Protein Family IF05739
Metagenome
Isolate
106
Members
40
Samples
104
Scaffolds
114.81
Avg Length
Representative Sequence
- ID
- 3300042600|Ga0466700_274607|Ga0466700_274607_293_673
- Length
- 126 aa
- Sequence
- MSSHEKQINKKVMENILKYNDFIATVKYSEEDEAFIGRIEGIASVVSFEGQSVKELKSAFQDAVESYLDFCGRKGISEPQKSYTGIFNVRIDADLHRRAAITAKMHGSTLNAFVKKAIERNLEYVH
Sample Types
Isolate
1.9%
Metagenome
98.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
60.5%
Kalotermitidae
23.7%
Unclassified
7.9%
Termopsidae
2.6%
Hodotermitidae
2.6%
Rhinotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
87
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 2 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 3 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 9 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 10 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 13 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 14 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 29 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 30 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 31 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 32 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 33 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 36 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 37 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 38 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0072941_1308615 | 3300005201 | Bacteria | 1122 |
| 2 | Ga0123356_10230541 | 3300010049 | Bacteria | 1916 |
| 3 | Ga0123354_10273013 | 3300010882 | Bacteria | 1660 |
| 4 | Ga0466705_120822 | 3300042612 | Bacteria | 5191 |
| 5 | Ga0466710_287077 | 3300042613 | Bacteria | 1450 |
| 6 | Ga0466715_503177 | 3300042616 | Bacteria | 8706 |
| 7 | Ga0466706_016198 | 3300042599 | Unclassified | 1854 |
| 8 | Ga0466717_122378 | 3300042604 | Bacteria | 3552 |
| 9 | Ga0265387_1012085 | 3300024582 | Bacteria | 1194 |
| 10 | Ga0466703_152083 | 3300042636 | Bacteria | 5453 |
| 11 | Ga0123357_10249440 | 3300009784 | Bacteria | 1903 |
| 12 | Ga0123356_10600434 | 3300010049 | Bacteria | 1265 |
| 13 | Ga0123356_10923123 | 3300010049 | Bacteria | 1044 |
| 14 | Ga0466726_434078 | 3300042619 | Unclassified | 2575 |
| 15 | Ga0466728_418633 | 3300042620 | Unclassified | 2204 |
| 16 | Ga0466701_028516 | 3300042598 | Bacteria | 8702 |
| 17 | Ga0466731_371279 | 3300042622 | Bacteria | 1341 |
| 18 | Ga0466704_143999 | 3300042643 | Unclassified | 1379 |
| 19 | Ga0466704_489122 | 3300042643 | Unclassified | 1033 |
| 20 | Ga0466704_575968 | 3300042643 | Unclassified | 4779 |
| 21 | Ga0123357_10000088 | 3300009784 | Bacteria | 73731 |
| 22 | Ga0123357_10360297 | 3300009784 | Bacteria | 1378 |
| 23 | Ga0123356_12028270 | 3300010049 | Unclassified | 718 |
| 24 | Ga0466710_215200 | 3300042613 | Bacteria | 1613 |
| 25 | Ga0466711_295382 | 3300042615 | Bacteria | 4735 |
| 26 | Ga0466707_065452 | 3300042601 | Bacteria | 19428 |
| 27 | Ga0466707_392837 | 3300042601 | Bacteria | 2779 |
| 28 | Ga0466690_024847 | 3300042590 | Bacteria | 1999 |
| 29 | Ga0466699_265600 | 3300042597 | Bacteria | 2046 |
