Protein Family IF05736

Metagenome Isolate
209 Members
76 Samples
182 Scaffolds
535.99 Avg Length

🧬 Representative Sequence

ID
3300042600|Ga0466700_263003|Ga0466700_263003_1138_2826
Length
562 aa
Sequence
MLQTLTIQNYALISRLEIDFPSGFSVITGETGAGKSILLGALSLILGQRAEAKSIKQNENRCLIEGIFNISSYQLDSYFSEKGWEYDPDQCILRREIWASGKSRAFINDSPVGLNDLKELGSFLIDIHSQHQNLLLADNQFQLQVLDVLAKNRELKNEYLSVYREYIRTEKEIKELKEKIHIRKTEEDYLRFQFNQLQEARLQADEQERLEQESETLSHIEEIKNGLCRLEEYFSSETTGVVPVLKESFKQIMSLRKVYSASEQMAERIETAYLDLKDLAADIQIRQETLEFNPERLQEVNDRLHIIYSLQQKHRLSSVDALIELRDNLDKQIQEIDHSGEALEALEKKSAQLYAQASTLGEKLSQTRKEAASALENQLVKTVSALGMPNIRFSAEMLRKESFDSNGWDSGTYLFSANKNVELKPVAQTASGGEISRLMLGVKSLIAGAMALPAIIFDEIDTGVSGEVADKVGDIMHQMGETMQVIAISHLPQIAAKGAVQYLVYKEENNHLSETRIRRLSYEERIKEIAQLLSGAQLTAAAIENAKELLKTELHNCFPDTD

📊 Sample Types

Isolate 12.9%
Metagenome 87.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 27.0%
Kalotermitidae 18.9%
Unclassified 16.2%
Blattidae 16.2%
Rhinotermitidae 6.8%
Termopsidae 4.1%
Drosophilidae 2.7%
Tenebrionidae 2.7%
Hydrophilidae 2.7%
Hodotermitidae 1.4%
Passalidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 203
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
2 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
3 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
4 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
5 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
6 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
7 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
8 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
9 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
10 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
11 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
12 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
13 3004667792 Bacteroides sp. 519 Isolate Blattidae
14 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
15 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
16 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
17 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
18 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
19 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
20 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
21 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
22 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
23 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
24 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
25 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
26 2922326829 Bacteroides sp. 224 Isolate Blattidae
27 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
28 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
29 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
30 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
34 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
35 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
36 3004677695 Bacteroides sp. 214 Isolate Blattidae
37 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
38 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
40 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
41 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
42 2882250448 Bizionia sp. APA-3 Isolate
43 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
44 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
