Protein Family IF05739

Metagenome Isolate
106 Members
40 Samples
104 Scaffolds
114.81 Avg Length

🧬 Representative Sequence

ID
3300042600|Ga0466700_274607|Ga0466700_274607_293_673
Length
126 aa
Sequence
MSSHEKQINKKVMENILKYNDFIATVKYSEEDEAFIGRIEGIASVVSFEGQSVKELKSAFQDAVESYLDFCGRKGISEPQKSYTGIFNVRIDADLHRRAAITAKMHGSTLNAFVKKAIERNLEYVH

📊 Sample Types

Isolate 1.9%
Metagenome 98.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 60.5%
Kalotermitidae 23.7%
Unclassified 7.9%
Termopsidae 2.6%
Hodotermitidae 2.6%
Rhinotermitidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 87
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
2 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
3 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
4 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
9 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
10 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
11 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
12 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
13 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
14 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
15 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
18 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
19 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
20 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
21 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
22 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
23 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
24 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
25 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
26 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
27 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
28 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
29 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
30 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
31 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
32 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
33 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
35 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
36 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
37 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
38 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
39 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
40 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0072941_1308615 3300005201 Bacteria 1122
2 Ga0123356_10230541 3300010049 Bacteria 1916
3 Ga0123354_10273013 3300010882 Bacteria 1660
4 Ga0466705_120822 3300042612 Bacteria 5191
5 Ga0466710_287077 3300042613 Bacteria 1450
6 Ga0466715_503177 3300042616 Bacteria 8706
7 Ga0466706_016198 3300042599 Unclassified 1854
8 Ga0466717_122378 3300042604 Bacteria 3552
9 Ga0265387_1012085 3300024582 Bacteria 1194
10 Ga0466703_152083 3300042636 Bacteria 5453
11 Ga0123357_10249440 3300009784 Bacteria 1903
12 Ga0123356_10600434 3300010049 Bacteria 1265
13 Ga0123356_10923123 3300010049 Bacteria 1044
14 Ga0466726_434078 3300042619 Unclassified 2575
15 Ga0466728_418633 3300042620 Unclassified 2204
16 Ga0466701_028516 3300042598 Bacteria 8702
17 Ga0466731_371279 3300042622 Bacteria 1341
18 Ga0466704_143999 3300042643 Unclassified 1379
19 Ga0466704_489122 3300042643 Unclassified 1033
20 Ga0466704_575968 3300042643 Unclassified 4779
21 Ga0123357_10000088 3300009784 Bacteria 73731
22 Ga0123357_10360297 3300009784 Bacteria 1378
23 Ga0123356_12028270 3300010049 Unclassified 718
24 Ga0466710_215200 3300042613 Bacteria 1613
25 Ga0466711_295382 3300042615 Bacteria 4735
26 Ga0466707_065452 3300042601 Bacteria 19428