| 30 | Ga0466731_283004 | 3300042622 | Bacteria | 1809 |
| 31 | Ga0466734_103786 | 3300042623 | Bacteria | 1115 |
| 32 | Ga0466704_063605 | 3300042643 | Bacteria | 1680 |
| 33 | Ga0466704_339435 | 3300042643 | Unclassified | 1230 |
| 34 | JGI24702J35022_10053317 | 3300002462 | Unclassified | 2157 |
| 35 | Ga0123357_10726369 | 3300009784 | Bacteria | 701 |
| 36 | Ga0123357_10766346 | 3300009784 | Bacteria | 665 |
| 37 | Ga0123356_10114644 | 3300010049 | Bacteria | 2610 |
| 38 | Ga0123353_10536001 | 3300010167 | Unclassified | 1693 |
| 39 | Ga0123354_10673610 | 3300010882 | Bacteria | 731 |
| 40 | Ga0466705_095408 | 3300042612 | Bacteria | 2775 |
| 41 | Ga0466705_360839 | 3300042612 | Bacteria | 1872 |
| 42 | Ga0466710_029725 | 3300042613 | Bacteria | 1200 |
| 43 | Ga0466728_098008 | 3300042620 | Bacteria | 3239 |
| 44 | Ga0466728_346856 | 3300042620 | Bacteria | 3594 |
| 45 | Ga0466728_367285 | 3300042620 | Bacteria | 5504 |
| 46 | Ga0466717_175259 | 3300042604 | Bacteria | 1516 |
| 47 | Ga0466698_224120 | 3300042610 | Bacteria | 1497 |
| 48 | Ga0466657_192080 | 3300042582 | Unclassified | 1840 |
| 49 | Ga0466703_363106 | 3300042636 | Bacteria | 20295 |
| 50 | Ga0466704_120206 | 3300042643 | Bacteria | 5699 |
| 51 | Ga0466704_132845 | 3300042643 | Unclassified | 4644 |
| 52 | Ga0466725_194319 | 3300042654 | Bacteria | 2989 |
| 53 | JGI24702J35022_10109683 | 3300002462 | Bacteria | 1517 |
| 54 | JGI24702J35022_10861959 | 3300002462 | Bacteria | 564 |
| 55 | JGI24705J35276_11676210 | 3300002504 | Unclassified | 622 |
| 56 | JGI24696J40584_12688284 | 3300002834 | Bacteria | 726 |
| 57 | Ga0123356_10594616 | 3300010049 | Bacteria | 1271 |
| 58 | Ga0123354_10000257 | 3300010882 | Bacteria | 47636 |
| 59 | Ga0466733_031671 | 3300042659 | Bacteria | 5037 |
| 60 | Ga0466718_127160 | 3300042617 | Bacteria | 1120 |
| 61 | Ga0466701_065845 | 3300042598 | Bacteria | 1528 |
| 62 | Ga0466701_087212 | 3300042598 | Bacteria | 3342 |
| 63 | Ga0466703_013719 | 3300042636 | Bacteria | 1383 |
| 64 | Ga0466703_256245 | 3300042636 | Bacteria | 3213 |
| 65 | Ga0466704_143947 | 3300042643 | Bacteria | 3670 |
| 66 | Ga0466704_196233 | 3300042643 | Bacteria | 1071 |
| 67 | Ga0466704_366092 | 3300042643 | Bacteria | 11039 |
| 68 | JGI24695J34938_10245389 | 3300002450 | Bacteria | 758 |
| 69 | Ga0123353_10943586 | 3300010167 | Bacteria | 1168 |
| 70 | Ga0123354_10195559 | 3300010882 | Unclassified | 2245 |
| 71 | Ga0466733_155159 | 3300042659 | Bacteria | 16702 |
| 72 | Ga0466700_274607 | 3300042600 | Bacteria | 1225 |
| 73 | Ga0466707_040792 | 3300042601 | Bacteria | 43826 |
| 74 | Ga0466693_027670 | 3300042592 | Unclassified | 4315 |
| 75 | Ga0466709_247857 | 3300042648 | Bacteria | 1506 |
| 76 | Ga0466725_329015 | 3300042654 | Bacteria | 2239 |
| 77 | JGI24702J35022_10140406 | 3300002462 | Bacteria | 1348 |
| 78 | JGI24699J35502_11134232 | 3300002509 | Bacteria | 111679 |
| 79 | Ga0123357_10001030 | 3300009784 | Bacteria | 28577 |
| 80 | Ga0123357_10299871 | 3300009784 | Bacteria | 1625 |
| 81 | Ga0123356_10309055 | 3300010049 | Bacteria | 1689 |
