Protein Family IF05747

Metagenome Isolate
173 Members
60 Samples
164 Scaffolds
577.17 Avg Length

🧬 Representative Sequence

ID
3300042600|Ga0466700_355727|Ga0466700_355727_61_1926
Length
621 aa
Sequence
LPYTESQDIFHSTGKKDLTHKLKTFLIHLIFVLLKHSFVKNTKMDNNQIFSDVKKKAATWLSDAFDENTRTQVQNMMDSHPDELTECFYRNLEFGTGGLRGLMGAGTNRMNIYTVGMATQGLCNYLKRNFASLPQIKVAIAHDSRNNSRLFAETTAGIFAANGIRVYLFDALRPTPELSFTIRHFGCQSGVVITASHNPKEYNGYKAYWDDGGQVISPHDKGIIEEVNRTTIESVKFNGPKELITVIGKEIDEIYTDAIVGLSLSPEAIARHSDLKIVYTPIHGTGVELVPMTLKKKGFTNIYHIPEQNVPDGNFPTVKSPNPEESAALNLAMQKAKEVDADIVMGTDPDADRVGIAVKNGTGEWVILNGNQAAAVLIYYLLKRWDELGKLKGSEYIVKTIVTSELLAEIATDCQVPYFDVLTGFKWIADVIRRNEGAKTFIGGGEESYGYLCGEFVRDKDAVMSCAFFAEIAAWAKDQGKTMFDILIDIYVNYNFYKETGVSVVKTGKSGAEEIKAMMETYRKTPLKTLGGSPVVKLLDYEMQIAADLTTGKTEKIDLPKSDVLQFLTADGTKVSIRPSGTEPKIKYYISVKEPLPSVADYARVNEALDARIEDIVNELK

📊 Sample Types

Isolate 5.2%
Metagenome 94.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.0%
Kalotermitidae 23.3%
Unclassified 15.0%
Formicidae 5.0%
Rhinotermitidae 5.0%
Termopsidae 5.0%
Blattidae 3.3%
Passalidae 3.3%
Culicidae 1.7%
Hodotermitidae 1.7%
Nephropidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 169
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
14 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
15 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
16 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
17 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
18 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
25 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
26 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
27 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
28 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
29 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
30 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
31 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
32 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
35 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
36 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
37 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
38 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
39 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
42 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
43 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
44 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
45 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
46 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
47 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
48 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
49 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
50 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
51 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
52 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
53 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
54 2920168565 Paludibacter sp. 221 Isolate Blattidae
55 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
56 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
57 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
