_100822992 311
173 3300010882 Ga0123354_10236051 Ga0123354_102360513 311
174 3300010882 Ga0123354_10332567 Ga0123354_103325672 311
175 3300042593 Ga0466691_195452 Ga0466691_195452_5482_6417 311
176 3300042601 Ga0466707_104360 Ga0466707_104360_2966_3901 311
177 3300042601 Ga0466707_305705 Ga0466707_305705_34874_35809 311
178 3300042606 Ga0466719_372237 Ga0466719_372237_5461_6399 312
179 3300042616 Ga0466715_484239 Ga0466715_484239_7486_8424 312
180 3300042624 Ga0466735_054067 Ga0466735_054067_160_1098 312
181 3300042636 Ga0466703_076148 Ga0466703_076148_11605_12543 312
182 3300042643 Ga0466704_073513 Ga0466704_073513_4653_5591 312
183 3300042602 Ga0466713_056151 Ga0466713_056151_18202_19143 313
184 3300042636 Ga0466703_385649 Ga0466703_385649_1050_1991 313
185 3300005083 Ga0068305_10321584 Ga0068305_103215842 314
186 3300042593 Ga0466691_089505 Ga0466691_089505_1475_2425 316
187 3300042616 Ga0466715_076359 Ga0466715_076359_5197_6153 318
188 3300042618 Ga0466723_113565 Ga0466723_113565_82_1041 319
189 3300042605 Ga0466716_281169 Ga0466716_281169_684_1646 320
190 3300002462 JGI24702J35022_10004410 JGI24702J35022_100044105 325
191 3300042643 Ga0466704_210305 Ga0466704_210305_4660_5763 367

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03193 RsgA_GTPase RsgA GTPase 63 239 0.96
PF16745 RsgA_N RsgA N-terminal domain 2 60 0.95
PF01926 MMR_HSR1 50S ribosome-binding GTPase 176 235 0.67

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01926 GO:0005525 GTP binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.