Protein Family IF05724

Metagenome Isolate
152 Members
53 Samples
150 Scaffolds
261.08 Avg Length

🧬 Representative Sequence

ID
3300042600|Ga0466700_151968|Ga0466700_151968_773_1561
Length
262 aa
Sequence
MIPLAAITEWSNVSPWTNTHFVEQDLLICRVLTDLFNDKTLAEKLAFRGGTALHKLYLHPQQRYSEDIDFVQTNPEPIGFVLNRIREVLSYIGAPTIKQKQKNNTVVYRFHTEALPQAVMRLKIEINCQEHLSVQGLQKIPFEVNNSWFTGNCDIVTYTFDELIATKIRALYQRKKGRDLFDIYQALNSGKLDIEKTIFCYKKYMEQSAAQIPSARQYLDNLQSKMNNQIFCSDMEPLLRPGAGYGIHAAYEAFHKHFISVM

📊 Sample Types

Isolate 1.3%
Metagenome 98.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 49.0%
Kalotermitidae 27.5%
Rhinotermitidae 7.8%
Termopsidae 5.9%
Unclassified 5.9%
Hodotermitidae 2.0%
Passalidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 125
Eukaryota 0
Viruses 0
Unclassified 27

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
12 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
13 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
14 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
15 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
16 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
17 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
18 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
19 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
20 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
23 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
24 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
25 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
26 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
27 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
28 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
29 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
30 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
31 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
32 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
33 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
34 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
35 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
36 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
37 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
38 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
39 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
40 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
41 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
43 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
44 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
45 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
46 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
47 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
48 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
49 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
50 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
53 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466657_015830 3300042582 Unclassified 1155
2 Ga0466690_204873 3300042590 Bacteria 1111
3 Ga0466693_366838 3300042592 Unclassified 1104
4 Ga0466710_411882 3300042613 Bacteria 1378
5 Ga0466728_009850 3300042620 Bacteria 2901
6 JGI24702J35022_10045284 3300002462 Bacteria 2344
7 JGI24705J35276_12188433 3300002504 Bacteria 1441