45 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
46 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
47 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
48 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
49 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
50 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
51 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
52 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
53 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
54 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
55 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
56 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
57 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
58 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
59 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
60 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
61 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
62 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
63 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
64 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
65 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
66 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
67 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
68 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
69 3004672520 Bacteroides sp. 51 Isolate Blattidae
70 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
71 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
72 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
73 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
74 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
75 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
76 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 IMNBL1DRAFT_c0007817 3300000062 Bacteria 5550
2 JGI24699J35502_11133952 3300002509 Bacteria 21091
3 Ga0104048_1025608 3300007143 Unclassified 3488
4 Ga0466735_063360 3300042624 Bacteria 5925
5 Ga0466735_066898 3300042624 Bacteria 3813
6 Ga0466735_105050 3300042624 Bacteria 3432
7 Ga0466735_105178 3300042624 Bacteria 2111
8 Ga0466703_203148 3300042636 Bacteria 3185
9 Ga0466703_232448 3300042636 Bacteria 16803
10 Ga0466727_252125 3300042655 Bacteria 8282
11 Ga0466715_035314 3300042616 Bacteria 6338
12 Ga0466715_035712 3300042616 Bacteria 2330
13 Ga0466723_062056 3300042618 Bacteria 9021
14 Ga0466690_038482 3300042590 Bacteria 44603
15 Ga0466690_114224 3300042590 Bacteria 5880
16 Ga0466694_182223 3300042594 Bacteria 2471
17 Ga0123353_10000206 3300010167 Bacteria 74863
18 Ga0466706_036123 3300042599 Bacteria 40157
19 Ga0466706_110068 3300042599 Bacteria 33466
20 Ga0466713_021496 3300042602 Bacteria 25913
21 Ga0466714_093285 3300042603 Bacteria 105352
22 Ga0466716_543640 3300042605 Bacteria 9256
23 Ga0466722_125543 3300042609 Bacteria 13662
24 Ga0068305_10010999 3300005083 Bacteria 28319
25 Ga0104050_1026574 3300007153 Bacteria 3299
26 Ga0466729_223156 3300042621 Unclassified 2521
27 Ga0466703_315184 3300042636 Bacteria 8338
28 Ga0466704_187055 3300042643 Bacteria 9571
29 Ga0466709_020138 3300042648 Bacteria 5373
30 Ga0466724_68743 3300042649 Bacteria 337166
31 Ga0466710_323013 3300042613 Bacteria 2146
32 Ga0466690_027177 3300042590 Bacteria 32769