58 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
59 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
60 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_061622 3300042659 Bacteria 45413
2 Ga0123356_10059673 3300010049 Bacteria 3559
3 Ga0123353_10006245 3300010167 Bacteria 15841
4 Ga0466711_001323 3300042615 Bacteria 18790
5 Ga0466711_136051 3300042615 Bacteria 2788
6 Ga0466711_502333 3300042615 Bacteria 6123
7 Ga0466723_290087 3300042618 Bacteria 15581
8 Ga0456237_0000003 3300041968 Bacteria 82299
9 Ga0466690_043583 3300042590 Bacteria 17399
10 Ga0466690_260668 3300042590 Bacteria 3671
11 Ga0466690_400825 3300042590 Bacteria 16559
12 Ga0466696_268297 3300042596 Bacteria 13144
13 Ga0466707_188845 3300042601 Bacteria 16270
14 Ga0466717_083412 3300042604 Bacteria 6099
15 Ga0466719_183714 3300042606 Bacteria 4722
16 Ga0466722_111476 3300042609 Bacteria 56871
17 JGI24702J35022_10000981 3300002462 Bacteria 17869
18 Ga0103263_100715 3300007042 Bacteria 4531
19 Ga0123357_10000677 3300009784 Bacteria 34044
20 Ga0466733_056566 3300042659 Bacteria 66737
21 Ga0466733_105048 3300042659 Bacteria 8040
22 Ga0123354_10034860 3300010882 Bacteria 7865
23 Ga0466715_064402 3300042616 Bacteria 36083
24 Ga0466715_402756 3300042616 Bacteria 7590
25 Ga0466723_014070 3300042618 Bacteria 20985
26 Ga0466723_053207 3300042618 Bacteria 23381
27 Ga0466723_064404 3300042618 Bacteria 11296
28 Ga0466723_164021 3300042618 Bacteria 38027
29 Ga0466657_250983 3300042582 Bacteria 7232
30 Ga0466690_153082 3300042590 Bacteria 5189
31 Ga0466690_295206 3300042590 Bacteria 14105
32 Ga0466693_178590 3300042592 Bacteria 5368
33 Ga0466691_173679 3300042593 Bacteria 10823
34 Ga0466706_036961 3300042599 Bacteria 15127
35 Ga0466706_060848 3300042599 Bacteria 6158
36 Ga0466714_093285 3300042603 Bacteria 105352
37 Ga0466716_397325 3300042605 Bacteria 4491
38 Ga0068305_10000300 3300005083 Bacteria 21290
39 Ga0466709_016315 3300042648 Bacteria 10373
40 Ga0466724_00883 3300042649 Bacteria 15481
41 Ga0466708_041066 3300042652 Bacteria 12959
42 Ga0466708_110426 3300042652 Bacteria 6520
43 Ga0466727_294835 3300042655 Bacteria 4715
44 Ga0123353_10028875 3300010167 Bacteria 8534
45 Ga0123353_10276362 3300010167 Bacteria 2583
46 Ga0466711_099584 3300042615 Bacteria 34400
47 Ga0466715_128475 3300042616 Bacteria 2425
48 Ga0466715_160060 3300042616 Bacteria 3182
49 Ga0466715_221281 3300042616 Bacteria 18002
50 Ga0466715_554015 3300042616 Bacteria 5583
51 Ga0466723_019379 3300042618 Bacteria 15330
52 Ga0160472_100025 3300012839 Bacteria 320056
53 Ga0466691_185768 3300042593 Bacteria 8529
54 Ga0466696_156913 3300042596 Bacteria 7767
55 Ga0466700_403019 3300042600 Bacteria 2790
56 Ga0466713_041659 3300042602 Bacteria 15881
57 Ga0466717_018136 3300042604 Bacteria 2630
58 Ga0466716_288764 3300042605 Bacteria 43815
59 Ga0466722_182057 3300042609 Bacteria 3545
60 Ga0466703_252887 3300042636 Bacteria 12128
61 Ga0466703_402500 3300042636 Bacteria 4186
62 Ga0466704_030571 3300042643 Bacteria 29418
63 Ga0466709_139708 3300042648 Bacteria 1934
64 Ga0466708_052136 3300042652 Bacteria 19216
65 Ga0466727_032046 3300042655 Bacteria 9291