| 82 | Ga0123353_11078990 | 3300010167 | Bacteria | 1069 |
| 83 | Ga0123353_12723804 | 3300010167 | Bacteria | 581 |
| 84 | Ga0466697_080625 | 3300042611 | Bacteria | 1423 |
| 85 | Ga0466711_116166 | 3300042615 | Bacteria | 4398 |
| 86 | Ga0466728_186852 | 3300042620 | Bacteria | 4096 |
| 87 | Ga0466722_166087 | 3300042609 | Bacteria | 1353 |
| 88 | Ga0466698_438256 | 3300042610 | Bacteria | 3820 |
| 89 | Ga0466657_293621 | 3300042582 | Bacteria | 2589 |
| 90 | Ga0466734_069099 | 3300042623 | Unclassified | 2350 |
| 91 | Ga0466704_497058 | 3300042643 | Bacteria | 3211 |
| 92 | Ga0466704_610396 | 3300042643 | Bacteria | 1464 |
| 93 | Ga0466725_293817 | 3300042654 | Bacteria | 1368 |
| 94 | JGI24705J35276_11914032 | 3300002504 | Bacteria | 762 |
| 95 | Ga0123357_10601188 | 3300009784 | Bacteria | 844 |
| 96 | Ga0123356_10010348 | 3300010049 | Bacteria | 9156 |
| 97 | Ga0466705_081939 | 3300042612 | Unclassified | 1392 |
| 98 | Ga0466710_075316 | 3300042613 | Bacteria | 1572 |
| 99 | Ga0466706_117414 | 3300042599 | Bacteria | 1099 |
| 100 | Ga0466700_254030 | 3300042600 | Bacteria | 1114 |
| 101 | Ga0466716_534667 | 3300042605 | Unclassified | 2070 |
| 102 | Ga0466704_398264 | 3300042643 | Bacteria | 5222 |
| 103 | Ga0466704_608078 | 3300042643 | Bacteria | 1038 |
| 104 | Ga0466704_619624 | 3300042643 | Unclassified | 5202 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010167 | Ga0123353_11078990 | Ga0123353_110789901 | 102 |
| 2 | 3300042601 | Ga0466707_065452 | Ga0466707_065452_10_321 | 103 |
| 3 | 3300042599 | Ga0466706_016198 | Ga0466706_016198_858_1190 | 110 |
| 4 | 3300042598 | Ga0466701_087212 | Ga0466701_087212_1107_1442 | 111 |
| 5 | 3300042622 | Ga0466731_283004 | Ga0466731_283004_394_729 | 111 |
| 6 | 3300042622 | Ga0466731_371279 | Ga0466731_371279_28_363 | 111 |
| 7 | 3300042659 | Ga0466733_031671 | Ga0466733_031671_537_872 | 111 |
| 8 | 3300042582 | Ga0466657_293621 | Ga0466657_293621_1242_1580 | 112 |
| 9 | 3300042590 | Ga0466690_024847 | Ga0466690_024847_537_875 | 112 |
| 10 | 3300042615 | Ga0466711_116166 | Ga0466711_116166_3317_3655 | 112 |
| 11 | 3300002462 | JGI24702J35022_10140406 | JGI24702J35022_101404062 | 113 |
| 12 | 3300010049 | Ga0123356_10010348 | Ga0123356_100103481 | 113 |
| 13 | 3300042597 | Ga0466699_265600 | Ga0466699_265600_1347_1688 | 113 |
| 14 | 3300042601 | Ga0466707_040792 | Ga0466707_040792_726_1067 | 113 |
| 15 | 3300042604 | Ga0466717_175259 | Ga0466717_175259_1023_1364 | 113 |
| 16 | 3300042612 | Ga0466705_081939 | Ga0466705_081939_773_1114 | 113 |
| 17 | 3300042612 | Ga0466705_120822 | Ga0466705_120822_3964_4305 | 113 |
| 18 | 3300042613 | Ga0466710_075316 | Ga0466710_075316_1182_1523 | 113 |
| 19 | 3300042617 | Ga0466718_127160 | Ga0466718_127160_94_435 | 113 |
| 20 | 3300042620 | Ga0466728_098008 | Ga0466728_098008_1882_2223 | 113 |
| 21 | 3300042620 | Ga0466728_367285 | Ga0466728_367285_1547_1888 | 113 |
| 22 | 3300042636 | Ga0466703_013719 | Ga0466703_013719_365_706 | 113 |
| 23 | 3300042636 | Ga0466703_152083 | Ga0466703_152083_2717_3058 | 113 |