33 Ga0123354_10000510 3300010882 Bacteria 39203
34 Ga0123354_10061399 3300010882 Bacteria 5547
35 Ga0466706_065550 3300042599 Bacteria 22203
36 Ga0466706_273544 3300042599 Bacteria 20008
37 Ga0466700_263003 3300042600 Bacteria 3802
38 Ga0466707_083281 3300042601 Bacteria 9933
39 Ga0466707_183167 3300042601 Bacteria 4993
40 Ga0466707_383522 3300042601 Bacteria 5044
41 Ga0466713_003552 3300042602 Bacteria 24258
42 Ga0466713_100271 3300042602 Bacteria 4257
43 Ga0466713_123723 3300042602 Bacteria 198668
44 Ga0466722_031905 3300042609 Bacteria 36244
45 Ga0466697_245989 3300042611 Bacteria 2055
46 Ga0466705_040770 3300042612 Bacteria 11513
47 Ga0466733_221141 3300042659 Bacteria 323281
48 JGI24699J35502_11134202 3300002509 Bacteria 55258
49 JGI24696J40584_12960323 3300002834 Bacteria 6916
50 Ga0104048_1002313 3300007143 Bacteria 7886
51 Ga0466730_089030 3300042625 Bacteria 3099
52 Ga0466703_030324 3300042636 Bacteria 9168
53 Ga0466704_119741 3300042643 Bacteria 23128
54 Ga0466708_241187 3300042652 Bacteria 16415
55 Ga0466727_283482 3300042655 Bacteria 5171
56 Ga0466705_474341 3300042612 Bacteria 80430
57 Ga0466715_162938 3300042616 Bacteria 8464
58 Ga0466726_054129 3300042619 Bacteria 8721
59 Ga0466726_350555 3300042619 Bacteria 1603
60 Ga0466728_098313 3300042620 Bacteria 5794
61 Ga0466656_277953 3300042550 Bacteria 2440
62 Ga0466690_247576 3300042590 Bacteria 7353
63 Ga0466692_137157 3300042591 Bacteria 5137
64 Ga0466691_077964 3300042593 Bacteria 17535
65 Ga0466691_129459 3300042593 Bacteria 115763
66 Ga0466713_034284 3300042602 Bacteria 9067
67 Ga0466714_102383 3300042603 Bacteria 4924
68 Ga0466716_059849 3300042605 Bacteria 6485
69 Ga0466719_230369 3300042606 Bacteria 3698
70 Ga0466722_182790 3300042609 Bacteria 4559
71 Ga0466733_041321 3300042659 Bacteria 6661
72 JGI24699J35502_11130704 3300002509 Bacteria 5245
73 Ga0466728_038055 3300042620 Bacteria 18734
74 Ga0466728_194707 3300042620 Bacteria 8888
75 Ga0466690_099393 3300042590 Bacteria 94849
76 Ga0466692_042162 3300042591 Bacteria 26764
77 Ga0466696_303312 3300042596 Bacteria 10145
78 Ga0123357_10011205 3300009784 Bacteria 11477
79 Ga0123357_10022863 3300009784 Bacteria 8389
80 Ga0123357_10201371 3300009784 Bacteria 2264
81 Ga0123357_10210992 3300009784 Bacteria 2181
82 Ga0123356_10025183 3300010049 Bacteria 5594
83 Ga0123354_10077161 3300010882 Bacteria 4748
84 Ga0123354_10143450 3300010882 Bacteria 2938
85 Ga0466701_034196 3300042598 Unclassified 9700
86 Ga0466701_037583 3300042598 Bacteria 9706
87 Ga0466701_045246 3300042598 Bacteria 23760
88 Ga0466706_033628 3300042599 Bacteria 10195
89 Ga0466706_103812 3300042599 Bacteria 57157
90 Ga0466706_151999 3300042599 Bacteria 21719
91 Ga0466716_161498 3300042605 Bacteria 13532
92 JGI24702J35022_10034274 3300002462 Bacteria 2715
93 Ga0123357_10002994 3300009784 Bacteria 19122
94 Ga0466734_168305 3300042623 Bacteria 3835
95 Ga0466735_103728 3300042624 Bacteria 5658
96 Ga0466704_571081 3300042643 Bacteria 12529
97 Ga0466709_169139 3300042648 Bacteria 148698
98 Ga0466709_328210 3300042648 Bacteria 5873
99 Ga0466708_135966 3300042652 Bacteria 11275
100 Ga0466727_247885 3300042655 Bacteria 6207
101 Ga0466711_398758 3300042615 Bacteria 47200
102 Ga0466715_217399 3300042616 Bacteria 37947
103 Ga0466715_644726 3300042616 Bacteria 7804
104 Ga0466723_114187 3300042618 Bacteria 9014