8 Ga0466706_067347 3300042599 Bacteria 16310
9 Ga0466707_008156 3300042601 Bacteria 2918
10 Ga0466719_565098 3300042606 Bacteria 14894
11 Ga0466722_113951 3300042609 Bacteria 3398
12 Ga0466729_244538 3300042621 Bacteria 9713
13 Ga0466703_201014 3300042636 Unclassified 1874
14 Ga0466704_307615 3300042643 Unclassified 8607
15 Ga0466709_169180 3300042648 Bacteria 45156
16 Ga0123354_10204705 3300010882 Bacteria 2155
17 Ga0123354_10219760 3300010882 Bacteria 2023
18 Ga0123354_10357010 3300010882 Bacteria 1294
19 Ga0466657_145615 3300042582 Bacteria 4272
20 Ga0466696_164407 3300042596 Bacteria 8262
21 Ga0466711_240999 3300042615 Bacteria 6354
22 Ga0466723_117184 3300042618 Bacteria 2162
23 Ga0072941_1160723 3300005201 Unclassified 1097
24 Ga0072941_1361054 3300005201 Bacteria 2041
25 Ga0466707_361113 3300042601 Bacteria 15284
26 Ga0466705_042001 3300042612 Bacteria 2177
27 Ga0466705_090578 3300042612 Bacteria 2133
28 Ga0466705_226038 3300042612 Bacteria 8838
29 Ga0466735_031848 3300042624 Bacteria 3054
30 Ga0466703_233720 3300042636 Unclassified 2709
31 Ga0466703_398508 3300042636 Unclassified 2918
32 Ga0123353_10009770 3300010167 Unclassified 13291
33 Ga0466690_035019 3300042590 Bacteria 3982
34 Ga0466691_097988 3300042593 Bacteria 31039
35 Ga0466694_050610 3300042594 Bacteria 1494
36 Ga0466694_271062 3300042594 Bacteria 2470
37 Ga0466696_276521 3300042596 Unclassified 1102
38 Ga0466705_445849 3300042612 Unclassified 2565
39 Ga0466711_094184 3300042615 Bacteria 20319
40 Ga0466711_268272 3300042615 Unclassified 1781
41 Ga0466723_268807 3300042618 Bacteria 43614
42 Ga0466726_246826 3300042619 Bacteria 2183
43 Ga0466728_186596 3300042620 Bacteria 2010
44 IMNBL1DRAFT_c0015016 3300000062 Bacteria 3380
45 Ga0123357_10001648 3300009784 Bacteria 23972
46 Ga0466733_093532 3300042659 Bacteria 1839
47 Ga0466713_084862 3300042602 Bacteria 3250
48 Ga0466719_029224 3300042606 Bacteria 10040
49 Ga0466703_205766 3300042636 Bacteria 18549
50 Ga0466704_064771 3300042643 Unclassified 2054
51 Ga0466709_046018 3300042648 Bacteria 14812
52 Ga0466709_051680 3300042648 Bacteria 2571
53 Ga0466727_309483 3300042655 Bacteria 2256
54 Ga0123353_10000035 3300010167 Bacteria 147488
55 Ga0123354_10000978 3300010882 Unclassified 32424
56 Ga0123354_10001198 3300010882 Bacteria 30564
57 Ga0466694_043021 3300042594 Bacteria 1983
58 Ga0466699_039741 3300042597 Bacteria 3591
59 Ga0466711_036432 3300042615 Bacteria 7039
60 Ga0466711_298434 3300042615 Unclassified 1418
61 Ga0466715_187301 3300042616 Bacteria 2156
62 Ga0466706_030038 3300042599 Bacteria 3552
63 Ga0466707_062229 3300042601 Unclassified 5870
64 Ga0466707_379065 3300042601 Bacteria 7175
65 Ga0466716_142279 3300042605 Bacteria 3268
66 Ga0466734_162861 3300042623 Bacteria 1037
67 Ga0466734_173765 3300042623 Bacteria 1040
68 Ga0466735_089531 3300042624 Bacteria 1487
69 Ga0466735_212575 3300042624 Unclassified 2112
70 Ga0466704_041876 3300042643 Bacteria 11886
71 Ga0123356_10052167 3300010049 Bacteria 3804
72 Ga0123356_10259128 3300010049 Bacteria 1822
73 Ga0123356_11216479 3300010049 Unclassified 919
74 Ga0123353_10436749 3300010167 Bacteria 1933
75 Ga0466656_189336 3300042550 Unclassified 1830
76 Ga0466656_228043 3300042550 Bacteria 1736
77 Ga0466657_185874 3300042582 Bacteria 3245