66 Ga0466705_142390 3300042612 Bacteria 11920
67 Ga0466733_025323 3300042659 Bacteria 2763
68 Ga0123353_10015042 3300010167 Bacteria 11205
69 Ga0123354_10061188 3300010882 Bacteria 5559
70 Ga0466715_125679 3300042616 Bacteria 15585
71 Ga0466715_376733 3300042616 Bacteria 17373
72 Ga0466723_294656 3300042618 Bacteria 18347
73 Ga0466723_323721 3300042618 Bacteria 25497
74 Ga0466728_291780 3300042620 Bacteria 2308
75 Ga0466690_299089 3300042590 Bacteria 33566
76 Ga0466701_065689 3300042598 Bacteria 3953
77 Ga0466707_034938 3300042601 Bacteria 23566
78 Ga0466707_231570 3300042601 Bacteria 22207
79 Ga0068305_10025582 3300005083 Bacteria 10039
80 Ga0466703_160339 3300042636 Bacteria 9123
81 Ga0466704_227670 3300042643 Bacteria 14516
82 Ga0466704_403719 3300042643 Bacteria 10396
83 Ga0466725_187504 3300042654 Bacteria 31004
84 Ga0466697_168887 3300042611 Bacteria 9525
85 Ga0466705_211173 3300042612 Bacteria 7116
86 Ga0466711_042033 3300042615 Bacteria 11823
87 Ga0466711_104172 3300042615 Bacteria 17590
88 Ga0466728_341550 3300042620 Bacteria 38650
89 Ga0466728_368254 3300042620 Bacteria 2620
90 Ga0466690_269808 3300042590 Unclassified 4456
91 Ga0466691_071250 3300042593 Bacteria 14524
92 Ga0466691_129914 3300042593 Bacteria 2574
93 Ga0466706_028017 3300042599 Bacteria 30169
94 Ga0466706_289888 3300042599 Bacteria 10166
95 Ga0466713_105925 3300042602 Bacteria 5280
96 Ga0466716_063803 3300042605 Bacteria 2345
97 JGI24702J35022_10005345 3300002462 Bacteria 7524
98 JGI24696J40584_12956634 3300002834 Bacteria 3176
99 Ga0466735_194555 3300042624 Bacteria 4893
100 Ga0466708_224582 3300042652 Bacteria 11662
101 Ga0466727_015058 3300042655 Bacteria 77303
102 Ga0466705_198636 3300042612 Bacteria 3770
103 Ga0466732_161338 3300042656 Bacteria 2654
104 Ga0466715_205744 3300042616 Bacteria 41900
105 Ga0466723_095909 3300042618 Unclassified 7807
106 Ga0466690_044861 3300042590 Bacteria 3336
107 Ga0466690_108802 3300042590 Bacteria 9746
108 Ga0466696_001652 3300042596 Bacteria 32781
109 Ga0466696_467056 3300042596 Bacteria 1898
110 Ga0466707_288988 3300042601 Bacteria 3836
111 Ga0466713_112630 3300042602 Bacteria 50784
112 Ga0466714_124101 3300042603 Bacteria 30720
113 Ga0466719_498714 3300042606 Bacteria 2510
114 Ga0466698_392930 3300042610 Bacteria 2059
115 IMNBL1DRAFT_c0001430 3300000062 Bacteria 17865
116 IMNBL1DRAFT_c0015056 3300000062 Bacteria 3373
117 JGI24695J34938_10003522 3300002450 Bacteria 10862
118 JGI24702J35022_10000464 3300002462 Bacteria 24409
119 Ga0102740_1001256 3300007140 Bacteria 6565
120 Ga0466735_086464 3300042624 Bacteria 5544
121 Ga0466735_190007 3300042624 Bacteria 3006
122 Ga0466703_260613 3300042636 Bacteria 18120
123 Ga0466709_346172 3300042648 Bacteria 19067
124 Ga0466708_172128 3300042652 Bacteria 12283
125 Ga0466708_379152 3300042652 Bacteria 6693
126 Ga0466725_461920 3300042654 Bacteria 38511
127 Ga0466727_351902 3300042655 Bacteria 5100
128 Ga0123354_10002184 3300010882 Bacteria 25403
129 Ga0466715_079603 3300042616 Bacteria 222305
130 Ga0466715_179288 3300042616 Bacteria 26870
131 Ga0466715_402871 3300042616 Bacteria 5487
132 Ga0466728_464616 3300042620 Bacteria 1801