105 Ga0466723_183947 3300042618 Bacteria 6016
106 Ga0466726_442609 3300042619 Bacteria 14068
107 Ga0466728_004172 3300042620 Bacteria 23679
108 Ga0466728_291826 3300042620 Bacteria 7528
109 Ga0466696_005804 3300042596 Bacteria 2758
110 Ga0123357_10044767 3300009784 Bacteria 6008
111 Ga0123357_10196655 3300009784 Bacteria 2307
112 Ga0466701_038344 3300042598 Bacteria 5089
113 Ga0466707_044398 3300042601 Bacteria 37204
114 Ga0466714_041819 3300042603 Bacteria 104465
115 Ga0466714_056144 3300042603 Bacteria 1568
116 Ga0466719_335843 3300042606 Bacteria 6365
117 Ga0562377_0004 3300056842 Bacteria 3525959
118 IMNBL1DRAFT_c0000063 3300000062 Bacteria 97352
119 IMNBL1DRAFT_c0009963 3300000062 Bacteria 4613
120 JGI24705J35276_12231543 3300002504 Unclassified 3977
121 Ga0072941_1060164 3300005201 Bacteria 9635
122 Ga0466735_081469 3300042624 Bacteria 4526
123 Ga0466703_061797 3300042636 Unclassified 8785
124 Ga0466704_203526 3300042643 Bacteria 10666
125 Ga0466709_099936 3300042648 Bacteria 10023
126 Ga0466709_418744 3300042648 Bacteria 33430
127 Ga0466711_033939 3300042615 Bacteria 4782
128 Ga0466711_446935 3300042615 Bacteria 3144
129 Ga0466715_181133 3300042616 Bacteria 21832
130 Ga0466723_022620 3300042618 Bacteria 7556
131 Ga0466723_154803 3300042618 Bacteria 51771
132 Ga0466723_168068 3300042618 Bacteria 59955
133 Ga0466690_027704 3300042590 Bacteria 6963
134 Ga0466690_242490 3300042590 Bacteria 11568
135 Ga0466691_173559 3300042593 Bacteria 13925
136 Ga0466701_005130 3300042598 Bacteria 7811
137 Ga0123357_10023201 3300009784 Bacteria 8334
138 Ga0466707_033129 3300042601 Bacteria 16675
139 Ga0466707_070404 3300042601 Bacteria 5313
140 Ga0466713_005701 3300042602 Bacteria 2959
141 Ga0466722_014557 3300042609 Bacteria 6549
142 Ga0466722_040472 3300042609 Bacteria 2310
143 Ga0466733_032159 3300042659 Bacteria 19865
144 JGI24699J35502_11133097 3300002509 Bacteria 8692
145 Ga0123357_10002407 3300009784 Bacteria 20849
146 Ga0466729_224438 3300042621 Bacteria 2607
147 Ga0466735_065919 3300042624 Bacteria 14275
148 Ga0466703_376744 3300042636 Bacteria 6743
149 Ga0466725_135015 3300042654 Bacteria 2625
150 Ga0466727_335068 3300042655 Bacteria 2759
151 Ga0466711_107706 3300042615 Bacteria 11387
152 Ga0466715_185370 3300042616 Bacteria 7280
153 Ga0466715_376988 3300042616 Bacteria 36049
154 Ga0466715_642914 3300042616 Bacteria 17581
155 Ga0466723_304947 3300042618 Bacteria 13280
156 Ga0466728_001073 3300042620 Bacteria 4496
157 Ga0466690_052487 3300042590 Bacteria 6212
158 Ga0466692_033060 3300042591 Bacteria 12445
159 Ga0466691_086619 3300042593 Bacteria 12002
160 Ga0466691_117402 3300042593 Bacteria 18767
161 Ga0466696_013092 3300042596 Bacteria 2837
162 Ga0123357_10102000 3300009784 Bacteria 3696
163 Ga0466701_017057 3300042598 Bacteria 176601
164 Ga0466707_249842 3300042601 Bacteria 2792
165 Ga0466716_320091 3300042605 Bacteria 3598
166 Ga0466733_019693 3300042659 Bacteria 6649
167 Ga0466703_125756 3300042636 Bacteria 22283
168 Ga0466727_033053 3300042655 Bacteria 32312
169 Ga0466711_016701 3300042615 Bacteria 17843
170 Ga0466723_006080 3300042618 Unclassified 12252
171 Ga0466691_140180 3300042593 Bacteria 12996
172 Ga0466701_012784 3300042598 Bacteria 94328
173 Ga0123354_10001224 3300010882 Bacteria 30412
174 Ga0123354_10001503 3300010882 Bacteria 28513