78 Ga0466692_099731 3300042591 Bacteria 2112
79 Ga0466696_132155 3300042596 Bacteria 2737
80 Ga0466711_036410 3300042615 Bacteria 2764
81 Ga0466711_051286 3300042615 Bacteria 5850
82 Ga0466715_262889 3300042616 Bacteria 4045
83 JGI24702J35022_10021559 3300002462 Bacteria 3492
84 JGI24699J35502_11050801 3300002509 Bacteria 1650
85 JGI24696J40584_12954072 3300002834 Unclassified 2580
86 Ga0466733_119589 3300042659 Unclassified 1559
87 Ga0466701_102474 3300042598 Bacteria 27466
88 Ga0466700_151968 3300042600 Unclassified 2902
89 Ga0466721_158763 3300042608 Bacteria 1249
90 Ga0466703_209860 3300042636 Bacteria 1772
91 Ga0466703_274880 3300042636 Bacteria 36873
92 Ga0466703_433165 3300042636 Bacteria 1405
93 Ga0466704_411746 3300042643 Bacteria 2236
94 Ga0466709_220634 3300042648 Unclassified 10846
95 Ga0466724_09227 3300042649 Bacteria 2758
96 Ga0466727_268939 3300042655 Bacteria 4372
97 Ga0123357_10063634 3300009784 Unclassified 4933
98 Ga0466691_026620 3300042593 Bacteria 13614
99 Ga0466694_339110 3300042594 Bacteria 1522
100 Ga0466710_233864 3300042613 Unclassified 1066
101 IMNBL1DRAFT_c0061501 3300000062 Bacteria 1126
102 Ga0072940_1477159 3300005200 Bacteria 985
103 Ga0072941_1119639 3300005201 Bacteria 1976
104 Ga0466707_203362 3300042601 Bacteria 7782
105 Ga0466714_042875 3300042603 Bacteria 1752
106 Ga0466702_091649 3300042635 Bacteria 2217
107 Ga0466702_366304 3300042635 Bacteria 2102
108 Ga0466704_046917 3300042643 Unclassified 11002
109 Ga0466709_180033 3300042648 Bacteria 1951
110 Ga0123353_10049930 3300010167 Bacteria 6666
111 Ga0265387_1002922 3300024582 Bacteria 2390
112 Ga0466696_063973 3300042596 Bacteria 3611
113 Ga0466711_204147 3300042615 Bacteria 19807
114 Ga0466723_084500 3300042618 Bacteria 15044
115 Ga0466726_383712 3300042619 Bacteria 1670
116 Ga0466728_340392 3300042620 Bacteria 2209
117 JGI24702J35022_10001430 3300002462 Bacteria 14912
118 JGI24702J35022_10016326 3300002462 Bacteria 4070
119 Ga0466706_214048 3300042599 Bacteria 8098
120 Ga0466716_210831 3300042605 Bacteria 1203
121 Ga0466716_468052 3300042605 Bacteria 3232
122 Ga0466719_435046 3300042606 Bacteria 1633
123 Ga0466722_147900 3300042609 Bacteria 1078
124 Ga0466705_196917 3300042612 Bacteria 1736
125 Ga0466731_314183 3300042622 Bacteria 2882
126 Ga0466703_099551 3300042636 Bacteria 12782
127 Ga0466703_225945 3300042636 Bacteria 6170
128 Ga0466704_081588 3300042643 Bacteria 15326
129 Ga0466708_084130 3300042652 Bacteria 3322
130 Ga0123357_10019640 3300009784 Bacteria 9011
131 Ga0123357_10306035 3300009784 Bacteria 1596
132 Ga0466690_414684 3300042590 Bacteria 11361
133 Ga0466693_193697 3300042592 Bacteria 3748
134 Ga0466691_077867 3300042593 Bacteria 12376
135 Ga0466715_507886 3300042616 Bacteria 10225
136 Ga0466723_044181 3300042618 Bacteria 301962
137 Ga0466729_141880 3300042621 Bacteria 2792
138 Ga0072941_1069018 3300005201 Bacteria 1362
139 Ga0466733_013248 3300042659 Bacteria 4966
140 Ga0466733_179460 3300042659 Bacteria 7578
141 Ga0466706_085763 3300042599 Bacteria 2345
142 Ga0466707_223432 3300042601 Bacteria 5997
143 Ga0466716_162121 3300042605 Bacteria 9060
144 Ga0466705_020893 3300042612 Bacteria 5244
145 Ga0466735_021146 3300042624 Bacteria 2061
146 Ga0466735_021974 3300042624 Bacteria 2849