133 Ga0466691_031323 3300042593 Unclassified 6026
134 Ga0466695_239997 3300042595 Bacteria 2353
135 Ga0466706_007074 3300042599 Bacteria 64572
136 Ga0466700_355727 3300042600 Bacteria 2077
137 Ga0466713_024240 3300042602 Bacteria 50826
138 Ga0466713_095475 3300042602 Bacteria 20507
139 Ga0466714_025158 3300042603 Bacteria 61228
140 Ga0466716_287438 3300042605 Bacteria 18951
141 Ga0466719_208696 3300042606 Bacteria 21658
142 Ga0466719_444908 3300042606 Bacteria 6268
143 IMNBL1DRAFT_c0009973 3300000062 Bacteria 4610
144 IMNBL1DRAFT_c0013541 3300000062 Bacteria 3651
145 JGI24702J35022_10013273 3300002462 Bacteria 4564
146 Ga0068302_10049242 3300005071 Bacteria 4274
147 Ga0466705_069154 3300042612 Bacteria 4656
148 Ga0466733_094453 3300042659 Bacteria 2831
149 Ga0123356_10125292 3300010049 Bacteria 2506
150 Ga0466711_430183 3300042615 Bacteria 17883
151 Ga0466692_183364 3300042591 Bacteria 4519
152 Ga0466695_246679 3300042595 Bacteria 2505
153 Ga0466696_104752 3300042596 Bacteria 4437
154 Ga0466696_399392 3300042596 Bacteria 3393
155 Ga0466706_131766 3300042599 Bacteria 12916
156 Ga0466713_110523 3300042602 Bacteria 3368
157 Ga0466722_031691 3300042609 Bacteria 2509
158 Ga0466722_075216 3300042609 Bacteria 4749
159 2227280804 2225789004 Unclassified 6811
160 CVPL010W_10001073 3300002931 Bacteria 44186
161 Ga0466734_104460 3300042623 Bacteria 3583
162 Ga0466703_286348 3300042636 Bacteria 7433
163 Ga0466704_559893 3300042643 Bacteria 21909
164 Ga0466709_410572 3300042648 Bacteria 35233

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042610 Ga0466698_392930 Ga0466698_392930_505_2049 514
2 3300042616 Ga0466715_125679 Ga0466715_125679_3342_5066 542
3 3300042596 Ga0466696_104752 Ga0466696_104752_2167_3924 546
4 3300042596 Ga0466696_268297 Ga0466696_268297_10097_11812 546
5 3300007042 Ga0103263_100715 Ga0103263_1007152 547
6 3300042649 Ga0466724_00883 Ga0466724_00883_6372_8108 547
7 3300002931 CVPL010W_10001073 CVPL010W_100010733 550
8 3300042616 Ga0466715_221281 Ga0466715_221281_14957_16684 550
9 3300042624 Ga0466735_190007 Ga0466735_190007_437_2200 551
10 3300042599 Ga0466706_131766 Ga0466706_131766_225_1973 552
11 3300042618 Ga0466723_095909 Ga0466723_095909_5835_7565 552
12 3300042636 Ga0466703_402500 Ga0466703_402500_2255_4003 552
13 3300042601 Ga0466707_288988 Ga0466707_288988_729_2459 554
14 3300042590 Ga0466690_108802 Ga0466690_108802_72_1823 556
15 3300042652 Ga0466708_172128 Ga0466708_172128_8471_10204 556
16 3300042602 Ga0466713_112630 Ga0466713_112630_4149_5897 558
17 3300042616 Ga0466715_179288 Ga0466715_179288_2168_3901 559
18 3300042593 Ga0466691_185768 Ga0466691_185768_6612_8345 560
19 3300005083 Ga0068305_10025582 Ga0068305_100255823 562
20 3300042606 Ga0466719_208696 Ga0466719_208696_8636_10384 562
21 3300042602 Ga0466713_095475 Ga0466713_095475_2764_4512 563
22 3300042602 Ga0466713_024240 Ga0466713_024240_44499_46193 564
23 3300042616 Ga0466715_160060 Ga0466715_160060_1360_3108 564
24 3300002462 JGI24702J35022_10013273 JGI24702J35022_100132733 566
25 3300042618 Ga0466723_053207 Ga0466723_053207_9451_11214 566
26 3300042602 Ga0466713_041659 Ga0466713_041659_238_1986 567