175 Ga0466706_142707 3300042599 Bacteria 44049
176 Ga0466700_015573 3300042600 Bacteria 4765
177 Ga0466707_416976 3300042601 Bacteria 13390
178 Ga0466713_019367 3300042602 Bacteria 104354
179 Ga0466713_058673 3300042602 Bacteria 88401
180 Ga0466713_131209 3300042602 Bacteria 23837
181 Ga0466722_023230 3300042609 Bacteria 15520
182 Ga0466722_206465 3300042609 Bacteria 3886

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005201 Ga0072941_1060164 Ga0072941_106016410 453
2 iso_pr_bacteria 2882250448 2882251918 454
3 3300042603 Ga0466714_056144 Ga0466714_056144_13_1476 459
4 3300042603 Ga0466714_102383 Ga0466714_102383_2064_3719 460
5 3300042600 Ga0466700_015573 Ga0466700_015573_1552_3198 464
6 3300042619 Ga0466726_350555 Ga0466726_350555_153_1592 479
7 3300042598 Ga0466701_038344 Ga0466701_038344_1217_2872 484
8 3300042598 Ga0466701_017057 Ga0466701_017057_9241_10896 487
9 3300042599 Ga0466706_142707 Ga0466706_142707_10136_11815 488
10 3300042601 Ga0466707_183167 Ga0466707_183167_2187_3842 492
11 3300010882 Ga0123354_10061399 Ga0123354_100613993 495
12 3300042625 Ga0466730_089030 Ga0466730_089030_473_2137 497
13 3300042618 Ga0466723_062056 Ga0466723_062056_4073_5728 498
14 3300042652 Ga0466708_241187 Ga0466708_241187_14016_15677 499
15 3300042602 Ga0466713_123723 Ga0466713_123723_62545_64212 502
16 3300042624 Ga0466735_081469 Ga0466735_081469_1196_2845 502
17 3300042598 Ga0466701_034196 Ga0466701_034196_4778_6433 504
18 3300042615 Ga0466711_107706 Ga0466711_107706_5391_7073 505
19 3300042611 Ga0466697_245989 Ga0466697_245989_346_1962 506
20 3300042655 Ga0466727_283482 Ga0466727_283482_1846_3504 506
21 3300042599 Ga0466706_151999 Ga0466706_151999_4454_6106 507
22 3300009784 Ga0123357_10196655 Ga0123357_101966551 508
23 3300042590 Ga0466690_027704 Ga0466690_027704_4996_6651 508
24 3300042624 Ga0466735_065919 Ga0466735_065919_527_2185 508
25 3300002509 JGI24699J35502_11133097 JGI24699J35502_111330973 509
26 3300009784 Ga0123357_10011205 Ga0123357_1001120510 509
27 3300010882 Ga0123354_10001224 Ga0123354_100012246 509
28 3300042596 Ga0466696_303312 Ga0466696_303312_2738_4402 509
29 3300042605 Ga0466716_543640 Ga0466716_543640_4087_5757 509
30 3300042636 Ga0466703_232448 Ga0466703_232448_978_2639 509
31 3300000062 IMNBL1DRAFT_c0009963 IMNBL1DRAFT_00099632 510
32 3300042624 Ga0466735_105178 Ga0466735_105178_446_2089 510
33 3300042603 Ga0466714_041819 Ga0466714_041819_25816_27471 513
34 3300042620 Ga0466728_098313 Ga0466728_098313_1361_3019 514
35 3300007143 Ga0104048_1002313 Ga0104048_10023135 515
36 3300042659 Ga0466733_221141 Ga0466733_221141_168020_169678 515
37 3300042599 Ga0466706_273544 Ga0466706_273544_9545_11215 516
38 3300042609 Ga0466722_125543 Ga0466722_125543_1118_2776 516
39 3300042591 Ga0466692_042162 Ga0466692_042162_20419_22086 518
40 3300042620 Ga0466728_194707 Ga0466728_194707_5854_7524 518
41 3300042590 Ga0466690_114224 Ga0466690_114224_3652_5322 519
42 3300042601 Ga0466707_044398 Ga0466707_044398_16004_17659 519
43 3300042602 Ga0466713_034284 Ga0466713_034284_1175_2836 519
44 3300007143 Ga0104048_1025608 Ga0104048_10256082 520
45 3300042601 Ga0466707_033129 Ga0466707_033129_8609_10258 520
46 3300042603 Ga0466714_093285 Ga0466714_093285_89146_90792 521
47 3300042655 Ga0466727_247885 Ga0466727_247885_4058_5713 521
48 3300042636 Ga0466703_061797 Ga0466703_061797_577_2235 522