147 Ga0466735_030263 3300042624 Unclassified 2016
148 Ga0466735_048758 3300042624 Bacteria 1296
149 Ga0466703_026600 3300042636 Bacteria 12360
150 Ga0466725_204235 3300042654 Unclassified 1082

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042613 Ga0466710_233864 Ga0466710_233864_217_888 223
2 3300010167 Ga0123353_10009770 Ga0123353_100097702 224
3 3300042590 Ga0466690_204873 Ga0466690_204873_347_1075 230
4 3300042636 Ga0466703_099551 Ga0466703_099551_3556_4248 230
5 3300042615 Ga0466711_036432 Ga0466711_036432_2323_3030 235
6 3300042624 Ga0466735_048758 Ga0466735_048758_162_875 237
7 3300042599 Ga0466706_030038 Ga0466706_030038_2734_3474 246
8 3300042612 Ga0466705_020893 Ga0466705_020893_626_1366 246
9 3300042612 Ga0466705_445849 Ga0466705_445849_1223_1963 246
10 3300042615 Ga0466711_298434 Ga0466711_298434_196_936 246
11 3300042624 Ga0466735_021974 Ga0466735_021974_399_1139 246
12 3300042599 Ga0466706_067347 Ga0466706_067347_3175_3918 247
13 3300042609 Ga0466722_113951 Ga0466722_113951_2366_3121 251
14 3300010882 Ga0123354_10357010 Ga0123354_103570101 252
15 3300042605 Ga0466716_468052 Ga0466716_468052_2042_2812 256
16 3300042643 Ga0466704_411746 Ga0466704_411746_1225_1998 257
17 3300042550 Ga0466656_228043 Ga0466656_228043_384_1172 262
18 3300042594 Ga0466694_271062 Ga0466694_271062_1462_2250 262
19 3300042600 Ga0466700_151968 Ga0466700_151968_773_1561 262
20 3300042616 Ga0466715_187301 Ga0466715_187301_224_1012 262
21 3300042618 Ga0466723_044181 Ga0466723_044181_83898_84686 262
22 3300042623 Ga0466734_173765 Ga0466734_173765_38_826 262
23 3300042635 Ga0466702_091649 Ga0466702_091649_394_1182 262
24 3300042635 Ga0466702_366304 Ga0466702_366304_169_957 262
25 3300042636 Ga0466703_398508 Ga0466703_398508_965_1753 262
26 3300002462 JGI24702J35022_10045284 JGI24702J35022_100452841 263
27 3300005200 Ga0072940_1477159 Ga0072940_14771591 263
28 3300010882 Ga0123354_10204705 Ga0123354_102047053 263
29 3300024582 Ga0265387_1002922 Ga0265387_10029223 263
30 3300042550 Ga0466656_189336 Ga0466656_189336_981_1772 263
31 3300042582 Ga0466657_015830 Ga0466657_015830_254_1045 263
32 3300042582 Ga0466657_145615 Ga0466657_145615_1262_2053 263
33 3300042582 Ga0466657_185874 Ga0466657_185874_1663_2454 263
34 3300042590 Ga0466690_035019 Ga0466690_035019_312_1103 263
35 3300042590 Ga0466690_414684 Ga0466690_414684_405_1196 263
36 3300042591 Ga0466692_099731 Ga0466692_099731_402_1193 263
37 3300042592 Ga0466693_193697 Ga0466693_193697_2609_3400 263
38 3300042592 Ga0466693_366838 Ga0466693_366838_130_921 263
39 3300042593 Ga0466691_026620 Ga0466691_026620_11711_12502 263
40 3300042593 Ga0466691_077867 Ga0466691_077867_6190_6981 263
41 3300042593 Ga0466691_097988 Ga0466691_097988_11623_12414 263
42 3300042594 Ga0466694_043021 Ga0466694_043021_56_847 263
43 3300042594 Ga0466694_050610 Ga0466694_050610_191_982 263
44 3300042594 Ga0466694_339110 Ga0466694_339110_719_1510 263
45 3300042596 Ga0466696_063973 Ga0466696_063973_1415_2206 263
46 3300042596 Ga0466696_132155 Ga0466696_132155_878_1669 263
47 3300042596 Ga0466696_164407 Ga0466696_164407_6994_7785 263
48 3300042596 Ga0466696_276521 Ga0466696_276521_290_1081 263
49 3300042597 Ga0466699_039741 Ga0466699_039741_140_931 263
50 3300042598 Ga0466701_102474 Ga0466701_102474_19331_20122 263