27 Ga0466707_392837 3300042601 Bacteria 2779
28 Ga0466690_024847 3300042590 Bacteria 1999
29 Ga0466699_265600 3300042597 Bacteria 2046
30 Ga0466731_283004 3300042622 Bacteria 1809
31 Ga0466734_103786 3300042623 Bacteria 1115
32 Ga0466704_063605 3300042643 Bacteria 1680
33 Ga0466704_339435 3300042643 Unclassified 1230
34 JGI24702J35022_10053317 3300002462 Unclassified 2157
35 Ga0123357_10726369 3300009784 Bacteria 701
36 Ga0123357_10766346 3300009784 Bacteria 665
37 Ga0123356_10114644 3300010049 Bacteria 2610
38 Ga0123353_10536001 3300010167 Unclassified 1693
39 Ga0123354_10673610 3300010882 Bacteria 731
40 Ga0466705_095408 3300042612 Bacteria 2775
41 Ga0466705_360839 3300042612 Bacteria 1872
42 Ga0466710_029725 3300042613 Bacteria 1200
43 Ga0466728_098008 3300042620 Bacteria 3239
44 Ga0466728_346856 3300042620 Bacteria 3594
45 Ga0466728_367285 3300042620 Bacteria 5504
46 Ga0466717_175259 3300042604 Bacteria 1516
47 Ga0466698_224120 3300042610 Bacteria 1497
48 Ga0466657_192080 3300042582 Unclassified 1840
49 Ga0466703_363106 3300042636 Bacteria 20295
50 Ga0466704_120206 3300042643 Bacteria 5699
51 Ga0466704_132845 3300042643 Unclassified 4644
52 Ga0466725_194319 3300042654 Bacteria 2989
53 JGI24702J35022_10109683 3300002462 Bacteria 1517
54 JGI24702J35022_10861959 3300002462 Bacteria 564
55 JGI24705J35276_11676210 3300002504 Unclassified 622
56 JGI24696J40584_12688284 3300002834 Bacteria 726
57 Ga0123356_10594616 3300010049 Bacteria 1271
58 Ga0123354_10000257 3300010882 Bacteria 47636
59 Ga0466733_031671 3300042659 Bacteria 5037
60 Ga0466718_127160 3300042617 Bacteria 1120
61 Ga0466701_065845 3300042598 Bacteria 1528
62 Ga0466701_087212 3300042598 Bacteria 3342
63 Ga0466703_013719 3300042636 Bacteria 1383
64 Ga0466703_256245 3300042636 Bacteria 3213
65 Ga0466704_143947 3300042643 Bacteria 3670
66 Ga0466704_196233 3300042643 Bacteria 1071
67 Ga0466704_366092 3300042643 Bacteria 11039
68 JGI24695J34938_10245389 3300002450 Bacteria 758
69 Ga0123353_10943586 3300010167 Bacteria 1168
70 Ga0123354_10195559 3300010882 Unclassified 2245
71 Ga0466733_155159 3300042659 Bacteria 16702
72 Ga0466700_274607 3300042600 Bacteria 1225
73 Ga0466707_040792 3300042601 Bacteria 43826
74 Ga0466693_027670 3300042592 Unclassified 4315
75 Ga0466709_247857 3300042648 Bacteria 1506
76 Ga0466725_329015 3300042654 Bacteria 2239
77 JGI24702J35022_10140406 3300002462 Bacteria 1348
78 JGI24699J35502_11134232 3300002509 Bacteria 111679
79 Ga0123357_10001030 3300009784 Bacteria 28577
80 Ga0123357_10299871 3300009784 Bacteria 1625
81 Ga0123356_10309055 3300010049 Bacteria 1689
82 Ga0123353_11078990 3300010167 Bacteria 1069
83 Ga0123353_12723804 3300010167 Bacteria 581
84 Ga0466697_080625 3300042611 Bacteria 1423
85 Ga0466711_116166 3300042615 Bacteria 4398
86 Ga0466728_186852 3300042620 Bacteria 4096
87 Ga0466722_166087 3300042609 Bacteria 1353
88 Ga0466698_438256 3300042610 Bacteria 3820
89 Ga0466657_293621 3300042582 Bacteria 2589
90 Ga0466734_069099 3300042623 Unclassified 2350
91 Ga0466704_497058 3300042643 Bacteria 3211
92 Ga0466704_610396 3300042643 Bacteria 1464
93 Ga0466725_293817 3300042654 Bacteria 1368
94 JGI24705J35276_11914032 3300002504 Bacteria 762
95 Ga0123357_10601188 3300009784 Bacteria 844
96 Ga0123356_10010348 3300010049 Bacteria 9156
97 Ga0466705_081939 3300042612 Unclassified 1392
98 Ga0466710_075316 3300042613 Bacteria 1572
99 Ga0466706_117414 3300042599 Bacteria 1099
100 Ga0466700_254030 3300042600 Bacteria 1114
101 Ga0466716_534667 3300042605 Unclassified 2070
102 Ga0466704_398264 3300042643 Bacteria 5222
103 Ga0466704_608078 3300042643 Bacteria 1038
104 Ga0466704_619624 3300042643 Unclassified 5202