49 3300042602 Ga0466713_019367 Ga0466713_019367_45273_46937 523
50 3300042655 Ga0466727_252125 Ga0466727_252125_3450_5111 523
51 3300042593 Ga0466691_077964 Ga0466691_077964_14350_16023 524
52 3300042602 Ga0466713_131209 Ga0466713_131209_8362_10017 524
53 3300002509 JGI24699J35502_11134202 JGI24699J35502_1113420234 525
54 3300042590 Ga0466690_027177 Ga0466690_027177_25990_27666 526
55 3300042593 Ga0466691_117402 Ga0466691_117402_16399_18063 526
56 3300042601 Ga0466707_070404 Ga0466707_070404_1913_3571 526
57 3300042616 Ga0466715_217399 Ga0466715_217399_514_2172 526
58 3300042618 Ga0466723_183947 Ga0466723_183947_2656_4314 526
59 3300042618 Ga0466723_304947 Ga0466723_304947_4873_6531 526
60 3300002834 JGI24696J40584_12960323 JGI24696J40584_129603236 529
61 3300010882 Ga0123354_10077161 Ga0123354_100771612 529
62 3300042598 Ga0466701_045246 Ga0466701_045246_12249_13913 529
63 3300042659 Ga0466733_019693 Ga0466733_019693_1128_2783 529
64 3300002509 JGI24699J35502_11130704 JGI24699J35502_111307044 530
65 3300042602 Ga0466713_003552 Ga0466713_003552_9992_11650 530
66 3300042605 Ga0466716_161498 Ga0466716_161498_10974_12650 530
67 3300042624 Ga0466735_063360 Ga0466735_063360_2319_3974 530
68 3300009784 Ga0123357_10002994 Ga0123357_100029948 531
69 3300042590 Ga0466690_242490 Ga0466690_242490_4177_5838 532
70 3300042620 Ga0466728_004172 Ga0466728_004172_7250_8908 532
71 3300042659 Ga0466733_032159 Ga0466733_032159_7255_8913 532
72 3300009784 Ga0123357_10022863 Ga0123357_100228636 533
73 3300042601 Ga0466707_416976 Ga0466707_416976_5487_7151 533
74 3300042609 Ga0466722_040472 Ga0466722_040472_204_1892 533
75 3300042615 Ga0466711_033939 Ga0466711_033939_1619_3289 533
76 3300042613 Ga0466710_323013 Ga0466710_323013_330_2003 534
77 3300042616 Ga0466715_181133 Ga0466715_181133_10412_12073 534
78 3300009784 Ga0123357_10023201 Ga0123357_100232018 535
79 3300042550 Ga0466656_277953 Ga0466656_277953_20_1690 535
80 3300042602 Ga0466713_100271 Ga0466713_100271_1788_3446 535
81 3300042616 Ga0466715_035314 Ga0466715_035314_2970_4625 535
82 3300042618 Ga0466723_168068 Ga0466723_168068_16412_18067 535
83 3300042621 Ga0466729_223156 Ga0466729_223156_110_1768 535
84 3300042596 Ga0466696_005804 Ga0466696_005804_436_2091 536
85 3300042619 Ga0466726_054129 Ga0466726_054129_1234_2895 537
86 3300042621 Ga0466729_224438 Ga0466729_224438_819_2474 537
87 3300042624 Ga0466735_066898 Ga0466735_066898_2182_3795 537
88 3300002504 JGI24705J35276_12231543 JGI24705J35276_122315434 538
89 3300042618 Ga0466723_022620 Ga0466723_022620_1144_2814 538
90 3300042620 Ga0466728_001073 Ga0466728_001073_1648_3303 538
91 3300042620 Ga0466728_038055 Ga0466728_038055_14617_16287 538
92 3300042591 Ga0466692_033060 Ga0466692_033060_5086_6738 539
93 3300042596 Ga0466696_013092 Ga0466696_013092_173_1831 539
94 3300042601 Ga0466707_249842 Ga0466707_249842_101_1762 540
95 3300042601 Ga0466707_383522 Ga0466707_383522_464_2125 540
96 3300042616 Ga0466715_185370 Ga0466715_185370_3892_5556 541
97 3300042590 Ga0466690_099393 Ga0466690_099393_6598_8259 542
98 3300042591 Ga0466692_137157 Ga0466692_137157_2502_4166 542
99 3300042655 Ga0466727_033053 Ga0466727_033053_19534_21195 542
100 3300042609 Ga0466722_023230 Ga0466722_023230_6563_8221 543
101 3300042619 Ga0466726_442609 Ga0466726_442609_2536_4200 543