| 24 | 3300042643 | Ga0466704_063605 | Ga0466704_063605_571_912 | 113 |
| 25 | 3300042643 | Ga0466704_132845 | Ga0466704_132845_3089_3430 | 113 |
| 26 | 3300042643 | Ga0466704_143947 | Ga0466704_143947_2654_2995 | 113 |
| 27 | 3300042643 | Ga0466704_196233 | Ga0466704_196233_563_904 | 113 |
| 28 | 3300042643 | Ga0466704_366092 | Ga0466704_366092_3923_4264 | 113 |
| 29 | 3300042643 | Ga0466704_497058 | Ga0466704_497058_2359_2700 | 113 |
| 30 | 3300042643 | Ga0466704_608078 | Ga0466704_608078_579_920 | 113 |
| 31 | 3300042643 | Ga0466704_610396 | Ga0466704_610396_525_866 | 113 |
| 32 | 3300042643 | Ga0466704_619624 | Ga0466704_619624_1709_2050 | 113 |
| 33 | iso_pr_bacteria | 2820759988 | 2820762731 | 113 |
| 34 | 3300002504 | JGI24705J35276_11914032 | JGI24705J35276_119140322 | 114 |
| 35 | 3300002509 | JGI24699J35502_11134232 | JGI24699J35502_1113423293 | 114 |
| 36 | 3300002834 | JGI24696J40584_12688284 | JGI24696J40584_126882842 | 114 |
| 37 | 3300005201 | Ga0072941_1308615 | Ga0072941_13086152 | 114 |
| 38 | 3300009784 | Ga0123357_10249440 | Ga0123357_102494403 | 114 |
| 39 | 3300009784 | Ga0123357_10601188 | Ga0123357_106011882 | 114 |
| 40 | 3300010049 | Ga0123356_10594616 | Ga0123356_105946162 | 114 |
| 41 | 3300010882 | Ga0123354_10000257 | Ga0123354_1000025739 | 114 |
| 42 | 3300024582 | Ga0265387_1012085 | Ga0265387_10120852 | 114 |
| 43 | 3300042582 | Ga0466657_192080 | Ga0466657_192080_205_549 | 114 |
| 44 | 3300042592 | Ga0466693_027670 | Ga0466693_027670_496_840 | 114 |
| 45 | 3300042598 | Ga0466701_065845 | Ga0466701_065845_864_1208 | 114 |
| 46 | 3300042600 | Ga0466700_254030 | Ga0466700_254030_493_837 | 114 |
| 47 | 3300042601 | Ga0466707_392837 | Ga0466707_392837_1290_1634 | 114 |
| 48 | 3300042604 | Ga0466717_122378 | Ga0466717_122378_2864_3208 | 114 |
| 49 | 3300042605 | Ga0466716_534667 | Ga0466716_534667_1226_1570 | 114 |
| 50 | 3300042609 | Ga0466722_166087 | Ga0466722_166087_759_1103 | 114 |
| 51 | 3300042610 | Ga0466698_224120 | Ga0466698_224120_552_896 | 114 |
| 52 | 3300042610 | Ga0466698_438256 | Ga0466698_438256_1833_2177 | 114 |
| 53 | 3300042612 | Ga0466705_095408 | Ga0466705_095408_879_1223 | 114 |
| 54 | 3300042613 | Ga0466710_029725 | Ga0466710_029725_247_591 | 114 |
| 55 | 3300042613 | Ga0466710_215200 | Ga0466710_215200_848_1192 | 114 |
| 56 | 3300042613 | Ga0466710_287077 | Ga0466710_287077_167_511 | 114 |
| 57 | 3300042619 | Ga0466726_434078 | Ga0466726_434078_326_670 | 114 |
| 58 | 3300042623 | Ga0466734_069099 | Ga0466734_069099_1634_1978 | 114 |
| 59 | 3300042636 | Ga0466703_256245 | Ga0466703_256245_864_1208 | 114 |
| 60 | 3300042643 | Ga0466704_120206 | Ga0466704_120206_4526_4870 | 114 |
| 61 | 3300042648 | Ga0466709_247857 | Ga0466709_247857_318_662 | 114 |
| 62 | 3300042654 | Ga0466725_194319 | Ga0466725_194319_1365_1709 | 114 |
| 63 | 3300042654 | Ga0466725_293817 | Ga0466725_293817_398_742 | 114 |
| 64 | 3300042659 | Ga0466733_155159 | Ga0466733_155159_1312_1656 | 114 |
| 65 | iso_pr_bacteria | 2820776227 | 2820776811 | 114 |
| 66 | 3300002462 | JGI24702J35022_10053317 | JGI24702J35022_100533171 | 115 |