51 3300042599 Ga0466706_085763 Ga0466706_085763_497_1288 263
52 3300042599 Ga0466706_214048 Ga0466706_214048_6671_7462 263
53 3300042601 Ga0466707_008156 Ga0466707_008156_833_1624 263
54 3300042601 Ga0466707_062229 Ga0466707_062229_1361_2152 263
55 3300042601 Ga0466707_203362 Ga0466707_203362_725_1516 263
56 3300042601 Ga0466707_223432 Ga0466707_223432_3422_4213 263
57 3300042601 Ga0466707_361113 Ga0466707_361113_12905_13696 263
58 3300042601 Ga0466707_379065 Ga0466707_379065_3896_4687 263
59 3300042602 Ga0466713_084862 Ga0466713_084862_1110_1901 263
60 3300042603 Ga0466714_042875 Ga0466714_042875_456_1247 263
61 3300042605 Ga0466716_142279 Ga0466716_142279_1050_1841 263
62 3300042605 Ga0466716_162121 Ga0466716_162121_1520_2311 263
63 3300042605 Ga0466716_210831 Ga0466716_210831_387_1178 263
64 3300042606 Ga0466719_029224 Ga0466719_029224_2148_2939 263
65 3300042606 Ga0466719_435046 Ga0466719_435046_243_1034 263
66 3300042606 Ga0466719_565098 Ga0466719_565098_1526_2317 263
67 3300042609 Ga0466722_147900 Ga0466722_147900_222_1013 263
68 3300042612 Ga0466705_042001 Ga0466705_042001_171_962 263
69 3300042612 Ga0466705_090578 Ga0466705_090578_1243_2034 263
70 3300042612 Ga0466705_196917 Ga0466705_196917_274_1065 263
71 3300042612 Ga0466705_226038 Ga0466705_226038_2869_3660 263
72 3300042613 Ga0466710_411882 Ga0466710_411882_49_840 263
73 3300042615 Ga0466711_036410 Ga0466711_036410_1457_2248 263
74 3300042615 Ga0466711_051286 Ga0466711_051286_3685_4476 263
75 3300042615 Ga0466711_094184 Ga0466711_094184_16068_16859 263
76 3300042615 Ga0466711_204147 Ga0466711_204147_5928_6719 263
77 3300042615 Ga0466711_240999 Ga0466711_240999_3847_4638 263
78 3300042615 Ga0466711_268272 Ga0466711_268272_589_1380 263
79 3300042616 Ga0466715_262889 Ga0466715_262889_1785_2576 263
80 3300042618 Ga0466723_084500 Ga0466723_084500_2089_2880 263
81 3300042618 Ga0466723_117184 Ga0466723_117184_1082_1873 263
82 3300042618 Ga0466723_268807 Ga0466723_268807_11858_12649 263
83 3300042619 Ga0466726_383712 Ga0466726_383712_808_1599 263
84 3300042620 Ga0466728_009850 Ga0466728_009850_1708_2499 263
85 3300042620 Ga0466728_186596 Ga0466728_186596_1146_1937 263
86 3300042620 Ga0466728_340392 Ga0466728_340392_1204_1995 263
87 3300042621 Ga0466729_244538 Ga0466729_244538_1036_1827 263
88 3300042622 Ga0466731_314183 Ga0466731_314183_1190_1981 263
89 3300042623 Ga0466734_162861 Ga0466734_162861_171_962 263
90 3300042624 Ga0466735_030263 Ga0466735_030263_84_875 263
91 3300042624 Ga0466735_031848 Ga0466735_031848_1989_2780 263
92 3300042624 Ga0466735_089531 Ga0466735_089531_203_994 263
93 3300042624 Ga0466735_212575 Ga0466735_212575_270_1061 263
94 3300042636 Ga0466703_026600 Ga0466703_026600_7653_8444 263
95 3300042636 Ga0466703_201014 Ga0466703_201014_229_1020 263
96 3300042636 Ga0466703_209860 Ga0466703_209860_903_1694 263
97 3300042636 Ga0466703_225945 Ga0466703_225945_917_1708 263
98 3300042636 Ga0466703_233720 Ga0466703_233720_265_1056 263
99 3300042636 Ga0466703_274880 Ga0466703_274880_6007_6798 263
100 3300042636 Ga0466703_433165 Ga0466703_433165_208_999 263
101 3300042643 Ga0466704_041876 Ga0466704_041876_5850_6641 263
102 3300042643 Ga0466704_046917 Ga0466704_046917_3784_4575 263