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_11078990 Ga0123353_110789901 102
2 3300042601 Ga0466707_065452 Ga0466707_065452_10_321 103
3 3300042599 Ga0466706_016198 Ga0466706_016198_858_1190 110
4 3300042598 Ga0466701_087212 Ga0466701_087212_1107_1442 111
5 3300042622 Ga0466731_283004 Ga0466731_283004_394_729 111
6 3300042622 Ga0466731_371279 Ga0466731_371279_28_363 111
7 3300042659 Ga0466733_031671 Ga0466733_031671_537_872 111
8 3300042582 Ga0466657_293621 Ga0466657_293621_1242_1580 112
9 3300042590 Ga0466690_024847 Ga0466690_024847_537_875 112
10 3300042615 Ga0466711_116166 Ga0466711_116166_3317_3655 112
11 3300002462 JGI24702J35022_10140406 JGI24702J35022_101404062 113
12 3300010049 Ga0123356_10010348 Ga0123356_100103481 113
13 3300042597 Ga0466699_265600 Ga0466699_265600_1347_1688 113
14 3300042601 Ga0466707_040792 Ga0466707_040792_726_1067 113
15 3300042604 Ga0466717_175259 Ga0466717_175259_1023_1364 113
16 3300042612 Ga0466705_081939 Ga0466705_081939_773_1114 113
17 3300042612 Ga0466705_120822 Ga0466705_120822_3964_4305 113
18 3300042613 Ga0466710_075316 Ga0466710_075316_1182_1523 113
19 3300042617 Ga0466718_127160 Ga0466718_127160_94_435 113
20 3300042620 Ga0466728_098008 Ga0466728_098008_1882_2223 113
21 3300042620 Ga0466728_367285 Ga0466728_367285_1547_1888 113
22 3300042636 Ga0466703_013719 Ga0466703_013719_365_706 113
23 3300042636 Ga0466703_152083 Ga0466703_152083_2717_3058 113
24 3300042643 Ga0466704_063605 Ga0466704_063605_571_912 113
25 3300042643 Ga0466704_132845 Ga0466704_132845_3089_3430 113
26 3300042643 Ga0466704_143947 Ga0466704_143947_2654_2995 113
27 3300042643 Ga0466704_196233 Ga0466704_196233_563_904 113
28 3300042643 Ga0466704_366092 Ga0466704_366092_3923_4264 113
29 3300042643 Ga0466704_497058 Ga0466704_497058_2359_2700 113
30 3300042643 Ga0466704_608078 Ga0466704_608078_579_920 113
31 3300042643 Ga0466704_610396 Ga0466704_610396_525_866 113
32 3300042643 Ga0466704_619624 Ga0466704_619624_1709_2050 113
33 iso_pr_bacteria 2820759988 2820762731 113
34 3300002504 JGI24705J35276_11914032 JGI24705J35276_119140322 114
35 3300002509 JGI24699J35502_11134232 JGI24699J35502_1113423293 114
36 3300002834 JGI24696J40584_12688284 JGI24696J40584_126882842 114
37 3300005201 Ga0072941_1308615 Ga0072941_13086152 114
38 3300009784 Ga0123357_10249440 Ga0123357_102494403 114
39 3300009784 Ga0123357_10601188 Ga0123357_106011882 114
40 3300010049 Ga0123356_10594616 Ga0123356_105946162 114
41 3300010882 Ga0123354_10000257 Ga0123354_1000025739 114
42 3300024582 Ga0265387_1012085 Ga0265387_10120852 114
43 3300042582 Ga0466657_192080 Ga0466657_192080_205_549 114
44 3300042592 Ga0466693_027670 Ga0466693_027670_496_840 114
45 3300042598 Ga0466701_065845 Ga0466701_065845_864_1208 114
46 3300042600 Ga0466700_254030 Ga0466700_254030_493_837 114
47 3300042601 Ga0466707_392837 Ga0466707_392837_1290_1634 114
48 3300042604 Ga0466717_122378 Ga0466717_122378_2864_3208 114
49 3300042605 Ga0466716_534667 Ga0466716_534667_1226_1570 114
50 3300042609 Ga0466722_166087 Ga0466722_166087_759_1103 114
51 3300042610 Ga0466698_224120 Ga0466698_224120_552_896 114
52 3300042610 Ga0466698_438256 Ga0466698_438256_1833_2177 114
53 3300042612 Ga0466705_095408 Ga0466705_095408_879_1223 114
54 3300042613 Ga0466710_029725 Ga0466710_029725_247_591 114