27 3300042602 Ga0466713_105925 Ga0466713_105925_2473_4224 568
28 3300042602 Ga0466713_110523 Ga0466713_110523_1544_3295 568
29 3300042604 Ga0466717_018136 Ga0466717_018136_493_2199 568
30 3300042615 Ga0466711_099584 Ga0466711_099584_24505_26259 568
31 3300007140 Ga0102740_1001256 Ga0102740_10012565 569
32 iso_pr_bacteria 2894649344 2894651690 569
33 3300042596 Ga0466696_467056 Ga0466696_467056_161_1873 570
34 3300042618 Ga0466723_323721 Ga0466723_323721_14986_16734 571
35 3300042590 Ga0466690_295206 Ga0466690_295206_1181_2917 572
36 3300042605 Ga0466716_288764 Ga0466716_288764_24625_26379 572
37 3300042654 Ga0466725_187504 Ga0466725_187504_25216_26964 572
38 3300042590 Ga0466690_153082 Ga0466690_153082_811_2532 573
39 3300042615 Ga0466711_430183 Ga0466711_430183_5934_7655 573
40 3300042590 Ga0466690_299089 Ga0466690_299089_16701_18425 574
41 3300042615 Ga0466711_042033 Ga0466711_042033_2726_4450 574
42 3300042624 Ga0466735_086464 Ga0466735_086464_3486_5234 574
43 3300042652 Ga0466708_041066 Ga0466708_041066_1439_3163 574
44 3300000062 IMNBL1DRAFT_c0009973 IMNBL1DRAFT_00099732 575
45 3300012839 Ga0160472_100025 Ga0160472_100025103 575
46 3300041968 Ga0456237_0000003 Ga0456237_0000003_35065_36816 575
47 3300042582 Ga0466657_250983 Ga0466657_250983_3995_5722 575
48 3300042590 Ga0466690_043583 Ga0466690_043583_7991_9718 575
49 3300042596 Ga0466696_001652 Ga0466696_001652_221_1948 575
50 3300042616 Ga0466715_402871 Ga0466715_402871_726_2453 575
51 3300042624 Ga0466735_194555 Ga0466735_194555_2455_4182 575
52 3300042655 Ga0466727_015058 Ga0466727_015058_6919_8646 575
53 3300042593 Ga0466691_031323 Ga0466691_031323_3963_5693 576
54 3300042595 Ga0466695_239997 Ga0466695_239997_294_2024 576
55 3300042600 Ga0466700_403019 Ga0466700_403019_951_2681 576
56 3300042601 Ga0466707_231570 Ga0466707_231570_13036_14766 576
57 3300042606 Ga0466719_498714 Ga0466719_498714_764_2494 576
58 3300042612 Ga0466705_142390 Ga0466705_142390_4698_6428 576
59 3300042616 Ga0466715_128475 Ga0466715_128475_406_2136 576
60 3300042616 Ga0466715_376733 Ga0466715_376733_14024_15754 576
61 3300042618 Ga0466723_014070 Ga0466723_014070_15484_17214 576
62 3300042620 Ga0466728_341550 Ga0466728_341550_18875_20605 576
63 3300042652 Ga0466708_379152 Ga0466708_379152_3887_5617 576
64 iso_pr_bacteria 2820736622 2820736839 576
65 iso_pr_bacteria 2820740053 2820740173 576
66 iso_pr_bacteria 2838772460 2838773204 576
67 3300000062 IMNBL1DRAFT_c0013541 IMNBL1DRAFT_00135412 577
68 3300002462 JGI24702J35022_10000464 JGI24702J35022_1000046414 577
69 3300005071 Ga0068302_10049242 Ga0068302_100492423 577
70 3300042590 Ga0466690_269808 Ga0466690_269808_1368_3101 577
71 3300042605 Ga0466716_397325 Ga0466716_397325_1727_3460 577
72 3300042618 Ga0466723_294656 Ga0466723_294656_15400_17133 577
73 3300042643 Ga0466704_403719 Ga0466704_403719_7669_9402 577
74 3300042652 Ga0466708_110426 Ga0466708_110426_4136_5869 577
75 3300010049 Ga0123356_10125292 Ga0123356_101252922 578
76 3300042593 Ga0466691_173679 Ga0466691_173679_4039_5775 578
77 3300042609 Ga0466722_031691 Ga0466722_031691_515_2251 578