| 67 | 3300002504 | JGI24705J35276_11676210 | JGI24705J35276_116762101 | 115 |
| 68 | 3300009784 | Ga0123357_10001030 | Ga0123357_1000103011 | 115 |
| 69 | 3300009784 | Ga0123357_10299871 | Ga0123357_102998713 | 115 |
| 70 | 3300009784 | Ga0123357_10360297 | Ga0123357_103602972 | 115 |
| 71 | 3300010049 | Ga0123356_10114644 | Ga0123356_101146442 | 115 |
| 72 | 3300010049 | Ga0123356_10230541 | Ga0123356_102305412 | 115 |
| 73 | 3300010049 | Ga0123356_10309055 | Ga0123356_103090551 | 115 |
| 74 | 3300010049 | Ga0123356_10600434 | Ga0123356_106004342 | 115 |
| 75 | 3300010049 | Ga0123356_12028270 | Ga0123356_120282703 | 115 |
| 76 | 3300010167 | Ga0123353_12723804 | Ga0123353_127238042 | 115 |
| 77 | 3300010882 | Ga0123354_10273013 | Ga0123354_102730132 | 115 |
| 78 | 3300010882 | Ga0123354_10673610 | Ga0123354_106736102 | 115 |
| 79 | 3300042643 | Ga0466704_143999 | Ga0466704_143999_518_865 | 115 |
| 80 | 3300042643 | Ga0466704_575968 | Ga0466704_575968_1100_1447 | 115 |
| 81 | 3300042654 | Ga0466725_329015 | Ga0466725_329015_389_736 | 115 |
| 82 | 3300009784 | Ga0123357_10000088 | Ga0123357_1000008871 | 116 |
| 83 | 3300009784 | Ga0123357_10766346 | Ga0123357_107663462 | 116 |
| 84 | 3300002462 | JGI24702J35022_10109683 | JGI24702J35022_101096832 | 117 |
| 85 | 3300002462 | JGI24702J35022_10861959 | JGI24702J35022_108619591 | 117 |
| 86 | 3300010049 | Ga0123356_10923123 | Ga0123356_109231232 | 117 |
| 87 | 3300042598 | Ga0466701_028516 | Ga0466701_028516_1277_1630 | 117 |
| 88 | 3300042620 | Ga0466728_186852 | Ga0466728_186852_2430_2783 | 117 |
| 89 | 3300042623 | Ga0466734_103786 | Ga0466734_103786_272_625 | 117 |
| 90 | 3300009784 | Ga0123357_10726369 | Ga0123357_107263692 | 118 |
| 91 | 3300010167 | Ga0123353_10536001 | Ga0123353_105360012 | 118 |
| 92 | 3300042616 | Ga0466715_503177 | Ga0466715_503177_4521_4877 | 118 |
| 93 | 3300002450 | JGI24695J34938_10245389 | JGI24695J34938_102453892 | 119 |
| 94 | 3300042599 | Ga0466706_117414 | Ga0466706_117414_450_809 | 119 |
| 95 | 3300042620 | Ga0466728_346856 | Ga0466728_346856_266_628 | 120 |
| 96 | 3300042643 | Ga0466704_398264 | Ga0466704_398264_1383_1745 | 120 |
| 97 | 3300042612 | Ga0466705_360839 | Ga0466705_360839_544_909 | 121 |
| 98 | 3300042620 | Ga0466728_418633 | Ga0466728_418633_519_884 | 121 |
| 99 | 3300042636 | Ga0466703_363106 | Ga0466703_363106_19838_20203 | 121 |
| 100 | 3300042643 | Ga0466704_339435 | Ga0466704_339435_455_820 | 121 |
| 101 | 3300042643 | Ga0466704_489122 | Ga0466704_489122_357_722 | 121 |
| 102 | 3300042615 | Ga0466711_295382 | Ga0466711_295382_3926_4294 | 122 |
| 103 | 3300010167 | Ga0123353_10943586 | Ga0123353_109435861 | 123 |
| 104 | 3300010882 | Ga0123354_10195559 | Ga0123354_101955591 | 123 |
| 105 | 3300042611 | Ga0466697_080625 | Ga0466697_080625_413_784 | 123 |
| 106 | 3300042600 | Ga0466700_274607 | Ga0466700_274607_293_673 | 126 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05534 | HicB | HicB family | 67 | 118 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.6 | 0.81 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.