102 3300000062 IMNBL1DRAFT_c0000063 IMNBL1DRAFT_000006375 544
103 3300042599 Ga0466706_065550 Ga0466706_065550_6731_8401 544
104 3300042615 Ga0466711_446935 Ga0466711_446935_640_2307 544
105 3300005083 Ga0068305_10010999 Ga0068305_100109998 545
106 3300042609 Ga0466722_031905 Ga0466722_031905_20903_22576 545
107 3300042636 Ga0466703_376744 Ga0466703_376744_832_2490 545
108 3300042615 Ga0466711_016701 Ga0466711_016701_5149_6825 546
109 3300042616 Ga0466715_162938 Ga0466715_162938_4261_5970 546
110 3300042616 Ga0466715_376988 Ga0466715_376988_11395_13053 546
111 3300042659 Ga0466733_041321 Ga0466733_041321_4349_6007 546
112 3300010882 Ga0123354_10001503 Ga0123354_100015033 547
113 3300042636 Ga0466703_125756 Ga0466703_125756_14514_16175 547
114 3300009784 Ga0123357_10210992 Ga0123357_102109922 549
115 3300009784 Ga0123357_10201371 Ga0123357_102013712 550
116 3300042605 Ga0466716_320091 Ga0466716_320091_1161_2813 550
117 3300042609 Ga0466722_182790 Ga0466722_182790_2856_4508 550
118 3300042643 Ga0466704_119741 Ga0466704_119741_20695_22347 550
119 3300042590 Ga0466690_038482 Ga0466690_038482_5372_7027 551
120 3300042590 Ga0466690_052487 Ga0466690_052487_2572_4227 551
121 3300042590 Ga0466690_247576 Ga0466690_247576_5483_7138 551
122 3300042598 Ga0466701_012784 Ga0466701_012784_46978_48633 551
123 3300042598 Ga0466701_037583 Ga0466701_037583_4785_6440 551
124 3300042601 Ga0466707_083281 Ga0466707_083281_963_2618 551
125 3300042615 Ga0466711_398758 Ga0466711_398758_38828_40483 551
126 3300042616 Ga0466715_642914 Ga0466715_642914_10961_12616 551
127 3300042618 Ga0466723_154803 Ga0466723_154803_36220_37875 551
128 3300042624 Ga0466735_103728 Ga0466735_103728_1492_3147 551
129 3300042624 Ga0466735_105050 Ga0466735_105050_787_2442 551
130 3300042648 Ga0466709_020138 Ga0466709_020138_1795_3450 551
131 3300042649 Ga0466724_68743 Ga0466724_68743_196278_197933 551
132 iso_pr_bacteria 2899132286 2899133305 551
133 iso_pr_bacteria 2910926975 2910929265 551
134 iso_pr_bacteria 2967483437 2967484765 551
135 3300000062 IMNBL1DRAFT_c0007817 IMNBL1DRAFT_00078172 552
136 3300007153 Ga0104050_1026574 Ga0104050_10265742 552
137 3300010167 Ga0123353_10000206 Ga0123353_1000020640 552
138 3300042593 Ga0466691_129459 Ga0466691_129459_110865_112523 552
139 3300042594 Ga0466694_182223 Ga0466694_182223_687_2345 552
140 3300042599 Ga0466706_033628 Ga0466706_033628_4615_6273 552
141 3300042599 Ga0466706_036123 Ga0466706_036123_26448_28106 552
142 3300042599 Ga0466706_103812 Ga0466706_103812_4485_6143 552
143 3300042599 Ga0466706_110068 Ga0466706_110068_17518_19176 552
144 3300042602 Ga0466713_005701 Ga0466713_005701_1082_2740 552
145 3300042602 Ga0466713_021496 Ga0466713_021496_7454_9112 552
146 3300042602 Ga0466713_058673 Ga0466713_058673_53620_55278 552
147 3300042606 Ga0466719_335843 Ga0466719_335843_3161_4819 552
148 3300042616 Ga0466715_035712 Ga0466715_035712_372_2030 552
149 3300042616 Ga0466715_644726 Ga0466715_644726_816_2474 552
150 3300042620 Ga0466728_291826 Ga0466728_291826_5153_6811 552
151 3300042636 Ga0466703_030324 Ga0466703_030324_4617_6275 552
152 3300042636 Ga0466703_315184 Ga0466703_315184_279_1937 552
153 3300042648 Ga0466709_169139 Ga0466709_169139_24033_25691 552
154 3300042648 Ga0466709_328210 Ga0466709_328210_3314_4972 552
155 3300042648 Ga0466709_418744 Ga0466709_418744_25890_27548 552