78 3300042609 Ga0466722_111476 Ga0466722_111476_51709_53445 578
79 3300042609 Ga0466722_182057 Ga0466722_182057_162_1898 578
80 3300042615 Ga0466711_001323 Ga0466711_001323_4929_6665 578
81 3300042616 Ga0466715_205744 Ga0466715_205744_4815_6551 578
82 3300042604 Ga0466717_083412 Ga0466717_083412_1135_2874 579
83 3300042612 Ga0466705_198636 Ga0466705_198636_1208_2947 579
84 3300042612 Ga0466705_211173 Ga0466705_211173_420_2159 579
85 3300042659 Ga0466733_094453 Ga0466733_094453_616_2355 579
86 3300042659 Ga0466733_105048 Ga0466733_105048_4357_6096 579
87 3300010167 Ga0123353_10006245 Ga0123353_100062457 580
88 3300010167 Ga0123353_10015042 Ga0123353_100150426 580
89 3300010167 Ga0123353_10028875 Ga0123353_100288753 580
90 3300010167 Ga0123353_10276362 Ga0123353_102763621 580
91 3300010882 Ga0123354_10034860 Ga0123354_100348604 580
92 3300010882 Ga0123354_10061188 Ga0123354_100611882 580
93 3300042593 Ga0466691_129914 Ga0466691_129914_809_2551 580
94 3300042599 Ga0466706_007074 Ga0466706_007074_55919_57661 580
95 3300042599 Ga0466706_060848 Ga0466706_060848_3781_5523 580
96 3300042618 Ga0466723_019379 Ga0466723_019379_10367_12109 580
97 3300042620 Ga0466728_291780 Ga0466728_291780_206_1948 580
98 3300042643 Ga0466704_559893 Ga0466704_559893_1664_3406 580
99 3300042648 Ga0466709_016315 Ga0466709_016315_6275_8071 580
100 2225789004 2227280804 2227732674 581
101 3300005083 Ga0068305_10000300 Ga0068305_100003009 581
102 3300042591 Ga0466692_183364 Ga0466692_183364_946_2691 581
103 3300042603 Ga0466714_124101 Ga0466714_124101_10866_12611 581
104 3300042659 Ga0466733_025323 Ga0466733_025323_761_2506 581
105 3300042659 Ga0466733_061622 Ga0466733_061622_41029_42774 581
106 iso_pr_bacteria 2695420931 2698110454 581
107 3300042592 Ga0466693_178590 Ga0466693_178590_1046_2794 582
108 3300042593 Ga0466691_071250 Ga0466691_071250_340_2088 582
109 3300042596 Ga0466696_399392 Ga0466696_399392_1311_3059 582
110 3300042599 Ga0466706_028017 Ga0466706_028017_2332_4080 582
111 3300042599 Ga0466706_036961 Ga0466706_036961_5533_7281 582
112 3300042603 Ga0466714_025158 Ga0466714_025158_19252_21000 582
113 3300042615 Ga0466711_104172 Ga0466711_104172_14549_16297 582
114 3300042618 Ga0466723_064404 Ga0466723_064404_7192_8940 582
115 3300042620 Ga0466728_464616 Ga0466728_464616_13_1761 582
116 3300042623 Ga0466734_104460 Ga0466734_104460_1082_2830 582
117 3300042636 Ga0466703_252887 Ga0466703_252887_5287_7035 582
118 3300042636 Ga0466703_286348 Ga0466703_286348_5505_7253 582
119 3300042643 Ga0466704_030571 Ga0466704_030571_10419_12167 582
120 3300042643 Ga0466704_227670 Ga0466704_227670_454_2202 582
121 3300042648 Ga0466709_410572 Ga0466709_410572_24283_26031 582
122 3300042652 Ga0466708_052136 Ga0466708_052136_315_2063 582
123 3300042652 Ga0466708_224582 Ga0466708_224582_8211_9959 582
124 3300042654 Ga0466725_461920 Ga0466725_461920_3716_5464 582
125 3300042655 Ga0466727_032046 Ga0466727_032046_462_2210 582
126 3300042656 Ga0466732_161338 Ga0466732_161338_109_1857 582
127 3300042659 Ga0466733_056566 Ga0466733_056566_41322_43070 582
128 iso_pr_bacteria 2781125634 2781274951 582
129 iso_pr_bacteria 2920168565 2920170228 582