55 3300042613 Ga0466710_215200 Ga0466710_215200_848_1192 114
56 3300042613 Ga0466710_287077 Ga0466710_287077_167_511 114
57 3300042619 Ga0466726_434078 Ga0466726_434078_326_670 114
58 3300042623 Ga0466734_069099 Ga0466734_069099_1634_1978 114
59 3300042636 Ga0466703_256245 Ga0466703_256245_864_1208 114
60 3300042643 Ga0466704_120206 Ga0466704_120206_4526_4870 114
61 3300042648 Ga0466709_247857 Ga0466709_247857_318_662 114
62 3300042654 Ga0466725_194319 Ga0466725_194319_1365_1709 114
63 3300042654 Ga0466725_293817 Ga0466725_293817_398_742 114
64 3300042659 Ga0466733_155159 Ga0466733_155159_1312_1656 114
65 iso_pr_bacteria 2820776227 2820776811 114
66 3300002462 JGI24702J35022_10053317 JGI24702J35022_100533171 115
67 3300002504 JGI24705J35276_11676210 JGI24705J35276_116762101 115
68 3300009784 Ga0123357_10001030 Ga0123357_1000103011 115
69 3300009784 Ga0123357_10299871 Ga0123357_102998713 115
70 3300009784 Ga0123357_10360297 Ga0123357_103602972 115
71 3300010049 Ga0123356_10114644 Ga0123356_101146442 115
72 3300010049 Ga0123356_10230541 Ga0123356_102305412 115
73 3300010049 Ga0123356_10309055 Ga0123356_103090551 115
74 3300010049 Ga0123356_10600434 Ga0123356_106004342 115
75 3300010049 Ga0123356_12028270 Ga0123356_120282703 115
76 3300010167 Ga0123353_12723804 Ga0123353_127238042 115
77 3300010882 Ga0123354_10273013 Ga0123354_102730132 115
78 3300010882 Ga0123354_10673610 Ga0123354_106736102 115
79 3300042643 Ga0466704_143999 Ga0466704_143999_518_865 115
80 3300042643 Ga0466704_575968 Ga0466704_575968_1100_1447 115
81 3300042654 Ga0466725_329015 Ga0466725_329015_389_736 115
82 3300009784 Ga0123357_10000088 Ga0123357_1000008871 116
83 3300009784 Ga0123357_10766346 Ga0123357_107663462 116
84 3300002462 JGI24702J35022_10109683 JGI24702J35022_101096832 117
85 3300002462 JGI24702J35022_10861959 JGI24702J35022_108619591 117
86 3300010049 Ga0123356_10923123 Ga0123356_109231232 117
87 3300042598 Ga0466701_028516 Ga0466701_028516_1277_1630 117
88 3300042620 Ga0466728_186852 Ga0466728_186852_2430_2783 117
89 3300042623 Ga0466734_103786 Ga0466734_103786_272_625 117
90 3300009784 Ga0123357_10726369 Ga0123357_107263692 118
91 3300010167 Ga0123353_10536001 Ga0123353_105360012 118
92 3300042616 Ga0466715_503177 Ga0466715_503177_4521_4877 118
93 3300002450 JGI24695J34938_10245389 JGI24695J34938_102453892 119
94 3300042599 Ga0466706_117414 Ga0466706_117414_450_809 119
95 3300042620 Ga0466728_346856 Ga0466728_346856_266_628 120
96 3300042643 Ga0466704_398264 Ga0466704_398264_1383_1745 120
97 3300042612 Ga0466705_360839 Ga0466705_360839_544_909 121
98 3300042620 Ga0466728_418633 Ga0466728_418633_519_884 121
99 3300042636 Ga0466703_363106 Ga0466703_363106_19838_20203 121
100 3300042643 Ga0466704_339435 Ga0466704_339435_455_820 121
101 3300042643 Ga0466704_489122 Ga0466704_489122_357_722 121
102 3300042615 Ga0466711_295382 Ga0466711_295382_3926_4294 122
103 3300010167 Ga0123353_10943586 Ga0123353_109435861 123
104 3300010882 Ga0123354_10195559 Ga0123354_101955591 123
105 3300042611 Ga0466697_080625 Ga0466697_080625_413_784 123
106 3300042600 Ga0466700_274607 Ga0466700_274607_293_673 126

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF05534 HicB HicB family 67 118 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.6 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.