103 3300042643 Ga0466704_064771 Ga0466704_064771_1011_1802 263
104 3300042643 Ga0466704_081588 Ga0466704_081588_13515_14306 263
105 3300042643 Ga0466704_307615 Ga0466704_307615_1978_2769 263
106 3300042648 Ga0466709_046018 Ga0466709_046018_4300_5091 263
107 3300042648 Ga0466709_051680 Ga0466709_051680_397_1188 263
108 3300042648 Ga0466709_169180 Ga0466709_169180_4748_5539 263
109 3300042648 Ga0466709_180033 Ga0466709_180033_61_852 263
110 3300042648 Ga0466709_220634 Ga0466709_220634_8414_9205 263
111 3300042649 Ga0466724_09227 Ga0466724_09227_1087_1878 263
112 3300042652 Ga0466708_084130 Ga0466708_084130_803_1594 263
113 3300042654 Ga0466725_204235 Ga0466725_204235_155_946 263
114 3300042655 Ga0466727_268939 Ga0466727_268939_2799_3590 263
115 3300042655 Ga0466727_309483 Ga0466727_309483_221_1012 263
116 3300042659 Ga0466733_013248 Ga0466733_013248_1998_2789 263
117 3300042659 Ga0466733_093532 Ga0466733_093532_692_1483 263
118 3300042659 Ga0466733_119589 Ga0466733_119589_447_1238 263
119 3300042659 Ga0466733_179460 Ga0466733_179460_3093_3884 263
120 iso_pr_bacteria 2820778767 2820781398 263
121 iso_pr_bacteria 8100157865 8100160254 263
122 3300000062 IMNBL1DRAFT_c0015016 IMNBL1DRAFT_00150162 264
123 3300000062 IMNBL1DRAFT_c0061501 IMNBL1DRAFT_00615011 264
124 3300002462 JGI24702J35022_10016326 JGI24702J35022_100163266 264
125 3300002462 JGI24702J35022_10021559 JGI24702J35022_100215592 264
126 3300002504 JGI24705J35276_12188433 JGI24705J35276_121884332 264
127 3300002509 JGI24699J35502_11050801 JGI24699J35502_110508012 264
128 3300002834 JGI24696J40584_12954072 JGI24696J40584_129540722 264
129 3300005201 Ga0072941_1069018 Ga0072941_10690181 264
130 3300005201 Ga0072941_1119639 Ga0072941_11196392 264
131 3300005201 Ga0072941_1160723 Ga0072941_11607232 264
132 3300009784 Ga0123357_10001648 Ga0123357_100016483 264
133 3300009784 Ga0123357_10019640 Ga0123357_100196403 264
134 3300009784 Ga0123357_10063634 Ga0123357_100636345 264
135 3300009784 Ga0123357_10306035 Ga0123357_103060352 264
136 3300010049 Ga0123356_10052167 Ga0123356_100521672 264
137 3300010049 Ga0123356_10259128 Ga0123356_102591282 264
138 3300010049 Ga0123356_11216479 Ga0123356_112164791 264
139 3300010167 Ga0123353_10000035 Ga0123353_1000003542 264
140 3300010167 Ga0123353_10049930 Ga0123353_100499302 264
141 3300010167 Ga0123353_10436749 Ga0123353_104367492 264
142 3300010882 Ga0123354_10000978 Ga0123354_1000097826 264
143 3300010882 Ga0123354_10001198 Ga0123354_1000119817 264
144 3300010882 Ga0123354_10219760 Ga0123354_102197602 264
145 3300042608 Ga0466721_158763 Ga0466721_158763_119_913 264
146 3300042616 Ga0466715_507886 Ga0466715_507886_307_1101 264
147 3300042624 Ga0466735_021146 Ga0466735_021146_208_1002 264
148 3300042636 Ga0466703_205766 Ga0466703_205766_4652_5446 264
149 3300002462 JGI24702J35022_10001430 JGI24702J35022_100014302 265
150 3300042619 Ga0466726_246826 Ga0466726_246826_1271_2071 266
151 3300042621 Ga0466729_141880 Ga0466729_141880_513_1325 270
152 3300005201 Ga0072941_1361054 Ga0072941_13610542 277

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08843 AbiEii Nucleotidyl transferase AbiEii toxin, Type IV TA system 30 228 0.85

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.92 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.