130 iso_pr_bacteria 2940195863 2940197550 582
131 3300000062 IMNBL1DRAFT_c0001430 IMNBL1DRAFT_000143014 583
132 3300000062 IMNBL1DRAFT_c0015056 IMNBL1DRAFT_00150561 583
133 3300002450 JGI24695J34938_10003522 JGI24695J34938_100035224 583
134 3300002462 JGI24702J35022_10005345 JGI24702J35022_100053455 583
135 3300042590 Ga0466690_044861 Ga0466690_044861_728_2479 583
136 3300042601 Ga0466707_034938 Ga0466707_034938_6345_8096 583
137 3300042601 Ga0466707_188845 Ga0466707_188845_12877_14628 583
138 3300042605 Ga0466716_063803 Ga0466716_063803_341_2092 583
139 3300042615 Ga0466711_502333 Ga0466711_502333_3800_5551 583
140 3300042616 Ga0466715_064402 Ga0466715_064402_7600_9351 583
141 3300042618 Ga0466723_164021 Ga0466723_164021_35046_36797 583
142 3300042618 Ga0466723_290087 Ga0466723_290087_3306_5057 583
143 3300042620 Ga0466728_368254 Ga0466728_368254_42_1793 583
144 3300042648 Ga0466709_139708 Ga0466709_139708_119_1870 583
145 3300042648 Ga0466709_346172 Ga0466709_346172_4475_6226 583
146 3300042655 Ga0466727_294835 Ga0466727_294835_2788_4539 583
147 3300002462 JGI24702J35022_10000981 JGI24702J35022_100009813 584
148 3300042606 Ga0466719_183714 Ga0466719_183714_1093_2847 584
149 3300042609 Ga0466722_075216 Ga0466722_075216_2317_4071 584
150 3300042616 Ga0466715_079603 Ga0466715_079603_72497_74251 584
151 3300009784 Ga0123357_10000677 Ga0123357_1000067716 585
152 3300042590 Ga0466690_400825 Ga0466690_400825_14574_16331 585
153 3300042598 Ga0466701_065689 Ga0466701_065689_1784_3571 585
154 3300002834 JGI24696J40584_12956634 JGI24696J40584_129566342 587
155 3300042616 Ga0466715_554015 Ga0466715_554015_160_1923 587
156 3300010049 Ga0123356_10059673 Ga0123356_100596733 588
157 iso_pr_bacteria 643348524 643423308 588
158 3300042616 Ga0466715_402756 Ga0466715_402756_484_2253 589
159 3300042611 Ga0466697_168887 Ga0466697_168887_662_2437 591
160 3300042603 Ga0466714_093285 Ga0466714_093285_77580_79358 592
161 3300042636 Ga0466703_160339 Ga0466703_160339_1512_3290 592
162 3300010882 Ga0123354_10002184 Ga0123354_100021849 593
163 3300042636 Ga0466703_260613 Ga0466703_260613_8897_10678 593
164 3300042590 Ga0466690_260668 Ga0466690_260668_401_2185 594
165 3300042595 Ga0466695_246679 Ga0466695_246679_470_2254 594
166 3300042605 Ga0466716_287438 Ga0466716_287438_324_2108 594
167 3300042599 Ga0466706_289888 Ga0466706_289888_3770_5557 595
168 3300042606 Ga0466719_444908 Ga0466719_444908_2794_4587 597
169 3300042612 Ga0466705_069154 Ga0466705_069154_955_2811 597
170 3300042655 Ga0466727_351902 Ga0466727_351902_3096_4889 597
171 3300042615 Ga0466711_136051 Ga0466711_136051_79_1875 598
172 3300042600 Ga0466700_355727 Ga0466700_355727_61_1926 621
173 3300042596 Ga0466696_156913 Ga0466696_156913_4223_6202 659

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I 93 230 0.97
PF02880 PGM_PMM_III Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III 369 491 0.93
PF02879 PGM_PMM_II Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II 255 361 0.91

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02879 GO:0005975 carbohydrate metabolic process BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.