156 3300042652 Ga0466708_135966 Ga0466708_135966_5363_7021 552
157 iso_pr_bacteria 2609459943 2610744260 552
158 iso_pr_bacteria 2695420314 2695471683 552
159 iso_pr_bacteria 2830041218 2830045190 552
160 iso_pr_bacteria 2910959314 2910961187 552
161 iso_pr_bacteria 2922326829 2922328011 552
162 iso_pr_bacteria 2940244548 2940245704 552
163 iso_pr_bacteria 2940248789 2940250142 552
164 iso_pr_bacteria 2940253009 2940254131 552
165 iso_pr_bacteria 2940257232 2940258384 552
166 iso_pr_bacteria 8100166142 8100167112 552
167 3300002462 JGI24702J35022_10034274 JGI24702J35022_100342742 553
168 3300042593 Ga0466691_086619 Ga0466691_086619_247_1908 553
169 3300042598 Ga0466701_005130 Ga0466701_005130_433_2130 553
170 3300042605 Ga0466716_059849 Ga0466716_059849_4637_6298 553
171 3300042609 Ga0466722_014557 Ga0466722_014557_2567_4228 553
172 3300042612 Ga0466705_040770 Ga0466705_040770_5126_6787 553
173 3300042612 Ga0466705_474341 Ga0466705_474341_39413_41074 553
174 3300042618 Ga0466723_006080 Ga0466723_006080_7609_9270 553
175 3300042618 Ga0466723_114187 Ga0466723_114187_1927_3588 553
176 3300042636 Ga0466703_203148 Ga0466703_203148_1130_2791 553
177 3300042643 Ga0466704_187055 Ga0466704_187055_7206_8867 553
178 3300042643 Ga0466704_571081 Ga0466704_571081_10769_12430 553
179 3300042655 Ga0466727_335068 Ga0466727_335068_649_2310 553
180 3300056842 Ga0562377_0004 Ga0562377_0004_1541830_1543491 553
181 iso_pr_bacteria 2695420317 2695483768 553
182 iso_pr_bacteria 2695420931 2698109919 553
183 iso_pr_bacteria 2873600114 2873603652 553
184 iso_pr_bacteria 2873610414 2873614085 553
185 iso_pr_bacteria 2940193328 2940193886 553
186 iso_pr_bacteria 2940336608 2940337164 553
187 iso_pr_bacteria 3004677695 3004679356 553
188 3300042643 Ga0466704_203526 Ga0466704_203526_6025_7689 554
189 3300042654 Ga0466725_135015 Ga0466725_135015_63_1727 554
190 iso_pr_bacteria 2820741847 2820742991 554
191 iso_pr_bacteria 3004667792 3004672306 554
192 3300042609 Ga0466722_206465 Ga0466722_206465_874_2541 555
193 3300042623 Ga0466734_168305 Ga0466734_168305_785_2452 555
194 iso_pr_bacteria 2820762746 2820763563 555
195 3300002509 JGI24699J35502_11133952 JGI24699J35502_111339529 556
196 3300010882 Ga0123354_10000510 Ga0123354_1000051025 556
197 3300042593 Ga0466691_140180 Ga0466691_140180_6849_8519 556
198 3300042648 Ga0466709_099936 Ga0466709_099936_4579_6249 556
199 iso_pr_bacteria 2820759988 2820760122 556
200 iso_pr_bacteria 3004672520 3004675677 556
201 3300009784 Ga0123357_10002407 Ga0123357_1000240714 557
202 3300009784 Ga0123357_10044767 Ga0123357_100447673 557
203 3300010882 Ga0123354_10143450 Ga0123354_101434502 557
204 3300042606 Ga0466719_230369 Ga0466719_230369_522_2198 558
205 3300009784 Ga0123357_10102000 Ga0123357_101020002 559
206 3300010049 Ga0123356_10025183 Ga0123356_100251834 559
207 iso_pr_bacteria 2820757377 2820759375 560
208 3300042600 Ga0466700_263003 Ga0466700_263003_1138_2826 562
209 3300042593 Ga0466691_173559 Ga0466691_173559_7310_9007 565

🧩 MSA Aligner

Download FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02463 SMC_N RecF/RecN/SMC N terminal domain 2 511 0.97
PF13175 AAA_15 AAA ATPase domain 1 386 0.67
PF13476 AAA_23 AAA domain 5 224 0.57

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.77 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.